Hélène Moussard 1
Hélène Moussard 1
Hélène Moussard 1
THÈSE
présentée et soutenue publiquement le 8 décembre 2006
pour l’obtention du
par
Hélène MOUSSARD
Composition du jury
Je tiens en premier lieu à exprimer toute ma reconnaissance à mon Directeur de thèse, Mon-
sieur Christian Jeanthon, Directeur de Recherche à la Station Biologique de Rosco, qui m'a
guidé lors de ce travail de thèse. Tes conseils avisés, ton exigence et ton esprit critique lors de la
correction des articles et de cette thèse m'ont permis sans aucun doute de valoriser au mieux ce
travail. Merci pour ta patience.
Je remercie également tous les autres membres du Jury qui me font l'honneur d'examiner
cette thèse :
Merci donc à Wafa ACHOUAK, Chargée de recherche au CEA de Cadarache ainsi qu'à
Philippe Normand, Directeur de recherche au CNRS, Université Claude Bernard Lyon I, qui ont
accepté spontanément d'être rapporteurs de ce travail ;
Merci à Puricación López-García, Chargée de recherche CNRS à l'Université de Paris Sud et
à Georges Barbier, Pofesseur à l'Université de Bretagne Occidentale, qui ont accepté d'examiner
ce travail ;
Merci à Daniel Prieur, Professeur à l'Université de Bretagne Occidentale, d'avoir présidé ce
jury. Je souhaite vous exprimer tous mes remerciements pour m'avoir accueillie au sein de votre
laboratoire, depuis le DEA jusqu'à la n de cette thèse et de m'avoir décroché une bourse au
Ministère de l'Enseignement Supérieur et de la recherche an de nancer ce travail.
Je tiens à exprimer ma profonde sympathie à toutes les personnes qui m'ont aidé technique-
ment ou moralement au cours de ce travail :
Bien sur, j'adresse un grand merci à tous les membres de l'équipe IUEM du LM2E, qui m'ont
permis de passer de bons moments en leur compagnie :
Claire Geslin, Soizick Lucas, Edmond Jolivet, Laurent Ton et Olivier Nercessian qui termi-
naient leur thèse à mon arrivée au LM2E, et avec qui j'ai partagé de très bons moments que ce
soit au laboratoire, ou en dehors du labo ;
Gaël de Erauso, mon responsable de DEA : merci à toi de m'avoir toujours soutenu, conseillé,
i
encouragé et surtout cru en moi... Merci pour tout Gaël... Bon vent à Marseille ;
Stéphane L'Haridon, merci à toi de m'avoir donné tant de conseils avisés notamment sur
la culture des micro-organismes anaérobies et les diérents métabolismes microbiens que nous
sommes susceptibles de trouver dans l'écosystème hydrothermal profond ? Merci d'avoir toujours
été disponible pour m'aider ;
Je voudrais également remercier deux étudiants que j'ai encadrés : Adélaïde Nieguitsila qui
m'a aidé à caractériser la souche Thermodesulfatator indicus, et Vincent Joue qui a travaillé
sur l'annotation génomique des fosmides. Vincent, j'espère que tu trouveras prochainement un
travail dans le domaine que tu souhaites. Merci à vous deux pour votre aide précieuse ;
Et puis, je tiens également à remercier les doctorants qui sont arrivés après moi pour les bons
moments passés en leur compagnie : les premiers furent Mélusine Gaillard et Mathieu Gonnet.
Mélusine, je te souhaite le meilleur qu'il puisse être pour ton avenir professionnel, quant à toi
Mathieu, le pro de l'informatique et de la bioinformatique : allez, au travail ! Tu es le prochain
à soutenir ta thèse, n'est-ce pas ? Vite vite ! Bon courage à toi. Il y a également Nathalie, Raja
et Erwan : je vous souhaite à tous de terminer du mieux possible votre thèse. Merci pour votre
sympathie ;
Merci également à tous les autres membres du labo : Charlotte, Nadège, Jean-Louis, Joëlle,
Marc (merci à toi d'avoir à plusieurs reprises discuté avec moi dans cette très longue dernière
ligne droite) et aux étudiants : Anne-Laure, Aurore, Olivier, Valentin et Saïd : bon stage à vous
au sein du LM2E. Très bonne idée ce petit calendrier des gourmands !
Je remercie également tous les membres de l'équipe Ifremer du LM2E. Tout d'abord, je
remercie Joël Quérellou, d'avoir toujours porté de l'intérêt à ce que je faisais. J'adresse des re-
merciements tous particuliers à Marie-Anne Cambon-Bonavita (merci pour tes précieux conseils
en phylogénie et les discussions que j'ai pu avoir avec toi), à Gislaine Henneke pour sa collabora-
tion très ecace sur la manip de l'ADN polymérase, merci à Didier Flament d'avoir aidé Vincent
lors de l'annotation des fosmides et merci à Christine tout simplement pour ta gentillesse portée
à mon égard et ta bonne humeur permanante.
Merci à vous Berry et Martha pour votre amitié : que de bons souvenirs j'ai en pensant à
vous ! Rappelez-vous, les petits plats que nous nous faisions, les sorties et ballades du WE, le
séjour au ski avec toi Martha. J'espère qu'il y aura d'autres séjours à venir d'ailleurs ! Elise, tu
es dans la dernière ligne droite, bon courage à toi. Je te souhaite que du bon pour la suite !
Merci aux deux roscovites Isabelle et Arnaud pour leur complicité. Sabrina, je ne t'oublie pas !
Accroche toi pour obtnenir un poste que tu mérites tant !
Enn, merci à Monique Briand et à Robert Marc Marc pour leur aide dans la confection
des posters scientiques et des illustrations présentées dans ce manuscrit de thèse et dans mes
ii
articles. Je tiens également à remercier Emmanuel Taboré d'avoir passé tant de temps devant
mon PC et celui de Vincent pour la mise en place de logiciels informatiques.
Bien sur, je remercie également tous mes amis du Club d'Aviron de Mer de Plougonvelin qui
m'ont encouragé et soutenu notamment pendant les moments les plus diciles : merci à vous les
lles Chantal M, Chantal N, Chantal P, Claudine, Eloise, Estelle, Sophie d'avoir cru en notre
équipage qui en a étonné plus d'un ! Merci pour tous les moments de bonheur que j'ai passé
en votre compagnie. Merci à toi Joël pour ton enthousiasme à la présidence ce club, merci au
"coatch" Xav, fournisseur ociel en tout genre de l'équipage 1 féminin, merci au concepteur du
circuit muscu qui nous a fait tant sourir mais nous a certainement bien préparé pour le cham-
pionnat de France, merci à GrandFred, Franck, Hervé pour votre amitié et les bons moments
passés en votre compagnie.
Enn, je voudrais remercier mes parents, mon frère, mes grands parents et Frédéric. Je vous
dédie cette thèse. Encore merci à toi Frédéric d'avoir su m'encourager, de m'avoir soutenue, de
m'avoir épaulée, d'avoir pris le temps de relire ce manuscrit qui pourtant parlait de choses qui
t'étaient totalement inconnues.
iii
iv
Sommaire
Introduction 1
Chapitre 1
La microbiologie, de ses débuts à l'ère de la génomique 3
Chapitre 2
L'ère de la métagénomique 29
Chapitre 3
L'écosystème hydrothermal marin 69
Chapitre 4
Objectifs de la thèse 91
Matériels et Méthodes 97
Construction et criblage de la banque métagénomique 99
Résultats 111
Étude 1
Novel uncultured Epsilonproteobacteria dominate a lamentous sulphur mat
from the 13o N hydrothermal vent eld, East Pacic Rise 113
Sommaire
Étude 2
Characterization of a 40 kbp uncultivated euryarchaeotal fosmid from a mi-
crobial community associated to the hydrothermal vent polychaete annelid,
Alvinella pompejana 139
Étude 3
Thermophilic lifestyle for an uncultured archaeon from hydrothermal vents :
evidence from environmental genomics 167
Annexes 225
Annexe A
Banques de données de séquences nucléiques et protéiques 227
Annexe B
Composés chimiques des environnements hydrothermaux marins profonds 231
Annexe C
Publication de l'article : Thermodesulfatator indicus gen. nov., sp. nov., a
novel thermophilic chemolithoautotrophic sulfate-reducing bacterium isolated
from the Central Indian Ridge 235
Bibliographie 245
vi
Liste des abréviations
ARNr 16S : sous-unité 16S de l'ARN ribosomial MEB : microscopie électronique à balayage
ATP : adénosine tri-phosphate ORF : open reading frame (cadre ouvert de lec-
CDS : coding DNA sequence, désigne une région RBS : ribosome binding site
codante située entre une méthionine et un codon RFLP : restriction fragment length polymor-
stop phism
vii
Liste des abréviations
viii
Liste des gures
Introduction
Chapitre 1
Fig. 1 Principe de fonctionnement d'une colonne de Winogradsky. . . . . . . . . . . 6
Fig. 2 Arbre universel du vivant basé sur l'analyse des gènes codant les ARNr (16S
et 18S) des petites sous-unités des ribosomes. . . . . . . . . . . . . . . . . . 14
Fig. 3 Structure secondaire de la molécule d'ARNr 16S basée sur la stucture d'Escherichia
coli. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 15
Fig. 4 Phylogénie illustrant l'évolution des connaissances des phyla bactériens de-
puis Woese en 1987. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 18
Fig. 5 Diversité des phyla archaéens. . . . . . . . . . . . . . . . . . . . . . . . . . . 19
Fig. 6 Structure des gènes chez les Bacteria. . . . . . . . . . . . . . . . . . . . . . . 23
Fig. 7 Consensus des promoteurs de la transcription chez diérents groupes archaéens. 24
Fig. 8 Représentation schématique du complexe de pré-initiation et des promoteurs
dans les trois domaines de la vie. . . . . . . . . . . . . . . . . . . . . . . . . 25
Chapitre 2
Fig. 1 Principe de la construction et du criblage d'une banque métagénomique. . . 32
Fig. 2 Représentation schématique des deux approches utilisées pour extraire de
l'ADN génomique contenu dans un échantillon solide. . . . . . . . . . . . . . 37
Fig. 3 Enrichissement d'un échantillon en ADN génomique d'intérêt, par la tech-
nique du BrdU ou par la technique SIP. . . . . . . . . . . . . . . . . . . . . 40
Fig. 4 Assemblage de l'ébauche génomique après séquençage aléatoire global. . . . 49
Liste des gures
Chapitre 3
Fig. 1 Principe général de la tectonique des plaques. . . . . . . . . . . . . . . . . . 72
Fig. 2 Les trois types de dorsales océaniques. . . . . . . . . . . . . . . . . . . . . . 73
Fig. 3 Localisation des dorsales océaniques et des sites hydrothermaux marins étu-
diés par les biologistes. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 74
Fig. 4 Principe de la circulation de l'eau de mer dans la croûte océanique, au niveau
des zones d'expansion. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 75
Fig. 5 Quelques représentants de la faune hydrothermale marine profonde. . . . . . 79
Fig. 6 Localisation des principaux habitats microbiens des sources hydrothermales
marines. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 82
Fig. 7 Arbre phylogénétique illustrant les nouvelles lignées d'Archaea (en gras)
mises en évidence dans les sources hydrothermales marines profondes. . . . . 89
Résultats
Étude 1
Fig. 1 Quelques photographies de mattes microbiennes observées sur des sites hy-
drothermaux profonds. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 116
Fig. 2 Formation de biolms hydrothermaux contenant des laments de soufre d'ori-
gine bactérienne. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 117
x
Liste des gures
Étude 3
Fig. 1 Distribution des distances entre les boîtes TATA et les codons d'initiation de
la traduction prédits. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 200
Fig. 2 Alignement de séquences d'ADN polB de diérentes Euryarchaeota. . . . . . 203
Discussion générale
Fig. 1 Caractéristiques physiologiques des ε-Proteobacteria isolées d'habitats hydro-
thermaux marins profonds et de quelques autres environnements sélectionnés. 209
Fig. 2 Etudes publiées relatant la présence de DHVE2 dans les banques de clones
d'Archaea. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 219
Fig. 3 Arbre phylogénétique illustrant la souche Aciduliprofundum boonei , cer-
trains représentants des DHVE2 dont Alv-FOS4 et des Euryarchaeota. . . . 220
xi
Liste des gures
xii
Liste des tableaux
Introduction
Chapitre 1
Tableau 1 Exemples de processus physiologiques catalysés par les micro-organismes. . . 8
Tableau 2 Pourcentage de micro-organismes cultivables provenant de diérents habitats. 9
Tableau 3 Niveaux d'analyse informatique des séquences génomiques. . . . . . . . . . . 22
Chapitre 2
Tableau 1 Nouvelles enzymes et biocatalyseurs découverts suite au criblage fonctionnel
de banques métagénomiques. . . . . . . . . . . . . . . . . . . . . . . . . . . . 35
Tableau 2 Exemples de criblages de banques métagénomiques basés sur la recherche
d'activités antimicrobiennes. . . . . . . . . . . . . . . . . . . . . . . . . . . . 35
Tableau 3 Les avantages et les inconvénients d'une banque métagénomique à petits
inserts ou à grands inserts. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 42
Tableau 4 Comparaison de stratégies : criblage basé sur l'activité versus criblage basé
sur la séquence. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 45
Tableau 5 Analyses métagénomiques impliquant des Archaea incultivées. . . . . . . . . 52
Chapitre 3
Tableau 1 Types de métabolismes microbiens pouvant être observés au niveau des sources
hydrothermales océaniques profondes. . . . . . . . . . . . . . . . . . . . . . . 84
Liste des tableaux
Matériels et Méthodes
Tableau 1 Liste des amorces utilisées pour l'amplication par PCR de fragments d'ADNr
16S archaéens et de fragments d'ARNr 18S eucaryotes. . . . . . . . . . . . . 109
Résultats
Étude 1
Tableau 1 Résultats obtenus après amplication des gènes aclB, oorA et des gènes co-
dants pour les ARNr 16S . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 136
Étude 2
Tableau 1 Aliations phylogénétiques des séquences d'ADNr 16S bactériennes de la
communauté microbienne associée aux tubes d'A. pompejana. . . . . . . . . 164
Étude 3
Tableau 1 Nombre de gènes prédits chez Alv-FOS1 et Alv-FOS4 par les diérents pro-
grammes utilisés. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 199
xiv
Introduction
Chapitre 1
La microbiologie, de ses débuts à l'ère de la génomique 3
Chapitre 2
L'ère de la métagénomique 29
Chapitre 3
L'écosystème hydrothermal marin 69
Chapitre 4
Objectifs de la thèse 91
2
Chapitre 1
4
Chapitre 1. La microbiologie, de ses débuts à l'ère de la génomique
L'histoire des micro-organismes en biologie commence il y a un peu plus de 300 ans, avec
la mise au point du microscope par Antonie van Leewenhoek (1632-1723). Cet instrument lui
permis d'observer pour la première fois des micro-organismes appelés alors animalcules. Ce n'est
qu'à la n du XVIIIème siècle, que l'existence de ces animalcules fut conrmée par l'allemand
Müller.
5
Chapitre 1. La microbiologie, de ses débuts à l'ère de la génomique
air
Concentration en sulfures
Fig. 1 Principe de fonctionnement d'une colonne de Winogradsky. La phase supérieure reproduit les conditions
retrouvées dans le milieu liquide (luminosité, aération) alors que la phase inférieure reproduit les conditions
des premiers centimètres de sédiments (obscurité, augmentation du potentiel réducteur). Au cours du temps,
l'établissement de la ore microbienne s'eectue en fonction de leur préférendum au sein des gradients (d'après
Madigan, 1996).
6
Chapitre 1. La microbiologie, de ses débuts à l'ère de la génomique
(Hungate, 1950).
7
Chapitre 1. La microbiologie, de ses débuts à l'ère de la génomique
essentiel dans le fonctionnement des processus biogéochimiques sur Terre et sont à la base de
nombreux processus écologiques. La biosphère dépend totalement de l'activité microbienne (Ta-
bleau 1). Les micro-organismes interviennent entre autre dans la décomposition du sol, dans la
genèse et la régulation de la composition de l'atmosphère terrestre, dans la xation de l'azote et
dans la photosynthèse. Ils participent également à la détoxication de nombreux composés orga-
niques et inorganiques (Madsen, 2005). Les micro-organismes catalysent de nombreuses réactions
d'oxydo-réduction qui sont au centre de cycles biogéochimiques d'éléments majeurs tels que le
carbone, l'azote, le soufre, le phosphore et les métaux. Les micro-organismes sont les premiers
responsables des changements géochimiques de la planète, cela d'autant plus que la biomasse
globale des procaryotes est approximativement équivalente à celle de toutes les autres formes de
vies (eucaryotes) (Whitman et al., 1998).
Solvents chlorés Composés déchlorinés par respiration dans les habitats anaérobies Sol, Sw, Est
Cycle de l’azote
Fixation de l’azote N2 devient NH3 Sol, Em
– –
Oxydation de NH 4+ NH3 devient NO 2 , NO 3 Sol, Sw
+
Oxydation anaérobie de NH 4 NO 2– et NH 3 deviennent N 2 EmS, Sw
Dénitrification NO3– accepteur d’électrons devient N 2 Sol, Sw
Cycle du soufre
Oxydation des composés soufrés S 2– et S 0deviennent SO42– EmS, EdS
Réduction des sulfates SO42– accepteur d’électrons, devient S 0 et S 2–
EmS, Sw, Est
Autres éléments
Oxydation de H 2 H2 est oxydé en H + , les éléctrons réduisent d’autres composés Sw, sol, EmS, EdS
2+
Méthylation et réduction de Hg Hg organique formé et Hg est converti en Hg EdS, EmS
Réduction de (per)chlorate Les oxydants sont convertis en chlorides Est
Réduction de l’uranium L’oxyanion U est utilisé comme accepteur d’électron Est
Réduction de l’arsenique L’oxyanion As est utilisé comme accepteur d’électron EdS, Est
Oxydation du fer Oxydation des minerais de FeS EdS, Est
Abrévations des habitats: Ed, eau douce; EdS, sédiments d’eau douce, Est, eau souterraine; EmS, sédiments océaniques; Em, eau de mer; Sw, eau d’égouts; Est, eau souterraine
MTBE, methyl tertiary butyl ether
Tableau 1 Exemples de processus physiologiques catalysés par les micro-organismes (d'après Madsen, 2005).
8
Chapitre 1. La microbiologie, de ses débuts à l'ère de la génomique
2.3 Une minorité de micro-organismes est cultivable par les techniques clas-
siques de culture
Malgré le succès remporté par les techniques d'enrichissement et d'isolement en culture pure,
il est reconnu que pour la majorité des environnements, on ne sait cultiver qu'une très faible
partie des micro-organismes présents dans un échantillon. Le constat est frappant : la fraction
cultivable des micro-organismes ne représenterait qu'une très faible proportion (0.05 à 10%) de
la diversité totale estimée des procaryotes dans la biosphère (pour revue, Amann et al., 1995 ;
Pace, 1997) (Tableau 2).
9
Chapitre 1. La microbiologie, de ses débuts à l'ère de la génomique
organismes incultivés du sol avaient leur croissance inhibée par des concentrations trop
élevées en nutriments dans les milieux de culture couramment utilisés en microbiologie,
Janssen et ses collaborateurs (2002) tentèrent de les cultiver en utilisant des milieux de
culture dilués. An de favoriser la croissance des micro-organismes à taux de croissance
lent, ils augmentèrent les temps d'incubation jusqu'à 10 semaines. Par cette approche, ils
réussirent à isoler et purier de nouveaux organismes présents dans le sol. Button qui mit
au point une méthode de culture par dilution pour cultiver les micro-organismes présents
dans les environnements aquatiques oligotrophes montra que l'addition de nutriments dans
les milieux de culture pouvaient stimuler la croissance de quelques micro-organismes, mais
que cela inhibait la croissance de la majorité d'entre eux (Button et al., 1993).
La diculté de cultiver les micro-organismes sur milieu gélosé peut aussi venir du fait que
les micro-organismes vivent rarement sous forme libre, mais plutôt sous forme de biolms
attachés à des surfaces (Davey & O'Toole, 2000). Les biolms microbiens favorisent les in-
teractions inter-bactériennes en facilitant la diusion de molécules signales synthétisées par
les bactéries douées de quorum sensing. Le quorum sensing, initialement découvert chez des
bactéries bioluminescentes a maintenant été identié chez de nombreuses bactéries à Gram
négatif et positif (Whitehead et al., 2001 ; Waters & Bassler, 2005). Ce mécanisme de com-
munication inter-bactérienne dépend de la densité bactérienne. Les techniques classiques
d'enrichissement ne favorisent pas la formation de biolms, limitant ainsi la communica-
tion inter-bactérienne. Bruns et ses collaborateurs (2003) ont montré que l'ajout dans un
milieu de culture de petites molécules signales telles que de l'AMPc et des acylhomosérines
lactones (synthétisées par les bactéries capables de quorum sensing) augmentait le succès
de la culture de certains organismes.
De nombreux micro-organismes développent des relations particulières de symbiose avec
d'autres organismes (ces symbioses peuvent être obligatoires ou facultatives, de l'ordre du
mutualisme ou du parasitisme, impliquant des ecto- ou des endosymbioses), et ne peuvent
être cultivés indépendamment de leur hôte (Amann et al., 1995).
Certaines bactéries entrent dans un état de dormance dit état viable mais non cultivable
(VBNC) lorsqu'elles sont confrontées à des conditions inadéquates à leur physiologie et
métabolisme : par exemple une exposition à de l'eau salée, à de l'eau douce, à des mi-
lieux oligotrophes, à une pression osmotique ou un pH qui ne leur convient pas ou à de
faibles températures (Byrd et al., 1991 ; Colwell, 2000). Une étude menée par Colwell
(2000) montra que les souches bactériennes de Vibrio cholerae isolées d'environnements
aquatiques n'étaient pas directement cultivables sur milieu gélosé. Ces bactéries échap-
pant aux techniques de culture étaient pourtant viables. En eet, après leur passage dans
un intestin de souris ou d'humain, ces mêmes bactéries étaient de nouveau cultivables et
ré-exprimaient leur pouvoir pathogène. Dans l'état VBNC, ces bactéries qui sont pour-
tant métaboliquement actives, ne peuvent pas être détectées par les milieux de culture
10
Chapitre 1. La microbiologie, de ses débuts à l'ère de la génomique
Nous avons vu que certains micro-organismes doués de quorum-sensing vivaient sous forme
de biolms. Ces biolms sont essentiels, ils facilitent les communications intercellulaires. Pour
favoriser la formation des biolms, un système de culture en ux continu et sur support solide (le
support solide étant une lame de verre ou de polycarbonate) (système de culture nommé CFSC
pour Continuous-Flow Side Culture) a été récemment mis au point (Stach & Burns, 2002). Stach
et Burns (2002) ont réussi par cette méthode d'enrichissement à obtenir à partir d'un même
échantillon trois fois plus de diversité génétique que celle obtenue dans des conditions classiques
de culture.
Zengler a quant à lui récemment mis au point une technique d'enrichissement et d'isolement à
haut débit (Zengler et al., 2002). Cette technique consiste à individualiser des micro-organismes
dans des microcapsules d'agarose. Ces microcapsules sont alors placées dans diérents milieux de
culture pour incubation. Les colonies qui se forment dans les microcapsules sont ensuite détectées
puis isolées par cytométrie en ux. Cette approche permet le libre échange de composés chimiques
entre les micro-organismes d'une même communauté.
11
Chapitre 1. La microbiologie, de ses débuts à l'ère de la génomique
Plus tard, les critères morphologiques furent associés à des caractères physiologiques et bio-
chimiques pour pouvoir servir à la classication des micro-organismes (Kluyver & Van Niel,
1936). Cependant, ces méthodes aboutissaient parfois à des classications contradictoires. En
eet, les critères physiologiques et biochimiques n'étaient pas encore susamment bien connus
pour pouvoir servir à la classication des micro-organismes. De plus ces méthodes étaient limi-
tées dans la mesure où elles ne permettaient pas d'établir avec pertinence des liens de phylogénie
entre les micro-organismes. Deux espèces peuvent en eet avoir des caractères morphologiques
et/ou physiologiques identiques sans qu'on puisse pour autant leur attribuer une descendance
commune. Ainsi, la plupart des relations de parenté qui unissent les grands genres bactériens
demeurait à l'époque inconnue.
12
Chapitre 1. La microbiologie, de ses débuts à l'ère de la génomique
Les molécules dont la séquence primaire change aléatoirement au cours du temps peuvent
être considérées comme un marqueur phylogénétique ou une horloge moléculaire (Woese, 1987).
Cependant toute molécule ne peut être utilisée à des ns phylogénétiques. Un bon marqueur
moléculaire doit répondre aux critères suivants :
il doit être universel et ne pas être soumis à des événements de transferts horizontaux de
gènes,
les permutations dans sa séquence doivent être aussi aléatoires que possible,
sa vitesse d'évolution doit être adaptée à la gamme des distances évolutives devant être
mesurée (elle ne doit ni évoluer trop vite sous peine de masquer les changements ancestraux,
ni évoluer trop lentement au risque d'occulter les changements récents),
enn, il doit contenir une information génétique susante.
13
Chapitre 1. La microbiologie, de ses débuts à l'ère de la génomique
Fig. 2 Arbre universel du vivant basé sur l'analyse des gènes codant les ARNr (16S et 18S) des petites
sous-unités des ribosomes (d'après Woese et al., 1990). L'arbre du vivant montre les 3 domaines du vivant :
les Bacteria, les Archaea et les Eucarya. Les nombres à côtés des branches correspondent aux groupes d'orga-
nismes suivants : 1, Thermotogales ; 2, Flabobactéries ; 3, Cyanobactéries ; 4, Bactéries pourpres ; 5, Bactéries
Gram-positif ; 6, Bactéries vertes non sulfureuses ; 7, le genre Pyrodictium ; 8, le genre Thermoproteus ; 9, Ther-
mococcales ; 10, Methanococcales ; 11, Methanobacteriales ; 12, Methanomicrobiales ; 13, Halophiles extrêmes ;
14, Métazoaires ; 15, Ciliés ; 16, Plantes ; 17, Algues ; 18, Flagellés ; 19, Microsporidies
les produits de cette réaction sont ensuite séparés par migration éléctrophorétique bidimension-
nelle. Chaque espèce est alors caractérisée par le prol de migration d'oligonucléotides de son
ARNr 16S.
Le choix de l'ARNr 16S/18S par Woese pour établir la phylogénie universelle du vivant n'est
pas fortuit. Les ARNr 16S sont d'ailleurs à ce jour les marqueurs moléculaires les plus utilisés
pour établir des liens phylogénétiques entre les organismes. Les raisons en sont les suivantes
(Woese, 1987) :
les ARNr sont des constituants des ribosomes, dont la fonction n'a pas changé depuis
environ 3.8 milliards d'années. (chez les procaryotes, il existe trois types d'ARNr : les
ARNr 5S (120 pb) et ARNr 23S (3000 pb) qui constituent la sous-unité 50S d'un ribosome,
et l'ARNr 16S (1500 pb) constituant la sous-unité 30S d'un ribosome),
les gènes codant les ARNr 16S sont universels, ils sont présents dans toutes les cellules
procaryotes,
leur taille d'environ 1 540 pb contient susamment d'information génétique pour permettre
d'établir des phylogénies robustes,
leur séquence primaire composée de positions variables et conservées permet d'établir des
liens phylogénétiques entre les organismes appartenant à diérents niveaux taxonomiques
pouvant aller du domaine à l'espèce (Fig. 3),
le transfert de gènes horizontaux n'a pas encore été observé chez les procaryotes.
Les analyses phylogénétiques basées sur les séquences de l'ARNr 16S ont ouvert une nou-
14
Chapitre 1. La microbiologie, de ses débuts à l'ère de la génomique
Fig. 3 Structure secondaire de la molécule d'ARNr 16S basée sur la stucture d'Escherichia coli (Maidak et
al., 1994)35.Yusupov, M. M., Yusupova, G. Zh., Baucom, A., Lieberman, K., Earnest, T. N., Cate, J. H. D.,
and Noller, H. F. (2001) Science, 292, 883-896. . Les régions hypervariables sont en rouge ; les régions conservées
sont en vert. Les sites d'hybridation des amorces utilisées traditionnellement pour l'amplication génique par
PCR sont en bleu, et le sens d'amplication est noté par des èches. Les autres nucléotides sont en noir.
15
Chapitre 1. La microbiologie, de ses débuts à l'ère de la génomique
velle ère pour la biologie évolutive. L'utilisation de ce marqueur moléculaire a été adoptée par la
majorité des écologistes moléculaires. Cependant les séquences d'ARNr 16S ne sont pas idéales
et les progrès méthodologiques dans le domaine de la reconstruction phylogénétique ont mis en
évidence diérents artéfacts liés à l'utilisation de ces séquences comme par exemple le biais de
composition en G+C chez les organismes hyperthermophiles (Galtier & Lobry, 1997) ou les phé-
nomènes d'attraction des longues branches (Philippe & Germot, 2000).
D'autres marqueurs alternatifs à l'ARNr 16S ont cependant d'ores et déjà été utilisés avec
succès pour étudier la phylogénie des procaryotes. C'est le cas des molécules suivantes : l'ARNr
23 S (ARNr des grosses sous-unité des ribosomes), les facteurs d'élongation EF-Tu/-1α EFG,
les ARN polymerases, la sous-unité β de l'ATPase F1/FO, la protéine RecA, les protéines de
choc thermique Hsp60 et Hsp70, les ADN polymérases de la famille B et les ADN gyrases et
topoisomérases (Ludwig & Klenk, 2001). L'utilisation de ces marqueurs alternatifs a permis
la construction d'arbres phylogénétiques qui conrment dans la plupart des cas la phylogénie
observée avec les ARNr 16S.
16
Chapitre 1. La microbiologie, de ses débuts à l'ère de la génomique
approche moléculaire a été intensément exploitée ces dix dernières années dans des habitats ter-
restres et aquatiques.
Quand Carl Woese proposa il y a vingt ans de cela une phylogénie des bactéries basée sur
les ARNr 16S, il répertoria 12 phyla bactériens distincts, chacun d'entre eux possédant des re-
présentants cultivés (Woese, 1987). Depuis, quarante et un nouveaux phyla ont été identiés en
vingt ans d'inventaires moléculaires réalisés dans de nombreux environnements, ce qui conduit à
un total de 53 phyla bactériens (Rappe & Giovannoni, 2003). Parmi ces derniers, 26 phyla n'ont
pas de représentant cultivé et ont été identiés uniquement grâce à leur signature d'ARNr 16S
(Fig. 4). Quant aux Archaea, les premières d'entre elles à être identiées suite à des inventaires
moléculaires furent des Crenarchaeota. Ces dernières constituent avec les Euryarchaeota les deux
divisions archéennes initialement décrites par Woese et ses collaborateurs (1990). Ces Crenar-
chaeota ont été identiées dans des échantillons de plancton marin (DeLong, 1992 ; Fuhrman
et al., 1992). Quelques années plus tard, d'autres séquences d'ARNr 16s aliées aux Crenar-
chaeota furent identiées dans des environnements terrestres (Bintrim et al., 1997 ; Jurgens
et al., 1997, 1999). Cette surprenante découverte a révélé que les Archaea ne colonisaient pas
uniquement les habitats extrêmes comme on le pensait initialement, mais qu'elles s'étendaient
également aux habitats les plus communément répandus sur Terre. Depuis de nouveaux phylo-
types d'Archaea ont été détectés dans la plupart des environnements. En comparant les séquences
d'ARNr 16S, Philip Hugenholtz recensait il y a trois ans de cela, un total de 18 phyla archéens,
dont 10 ne contiennent pas encore de représentant cultivé (Hugenholtz, 2002). Depuis, près de
8000 séquences d'ARNr 16S archéennes ont été déposées dans des banques de données, consti-
tuant souvent de nouvelles lignées phylogénétiques au sein des Archaea (Schleper et al., 2005)
(Fig. 5).
L'approche moléculaire a ainsi montré que dans la plupart des environnements, la majorité
de la diversité microbienne (plus de 99 % tous environnements confondus) restait inaccessible
par des approches culturales classiques (Amann et al., 1995 ; Torsvik & Ovreas, 2002). Un grand
nombre de nouvelles lignées phylogénétiques à la fois chez les Bacteria et les Archaea mais aussi
au sein des Eucarya (Diez et al., 2001 ; Lopez-Garcia et al., 2003b) ont été mises en évidence
grâce aux inventaires moléculaires. Cette approche a permis d'établir une classication de tous les
organismes, cultivés ou non. L'heure est maintenant d'étudier le génome des micro-organismes,
cultivés ou non, an de comprendre leur rôle, leur organisation et leur fonctionnement dans la
biosphère.
17
Chapitre 1. La microbiologie, de ses débuts à l'ère de la génomique
Fig. 4 Phylogénie illustrant l'évolution des connaissances des phyla bactériens depuis Woese en 1987 (Woese,
1987). Les segments en noir montrent les phyla originaux décrits par Woese en 1987. Les segments blancs
représentent les 14 phyla contenant des espèces cultivées, découverts depuis 1987. Les segments en gris indiquent
les 26 phyla candidats qui ne contiennent pas d'espèces cultivées (d'après Rappe & Giovannoni, 2003).
18
Chapitre 1. La microbiologie, de ses débuts à l'ère de la génomique
Group II ANME-1B
FOS-GZfos25D1(1D1)
DCM group FOS-GZfos34G5
DCM65231 FOS-GZfos1C11
SG-IBEA_CTG_2081753 HydCal61
KTK 31A HydBeg01
SB95-72 BS-S-E1
COS-DeepAnt-JyKC7 BS-K-411
DCM3921 BS-SR-D3
WHAR N
ANTARCTIC 5 BS-R-B8
Thermoplasmata PVA OTU 1 BS-S-D7
TS10C294 HydCal52
ASL/SC group GIN492 BS-M-D6
SC38 DCM875 Eel-36a2G10
ARCP1-60 DH148-W1 0.05 BS-S-E7 0.01
SG- Thermoplasmatales archaeon Gp1 SBAR 16 BS-M-A7
SG- Ferroplasma acidarmanus Type I
SG- Ferroplasma sp. Type II DHVE6 Euryarchaeota ANME-1A
Ferromonas metallovorans GBa1r010
SC42 DHVE3 GBa1r013
MS14 pISA16 pISA14
Picrophilus oshimae PENDANT-33
Picrophilus torridus FOS-GZfos12E1
Thermoplasma acidophilum FOS-GZfos10C7
Thermoplasma acidophilum Halobacteria FOS-GZfos27G5
BS-SR-C1-Arch
MarB
Thermoplasma volcanium 0.05 BS-SR-G10
Thermoplasma volcanium BS-R-A1
Group III
e
SB-17a1A11 0.01
nth G
Methanomicrobiales SB-17a1A2
SAGMA-
Group II SA1
ANME-1-GBa
pE
S/T ANME-1B
WH
Rice
CA
VADIN cluster I ANME-
Thermoplasmata 1-AT
ANME-1A
ANME-2C
SAGMA1 C1_R004
DHVE1 Methanosaetaceae CS_R012
Methanobacteriales Eel-36a2A5
ANME-2A/B SB-24a1A12
C1_R019
ANME-2C HydBeg05
HydBeg22
Archaeoglobi
FOS-GZfos26E7
0.05 ARC1 HydBeg125
Methanococcales FOS-GZfos18C8
ANME-3/
Methano- SB-17a1D3
Methanosarcina SB-17a1B11
coccoides Methanolobus/ Eel-36a2A1
DHVE4 Thermococcales AT_R007 0.01
Methanopyrus Methanohalophylus C1_R048
Group I.1A kandleri
pOWA133 AAG
Korarchaeota
Nanoarchaeum equitans
Thermoproteales
SAGMCG-1
Desulfurococcales
FFS
Fig. 5 Diversité des phyla archaéens. La phylogénie présentée ici a été reconstruite à partir de séquences
d'ARNr 16S avec les méthodes de vraisemblance et de maximum de parcimonie. Les epèces non cultivées qui ont
fait l'objet d'études génomiques sont détaillées dans les boîtes. Les triangles avec les couleurs claires représentent
les branches constituées uniquement d'espèces non cultivées et ceux avec des couleurs sombres représentent les
branches où il y a des espèces cultivées. La taille des triangles est proportionnelle à la quantité de séquences
analysées (d'après Schleper et al., 2005).
19
Chapitre 1. La microbiologie, de ses débuts à l'ère de la génomique
5 L'ère de la génomique
L'origine du terme génomique est récente et fut proposé par Tom Roderick en 1989 pour
désigner la science ayant pour sujet l'étude des génomes. Cette nouvelle discipline vise à iden-
tier l'ensemble des gènes d'un organisme vivant. La première séquence d'un génome, celle du
bactériophage phiX174 (5386 pb) fut publiée en 1977 (Sanger et al., 1977). Plusieurs génomes de
virus, chloroplastes et mitochondries furent ensuite séquencés pendant les 18 années qui suivirent.
Ce n'est qu'en 1995, que le premier génome bactérien fut séquencé. Il s'agissait de la bactérie
Haemophilus inuenza dont la séquence (chromosome circulaire de 1830 kpb) fut annotée et
publiée par l'équipe américaine du TIGR dirigée par Craig Venter (Fleischmann et al., 1995).
Le premier génome d'archée entièrement séquencé fut celui de Methanocaldococcus jannaschii (1
chromosome circulaire de 1664 kpb et deux plasmides de 58 kpb et 16 kpb) (Bult et al., 1996).
La séquence génomique de Sacharomyces cerevisiae (16 chromosomes, 12 Mpb) fut quant à elle
la première séquence complète d'un génome eucaryote à être publiée (Goeau et al., 1996).
Par dénition, le gène désigne une séquence nucléotidique (ADN ou ARN) nécessaire à la syn-
thèse d'une protéine ou d'un ARN structural. Les principaux ARN structuraux des organismes
20
Chapitre 1. La microbiologie, de ses débuts à l'ère de la génomique
procaryotes sont les ARN de transferts (ARNt) et les ARN ribosomaux (ARNr). Les ARNr sont
des constituants des ribosomes. Les ARNt quant à eux permettent le transfert des acides aminés
le long d'une chaîne polypeptidique en cours de formation lors de la traduction.
D'autres critères permettent de distinguer les génomes procaryotes et eucaryotes. Tout d'abord,
la séquence de chaque gène est continue dans les génomes procaryotes (il n'y a pas d'introns).
Enn, les gènes des procaryotes sont fréquemment organisés en opéron (ensembles de gènes loca-
lisés les uns à la suite des autres, transcrits de façon coordonnée, sous le contrôle d'une protéine
régulatrice). Les protéines ainsi produites peuvent intervenir dans une même voie métabolique,
ou bien constituer les diérentes sous-unités d'une protéine multimérique.
Les RBS Ils sont en général situés 8 à 10 pb en amont du site du démarrage de la traduction
et caractérisés par un motif Shine-Dalgarno (SD), une séquence de 6 pb riche en purine et
complémentaire à l'extrémité 3' de l'ARNr 16S. Cette séquence qui s'apparie à l'extrêmité 3'
de l'ARNr 16S permet au ribosome de repérer le codon start. Ce motif est sujet à peu de
variations chez les procaryotes, reet de la conservation des séquences d'ARNr 16S. Le programme
RBSnder (http://www.genomics.jhu.edu/RBSfinder/) permet de localiser les RBS.
21
Chapitre 1. La microbiologie, de ses débuts à l'ère de la génomique
Annotation Objectifs
Analyse structurale
Àl’échelle nucléique
• Usage du code génétique des régions codantes Identification des gènes
• Statistiques sur les mots (oligonucléotides /
recherche de répétitions) Identification des régions de transferts horizontaux
• Recherche de signaux
et de régions promotrices
• Comparaison avec les banques d’ADNc
Àl’échelle protéique
• Comparaison avec les banques de séquences protéiques
• Recherche de motifs structuraux
• Recherche de régions transmembranaires, Caractérisation de la fonction biologique des gènes identifiés
de peptides signaux
• Prédiction de structures secondaires et tertiaires
Analyse fonctionnelle
Génomique comparative
• Construction de familles d’orthologues Identification des signaux de régulation conservés au voisinage des orthologues
• Analyse de l’organisation génomique en groupe Étude des interactions physiques entre gènes voisins (interactome)
de synténie Approche de la fonction biologique des gènes par exploration de voisinage
• Reconstruction des voies métaboliques par (similarité en séquence inter-espèce, voisinage chromosomique et métabolique)
comparaison avec des génomes modèles Identification des fonctions absentes ou spécifiques d’un génome donné
• Analyse «différentielle» des gènes de l’organisme Caractérisations des erreurs d’annotation
avec des génomes modèles voisins
Tableau 3 Niveaux d'analyse informatique des séquences génomiques (d'après Médigue et al., 2002).
22
Chapitre 1. La microbiologie, de ses débuts à l'ère de la génomique
CELLULE PROCARYOTE
ADN
5’ 3’
3’ 5’
5’ 3’ ARNm
AUG ou UAG ou
GAGGAG {3 à 5 bp} UACGCUAGACGUAUAUGCAUGCUGA C ...
UUG ou UGA ou
Site RBS CUG UAA
Codon START Codon STOP Ala Cys Thr Ile Glu Met AspTyr GlnCys...
23
Chapitre 1. La microbiologie, de ses débuts à l'ère de la génomique
Fig. 7 Consensus des promoteurs de la transcription chez diérents groupes archaéens (d'après Brinkmann,
2002).
comprend trois éléments : la boîte -35, la boîte TATA vers -10 et le site d'initiation de la trans-
cription. L'étude de diérents génomes d'Archaea, de Bacteria et d'Eukarya, a montré que la
structure du promoteur des Archaea correspondait quant à lui, à une version simpliée de celui
des Eukarya (Bell & Jackson, 1998). Les promoteurs archaéens ont des séquences de type boîte
TATA située environ 30 pb en amont du site d'initiation de la transcription et une boîte BRE
(élément de reconnaissance du facteur B) située en amont de la boîte TATA (Brinkmann, 2002)
(Fig. 7). Aucun programme de prédiction de promoteur archaéen n'est disponible, une recherche
manuelle des motifs consensus est donc eectuée pour les localiser.
Dans le modèle archaéen du complexe d'initiation de la transcription interviennent : une
ARN polymérase de type II, la protéine TBP (TATA-box Binding Protein) et les facteurs de
transcription TFB (Transcription Factor B) et TFE (Transcription Factor E). La protéine TBP
se xe sur la boîte TATA et permet le recrutement de l'ARN polymérase à l'aide du TFB. Ce
dernier se xe sur le BRE (TFB Recognition Element) (Fig. 8).
La terminaison de la transcription chez les procaryotes peut s'eectuer selon deux systèmes
qui se distinguent sur l'intervention ou non du facteur protéique rho. Le système rho-dépendant
n'a pas été identié chez les Archaea (Washio et al., 1998 ; Brinkmann, 2002). Le second système
dit rho-indépendant a lui été identié aussi bien chez les bactéries que chez des archées. Chez
ces dernières, le système de terminaison repose sur une séquence riche en thymidines. Cette
succession de thymidines sur le brin d'ADN n'est pas précédée de séquences pouvant former des
structures en tige boucle comme il a été observé dans le système rho-indépéndant de terminaison
des bactéries (Santangelo & Reeve, 2006).
24
Chapitre 1. La microbiologie, de ses débuts à l'ère de la génomique
TFIIF
RNAP II TFIIH
TAFs
TFIIE
TBP
TFIIA
BRE TATA INR
Eukarya DPE
TFIIB
TFIIB
RNAP
TBP
TFE
Archaea BRE TATA INR
TFB
RNAP
Bacteria - 35 - 10
Fig. 8 Représentation schématique du complexe de pré-initiation et des promoteurs dans les trois domaines
de la vie (d'après Brinkmann, 2002). Les facteurs avec un contour noir en pointillé correspondent aux protéines
absentes chez les Archaea. INR, codon start ; RNAP, ARN polymérase.
25
Chapitre 1. La microbiologie, de ses débuts à l'ère de la génomique
méthionine ATG est préférentiellement utilisé. Il peut représenter 70 à 90% des codons d'initiation
prédits chez la plupart des génomes archaéens (Torarinsson et al., 2005). Les codons stop sont
quant à eux les suivants : TAA, TAG ou TGA.
Prédiction des séquences codantes La prédiction des ARNr sur une séquence génomique
est assez simple dans la mesure où leurs séquences sont relativement bien conservées. Il sut donc
de rechercher le long de la séquence génomique des similitudes avec des séquences d'ADNr/ARNr
en utilisant des programmes tels que BLAST (http://www.ncbi.nlm.nih.gov/BLAST) (Altschul
& Lipman, 1990). Les ARNt quant à eux ont la particularité d'adopter une structure secondaire
qui leur est propre. Des logiciels tel que tRNAscan-SE (http://www.genetics.wustl.edu/eddy/
tRNAscan-SE) (Lowe & Eddy, 1997) reposent sur cette propriété des ARNt pour les prédire sur
une séquence génomique.
La prédiction des gènes chez les procaryotes peut se faire à l'aide de programmes comme Ge-
neMarck.hmm (http://www.ebi.ac.uk/genemark/) et le programme Gene Locator and Inter-
polated Markov Modeler (GLIMMER) (http://cbcb.umd.edu/software/glimmer/). L'analyse
statistique du biais des codons, c'est à dire l'usage des codons pour encoder les acides aminés,
ainsi que le pourcentage en G+C du génome et la fréquence de la position des bases, fréquence
avec laquelle chacune des 4 bases occupe chacune des 3 positions dans le codon, sont autant
de signes discriminatoires entre une région codante et une région non codante. Une fois que les
séquences codantes ont été prédites par les logiciels, on peut aner cette prédiction en tenant
compte des signaux des gènes décrits précédemment.
Une fois les séquences codantes prédites, il faut ensuite identier leur structure et prédire
leur fonction. Cette seconde étape d'annotation d'une séquence consiste à comparer les gènes
hypothétiques avec les séquences de gènes dont la fonction est connue. Cette comparaison de
gènes est basée sur l'identication des gènes homologues. Par dénition, des gènes homologues,
sont des gènes dérivant d'un même ancêtre commun. Il y a deux types d'homologie : l'orthologie,
et la paralogie. L'orthologie dénit des gènes homologues qui ont divergés suite à un phénomène
de spéciation. Des gènes paralogues sont des gènes homologues issus d'un événement de duplica-
tion, au sein d'un organisme. Contrairement aux gènes orthologues, des gènes paralogues peuvent
diverger susamment, pour exprimer des fonctions diérentes.
26
Chapitre 1. La microbiologie, de ses débuts à l'ère de la génomique
27
Chapitre 1. La microbiologie, de ses débuts à l'ère de la génomique
28
Chapitre 2
L'ère de la métagénomique
30
Chapitre 2. L'ère de la métagénomique
Le concept de la métagénomique a été initialement énoncé par Pace (1985). Par la suite,
Schmidt et ses collaborateurs (1991) furent les premiers à mettre en application cette idée en
clonant directement de l'ADN extrait d'échantillons d'eau de mer dans des phages lambda. La
technique fut ensuite reprise et améliorée par DeLong et son équipe qui clonèrent des grands
fragments d'ADN planctonique marin (40kpb) dans des fosmides, marquant le point de départ
de la métagénomique (Stein et al., 1996). Ce n'est qu'en 1998, que le terme métagénomique fut
introduit pour la première fois (Handelsman et al., 1998).
31
Chapitre 2. L'ère de la métagénomique
Ligation
Transformation
Protéine
atgacgac...gatttaca
tgggctcccatcgctag
Fig. 1 Principe de la construction et du criblage d'une banque métagénomique. Les photographies sont de
gauche à droite et de haut en bas : un échantillon de sol, des biolms microbiens du parc de Yellowstone, des
métazoaires de l'océan profond et des éponges (d'après Schloss & Handelsman, 2003).
32
Chapitre 2. L'ère de la métagénomique
souvent. Elles interagissent entre elles en échangeant par exemple du matériel génétique, des nu-
triments et/ou des signaux biochimiques. Si par des techniques d'isolement on individualise ces
espèces microbiennes, on les soustrait complètement des forces qui les maintiennent au sein de la
communauté. Ces micro-organismes une fois isolés ne peuvent plus entretenir de relations avec
les autres espèces microbiennes, comme cela se passait dans leur habitat naturel. Ainsi, l'analyse
génomique du pool des gènes d'une communauté microbienne révèle d'avantages de propriétés
que si l'on isolait les membres de cette communauté et qu'on en étudiait leur information géno-
mique.
On a estimé que plus de 99% des micro-organismes observables dans la nature ne pouvaient
être cultivés en utilisant les techniques de culture classiques (Amann et al., 1995). Grâce à la mé-
tagénomique, on peut capturer de grands fragments d'ADN génomique provenant d'échantillons
naturels. L'analyse de ces fragments d'ADN génomique et leur identication à l'aide de marqueurs
phylogénétiques, permet d'explorer le potentiel physiologique des micro-organismes incultivables.
Ainsi, la physiologie des micro-organismes que l'on croyait dicilement accessible, comme par
exemple les micro-organismes pathogènes et les symbiontes obligatoires (qui ne peuvent survivre
en dehors de leur hôte) est désormais accessible grâce à l'approche métagénomique. On peut
également accéder au génome d'anciens micro-organismes pour lesquels l'ADN fossile est la seule
trace encore disponible (Tringe et al., 2005). Par le biais de l'approche métagénomique, le sé-
quençage de l'ADN d'une espèce d'ours éteinte depuis 40 000 ans a récemment été mené (Noonan
et al., 2005).
De plus, une analyse métagénomique conduite à grande échelle permet éventuellement de re-
construire des génomes d'organismes incultivés, en assemblant un à un les fragments génomiques
se chevauchant.
33
Chapitre 2. L'ère de la métagénomique
L'accès à ces molécules était jusqu'à présent limité par la faible quantité de micro-organismes
cultivés. De plus, de nombreux métabolites secondaires connus sont produits soit par des micro-
organismes vivant au sein de consortia, soit par des micro-organismes occupant des niches éco-
logiques dicilement reproductibles in vitro (Piel et al., 2004). Si plusieurs méthodes ont été à
ce jour développées pour contourner les problèmes de culture (Kaeberlein et al., 2002 ; Zengler
et al., 2002), la métagénomique semble être l'approche la plus directe et la plus prometteuse pour
accéder à ce réservoir encore inexploré de nouveaux gènes.
L'avantage de l'approche métagénomique dans la capture des nouveaux gènes vient du fait
que l'on peut directement accéder à la totalité des gènes du métagénome sans qu'aucune connais-
sance préalable de leur séquence ne soit nécessaire (Schloss & Handelsman, 2003) ; ce qui n'est
pas le cas des techniques classiques d'inventaires moléculaires telles que l'amplication par PCR
de marqueurs phylogénétiques ou l'hybridation in situ. Ces deux techniques nécessitent en eet
d'avoir une bonne connaissance de la séquence du marqueur pour dessiner les amorces de PCR
ou les sondes d'hybridation.
Plusieurs articles et revues traitant de cette approche sont récemment parues (Handelsman
et al., 1998 ; Lorenz & Schleper, 2002 ; Schloss & Handelsman, 2003 ; Daniel, 2004 ; Lorenz & Eck,
1
Un métabolite secondaire est par dénition non essentiel à la croissance fondamentale et au développement
des organismes qui le produisent. Ces organismes ont acquis la capacité de les produire parce qu'ils leur conféraient
un avantage sélectif sur leur environnement, comme par exemple des interactions spéciques avec des récepteurs
présents sur d'autres organismes (Vicente et al., 2003).
34
Chapitre 2. L'ère de la métagénomique
Fonction Habitat Type de la Taille moyenne Nombre de Taille de la Substrat Nombre de Références
banque des inserts clones criblés banque (Mpb) clones positifs
(kpb)
Estérase/lipase Foret/sol Plasmide 8 67,000 536 Tributyrine 98 *
Chitinase Eau de mer Phage λ 5 825,000 4,125 Methylumbelliferyl- 11 Cottrell et al., 1999
diacetylchitobioside
E. coli a été utilisé comme cellule hôte pour toutes ces études
* Résultats non publiés, K. Liebeton et al., BRAIN AG.
Tableau 1 Nouvelles enzymes et biocatalyseurs découverts suite au criblage fonctionnel de banques métagé-
nomiques (d'après Lorenz & Eck, 2005).
Habitat Type de la Taille moyenne Nombre de Taille de la Organisme Cellule Nombre de clones Ref.
banque des inserts (kpb) clones criblés banque (Mpb) ciblé hôte positifs
B. subtilis, Bacillus subtilis; E.coli, Escherchia coli; nd: non déterminé; S. aureus, Staphylococcus aureus.
Tableau 2 Exemples de criblages de banques métagénomiques basés sur la recherche d'activités antimicro-
biennes (d'après Lorenz & Eck, 2005).
35
Chapitre 2. L'ère de la métagénomique
36
Chapitre 2. L'ère de la métagénomique
Métagénome du sol
Fig. 2 Représentation schématique des deux approches utilisées pour extraire de l'ADN génomique contenu
dans un échantillon solide (sol ou sédiment), en vue de construire une banque métagénomique (d'après Daniel,
2005).
Plusieurs protocoles d'extraction d'ADN ont été mis au point, et de nombreux kits commer-
ciaux d'extraction d'ADN sont disponibles (Daniel, 2005 ; pour revue). Cependant, ces protocoles
d'extraction d'ADN reposent tous sur deux types de méthodes : la méthode de la lyse directe
(les cellules sont lysées directement dans l'échantillon), ou indirecte (les cellules sont d'abords
extraites de l'échantillon avant leur lyse) (Daniel, 2005) (Fig. 2).
Lyse directe des cellules avant l'extraction d'ADN. Dans la première approche qu'est la lyse di-
recte des cellules (approche initialement expérimentée par Ogram et ses collaborateurs (1987)),
l'échantillon est resuspendu dans un tampon de lyse puis est traité successivement avec des
détergents et enzymes. S'en suit alors une extraction classique des ADN par l'ajout de phé-
nol/chloroforme. La lyse directe de l'ADN dans l'échantillon permet d'obtenir un bon rendement
d'extraction des acides nucléiques. De plus, cette méthode permet de capturer les diérents types
d'ADN contenu dans cet échantillon (ADN des cellules vivantes, ADN des particules virales, ainsi
que l'ADN sous forme libre provenant de cellules mortes).
Certains protocoles prévoient en plus de la lyse chimique des cellules, une lyse mécanique, en
utilisant par exemple des billes de verre. Cette approche drastique de lyse des cellules permet
d'obtenir un bon rendement d'extraction des acides nucléiques ainsi qu'une meilleure représenta-
tion de la composition en ADN. Elle permet en eet de s'aranchir des biais d'extraction dûs à la
37
Chapitre 2. L'ère de la métagénomique
diculté de lyser certains types d'organismes comme les bactéries à Gram-positif (von Wintzin-
gerode et al., 1997). Cependant, l'ADN extrait par cette méthode est particulièrement fragmenté,
rendant moins réalisable la construction de banques métagénomiques à grands inserts. L'ADN
extrait sera donc préférentiellement cloné dans des vecteurs de type plasmide ou vecteur lambda
portant des promoteurs forts permettant l'expression de gènes.
Lyse indirecte des cellules avant l'extraction d'ADN. Cette technique de lyse indirecte consiste
à séparer préalablement les cellules de l'échantillon de sol ou de sédiment, puis à les lyser. Cette
méthode d'extraction d'ADN, bien qu'elle soit moins ecace en terme de rendement / de quantité
d'ADN obtenu, est moins sévère que la méthode précédente. L'ADN extrait est ainsi moins frag-
menté, permettant la construction de banques métagénomiques à grand insert (Courtois et al.,
2001). La séparation des micro-organismes de la matrice solide peut se faire par des méthodes
mécaniques douces ou chimiques, telles que l'agitation et homogénéisation à l'aide d'un pilon ou
l'utilisation de résines échangeuses de cations, suivie par un gradient de densité ou une centrifu-
gation diérentielle (Daniel, 2005 ; pour revue).
Une méthode basée sur une technique d'électrophorèse à deux étapes a récemment été mise au
point pour permettre une purication rapide d'ADN de haut poids moléculaire à partir d'échan-
tillons du sol (Quaiser et al., 2002). Cette méthode consiste à inclure la biomasse d'un échantillon
de sol dans des plugs d'agarose. Au moyen d'une première électrophorèse en champ pulsé conte-
nant 2% de polyvinylpyrrolidone, on élimine les composés polyphénoliques qui ont tendance à
être co-puriés avec l'ADN. Une deuxième électrophorèse en champ pulsé ne contenant plus cette
fois-ci de polyvinylpyrrolidone, permet ensuite de sélectionner la taille de l'ADN désirée. Cette
méthode permet de concentrer et de purier susamment d'ADN de haut poids moléculaire pour
qu'il soit cloné dans des vecteurs acceptant des inserts de grande taille.
Comparaison des deux méthodes de lyse. Des extractions d'ADN réalisées en parallèle avec les
deux méthodes d'extraction (lyse directe et indirecte) ont révélé que toutes deux permettaient
d'obtenir, à l'exception de la sous-classe des γ -Proteobacteria, des représentations phylogénétiques
comparables en ce qui concerne le spectre de la diversité bactérienne des échantillons (Courtois
et al., 2001). Le choix de telle ou telle méthode pour extraire l'ADN se fera donc de la manière
suivante : si l'on veut obtenir de l'ADN de haut poids moléculaire par une méthode rapide et
facile on choisira plutôt la méthode d'extraction directe ; par contre, si c'est la qualité et la pureté
de l'ADN extrait que l'on privilégie, on choisira alors la méthode d'extraction indirecte. Notons
également que si l'on construit une banque métagénomique dans le but d'identier de nouveaux
gènes isolés faisant entre 1 et 2 kpb, la méthode de lyse indirecte sera bien adaptée ; par contre,
si on cherche à obtenir des clusters entiers de gènes, la méthode de lyse indirecte sera dans ce
38
Chapitre 2. L'ère de la métagénomique
cas plus adaptée. A titre d'exemple, les polyketides synthases2 apparaissent dans des clusters de
gènes qui peuvent dépasser les 100 kpb d'ADN contigu (Schwecke et al., 1995).
L'une de ces méthodes d'enrichissement repose sur le contenu en G+C des génomes. Certains
micro-organismes ont un contenu génomique en G+C particulièrement élevé. C'est par exemple
le cas des Actinomycètes (micro-organismes présents dans le sol, réputés pour synthétiser de
nombreux antibiotiques) (Waksman & Curtis, 1916) et des Acidobacteria (phylum bactérien
dont les représentants sont abondamment retrouvés dans le sol, mais dont on connaît peu de
choses) (Quaiser et al., 2003). Pour enrichir spéciquement un échantillon de sol en séquences
génomiques de ce type d'organismes, on extrait l'ADN et par ultracentrifugation, on récupère la
fraction d'ADN génomique ayant un contenu en G+C élevé (Schloss & Handelsman, 2003). Bien
que cette méthode n'apporte pas une séparation complète des génomes, elle permet cependant
d'augmenter la représentation de ces génomes à contenu en G+C élevé dans une banque méta-
génomique.
Une autre méthode d'enrichissement est la technique SIP pour Stable-Isotope Probing (Du-
mont & Murrell, 2005) (Fig. 3). Cette technique permet d'isoler l'ADN des micro-organismes qui
sont activement impliqués dans un processus métabolique spécique. Comme précédemment, on
incube dans des boîtes de Pétri des échantillons de l'environnement dans lesquels on a ajouté
2
les polyketides constituent un grand groupe de produits naturels qui incluent des antibiotiques, des antican-
céreux et des immunosuppresseurs (Schwecke et al., 1995).
39
Chapitre 2. L'ère de la métagénomique
(a) Construction d’une banque métagénomique (b) Construction d’une banque métagénomique enrichie
enrichie en BrdU en isotope stable
Echantillon environnemental
Echantillon environnemental
Cl
Cl Cl
Cl
Cl Cl
Substrat Substrat
(PCB) (13C-PCB)
BrdU
Enrichissement des bactéries Enrichissement des bactéries
Incubation qui métabolisent Incubation qui métabolisent le substrat marqué au
le substrat (PCB) 13C ( 13 C-PCB)
Ultracentrifugation pour
séparer l’ADN marqué au 13C
des autres ADN
Capture de l’ADN marqué au BrdU
par immuno-rétention
Construction de la banque
en utilisant l’ADN marqué
au BrdU Construction de la banque en utilisant
13
l’ADN marqué au C
Fig. 3 Enrichissement d'un échantillon en ADN génomique d'intérêt par la technique du BrdU (a) ou par la
technique SIP (b). Dans les deux cas, le PolyChlorinated Biphenyl (PCB) est utilisé comme substrat métabolique
(d'après Schloss & Handelsman, 2003).
40
Chapitre 2. L'ère de la métagénomique
cette fois ci des substrats marqués au carbone 13 (13 C). Les micro-organismes qui utilisent ce
substrat vont incorporer du 13 C dans leur ADN, et auront un ADN plus dense que le normal qui
contient du 12 C. Les fragments d'ADN marqués au 13 C, seront isolés des autres par centrifuga-
tion en gradient de chlorure de césium puis serviront pour construire la banque métagénomique.
Cette technique a d'ores et déjà permis de marquer et de séparer des ADN (Radajewski et al.,
2002) et des ARN (Maneeld et al., 2002a,b).
Notons que le temps ne joue pas en la faveur de ces deux dernières techniques. En eet, plus
le temps d'incubation de l'échantillon environnemental avec le substrat métabolique est long,
plus grande est la probabilité que le substrat soit recyclé au sein de la communauté microbienne.
Dans ce cas, on n'enrichit plus seulement les micro-organismes qui métabolisent spéciquement
ce substrat.
Les techniques de clonage étant maintenant optimisées, le choix du vecteur de clonage pour
la construction d'une banque métagénomique dépend maintenant de la taille des inserts que
l'on désire cloner mais aussi de l'importance que l'on accorde ou non à exprimer les gènes de
ces inserts. Les avantages et les inconvénients de construire une banque à l'aide de vecteurs de
clonage acceptant des inserts de petite taille (moins de 15 kpb) ou de grande taille (plus de 40
kpb) sont explicités dans la Tableau 3.
41
Chapitre 2. L'ère de la métagénomique
Avantages Désavantages
Banque à petits inserts (plasmides)
Pouvoir détecter les gènes exogènes faiblement exprimés grâce aux vecteurs à Les inserts d’ADN sont de petite taille
nombre de copies élevé
Pouvoir exprimer les gènes exogènes grâce aux vecteurs inductibles Devoir cribler beaucoup de clones pour obtenir ceux d’intérêt
Pouvoir cloner l’ADN de petit PM ou l’ADN du sol contaminé par les substances Ne convient pas au clonage des grands opérons codant des activités
de la matrice métaboliques d’intérêt
Techniquement simple
Banque à grands inserts (cosmides, fosmides, BACs)
Inserts de grande taille Il est plus difficile de détecter les gènes exogènes faiblement exprimés
avec les vecteurs à failble nombre de copie
Cribler peu de clones pour obtenir les clones d'intérêt Expression limitée des gènes exogènes par des vecteurs inductibles
Idéal pour le clonage des grands opérons de gènes codant des voies métaboliques Nécessite de l'ADN purifié de haut poids moléculaire pour construire la
d'intérêt banque
Convient pour la caractérisation partielle de l’ADN génomique des micro- Techniquement difficile
organismes incultivés du sol
Tableau 3 Les avantages et les inconvénients d'une banque métagénomique à petits inserts ou à grands inserts
(d'après Daniel, 2005).
Les BACs Ils ont été mis au point dans les années 1990, pour la génomique des eucaryotes
(Shizuya et al., 1992). Ces vecteurs de clonage se maintiennent de façon stable chez E. coli. Ils
sont construits sur la base du plasmide appelé facteur F qui est un plasmide conjugatif existant
naturellement chez E. coli. Le facteur F porte des gènes qui lui permettent non seulement de
réguler sa propre réplication (gènes oriS et repE ) mais aussi de le maintenir à raison d'une à
deux copies par cellule (gènes parA et parB ). Le vecteur de clonage de type BAC reprend les
caractéristiques du facteur F. Il contient également un marqueur de sélection (résistance à un
antibiotique) ainsi qu'une région à sites multiples de clonage éventuellement située au niveau
de la portion lacZa du gène β -galactosidase, permettant par test colorimétrique une sélection
blanc/bleu des cellules ayant intégré un plasmide recombinant (Shizuya et al., 1992). Ce type
de vecteur permet de cloner de grands fragments d'ADN pouvant aller jusqu'à 350 kpb. C'est
la raison pour laquelle les vecteurs BACs sont préférés aux autres vecteurs pour cartographier
et reconstituer plus rapidement des génomes entiers. Pour la même raison, on a plus de chance
d'obtenir avec ce type de vecteur de clonage des voies de biosynthèse complètes, des systèmes
de secrétions ou des îlots de pathogénicité qui sont généralement physiquement regroupés sur les
génomes bactériens (Rondon et al., 1999b).
Les cosmides et fosmides Ces vecteurs de clonage sont une alternative aux BACs si l'on
veut cloner des fragments de plus petite taille (inserts allant de 35 à 45 kpb). L'ecacité de
clonage dans ces vecteurs est généralement 100 à 1000 fois plus performante qu'avec des BACs
42
Chapitre 2. L'ère de la métagénomique
(Handelsman et al., 2002). Les cosmides sont des vecteurs qui combinent à la fois les propriétés
des bactériophages et des plasmides : ils possèdent une origine de réplication de plasmide, un ou
plusieurs marqueurs de sélection, une région de sites multiples de clonage et les séquences cos
nécessaires à l'encapsidation d'ADN dans des particules de phage lambda (Collins & Hohn, 1978).
Le système d'encapsidation dans les particules phagiques permet de sélectionner les vecteurs
ayant intégré des fragments d'ADN de 35 à 45 kpb. Les cosmides recombinants sont injectés dans
des cellules d'E. coli, après adsorption des particules phagiques sur des récepteurs membranaires
d'E. coli. Une fois dans la cellule hôte, le cosmide se circularise. Il se réplique alors comme un
plasmide, de nombreuses fois, ce qui peut provoquer son instabilité dans la cellule hôte. Pour
remédier à ce problème, des vecteurs de clonage à faible nombre de copies, les fosmides, ont été
développés (Kim et al., 1992). Ces derniers sont des vecteurs de clonage construits sur la base
des cosmides auxquels ont été ajoutés les gènes oriS, repE, parA et parB du facteur F. Dans la
cellule hôte, la stabilité des fosmides (maintenus à faible nombre de copies) est plus importante
qu'avec les vecteurs à grand nombre de copies (Kim et al., 1992). Le système d'encapsidation
des fosmides est tout aussi ecace que celui obtenu avec les cosmides, et l'ecacité d'infection
n'en est pas amoindrie.
De nombreuses études ont montré qu'il était possible d'exprimer chez E. coli divers types de
gènes provenant de diérents organismes (Ding & Yelton, 1993 ; Ferreyra et al., 1993). Cepen-
dant, étant donné que certains gènes requièrent des systèmes de transcription (reconnaissance
des promoteurs) et/ou de traduction (signaux d'initiation de la traduction) qui sont absents chez
E. coli, il n'est donc pas possible, chez cet organisme, d'exprimer tous les gènes d'une banque mé-
tagénomique. En eet, si le code génétique est presque universel, chaque organisme voire chaque
type de gène dispose de ses propres facteurs de transcription. De surcroît, la traduction est di-
rectement aectée par l'usage des codons spéciques à chaque organisme et est ainsi directement
corrélée à la disponibilité de certains ARNt dans la cellule.
43
Chapitre 2. L'ère de la métagénomique
An de combiner l'avantage des plasmides à faible et grand nombre de copies, des vecteurs
à faible nombre de copies dont la reproduction peut être facilement induite ont été mis au
point. A titre d'exemple, on peut citer les vecteur CopyControlTM Fosmid commercialisés par
EPICENTRE (pouvant être induit jusqu'à 50 copies par cellules), ou le vecteur superBAC1
(inductible jusqu'à 100 copies par cellules) (Handelsman et al., 2002).
44
Chapitre 2. L'ère de la métagénomique
Avantages Inconvénients
Méthode de criblage basée sur une activité:
De nouveaux gènes peuvent être récupérés Dépend de l'expression (transcription/traduction) des gènes clonés dans la cellule hôte
Sélectionne les gènes clonés dans leur totalité Nécessite que le produit du gène soit fonctionnel dans la cellule hôte
Sélectionne les produits des gènes fonctionnels Pouvoir créer une stratégie simple de criblage fonctionnel
Méthode de criblage basée sur la séquence:
Indépendant des cellules hôtes: pas d'expression des gènes clonés Les gènes récupéres sont des gènes relativement connus
Une même stratégie de criblage peut être utilisée pour différentes Les gènes peuvent être partiellement clonés
cibles, par ex, hybridation sur colonie et PCR
Pas de sélection des produits des gènes fonctionnels
Tableau 4 Comparaison de stratégies : criblage basé sur l'activité versus criblage basé sur la séquence (d'après
Daniel, 2005).
Les avantages et les inconvénients des deux stratégies de criblage d'une banque métagéno-
mique sont détaillés dans la Tableau 4.
Une première approche consiste à identier les clones d'intérêt d'une banque, puis à les
séquencer. On peut distinguer deux types de clones d'intérêt :
ceux portant des marqueurs phylogénétiques permettant de les identier (dans ce cas, on
espère identier des fragments génomiques d'organismes incultivés),
et ceux porteurs de nouveaux gènes d'intérêt industriel ou pharmaceutique.
Les clones d'une banque métagénomique pouvant être phylogénétiquement aliés à des or-
ganismes incultivés, seront entièrement séquencés. Le but de cette approche est d'extraire du
fragment génomique séquencé, un maximum d'informations sur la génétique, le métabolisme, la
physiologie, le rôle et/ou la fonction écologique des micro-organismes incultivés. La recherche des
clones d'intérêt présents dans la banque est généralement conduite pas PCR ou hybridation avec
des marqueurs/sondes phylogénétiques. Les marqueurs les plus fréquemment utilisés dans le cadre
d'études métagénomiques sont ceux ciblant les gènes codants les ARNr de lignées bactériennes
ou archéennes (Stein et al., 1996 ; Quaiser et al., 2002 ; Hallam et al., 2003 ; Quaiser et al., 2003 ;
Liles et al., 2003 ; Lopez-Garcia et al., 2004 ; Moreira et al., 2004 ; Béjà et al., 2000b, 2002a) ;
45
Chapitre 2. L'ère de la métagénomique
ceux ciblant les homologues des gènes radA/recA ont également été utilisés (Sandler et al., 1999).
Plusieurs lignées microbiennes qui étaient auparavant connues uniquement par la signature de
leur gène codant l'ARNr 16S, ont pu être ainsi explorées. A titre d'exemple, ce fut le cas des Aci-
dobacteria. Plusieurs études métagénomiques ont permis d'identier des fragments génomiques
aliés aux Acidobacteria, permettant ainsi d'émettre des hypothèses sur le rôle écologique de ces
bactéries (Quaiser et al., 2002, 2003 ; Liles et al., 2003). D'autres études métagénomiques ciblant
plus particulièrement les archaea incultivées du sol ou de la mer ont permis d'élucider dans cer-
tains cas la biologie des ces organismes (Stein et al., 1996 ; Quaiser et al., 2002 ; Lopez-Garcia
et al., 2004 ; Moreira et al., 2004 ; Hallam et al., 2003 ; Treusch et al., 2004 ; Schleper et al.,
1998, 1997b ; Béjà et al., 2002a). Enn, la découverte de photorécepteurs de type rhodopsine
chez des bactéries marines représente un bel exemple de surprise biologique qui a pu être révélée
par des études de métagénomique (Béjà et al., 2000a). Plusieurs de ces études seront présentées
ultérieurement. Notons cependant que, si cette approche semble très prometteuse, il peut parfois
s'avérer très dicile d'attribuer aux organismes non ou dicilement cultivables des caractéris-
tiques métaboliques qui leur sont propres. En eet, il est bien souvent dicile d'attribuer aux
gènes prédits une fonction précise (cela peut concerner jusqu'à 60% des gènes) (Tyson & Ban-
eld, 2005). Même dans le cas d'E. coli, qui est sans doute la bactérie la plus étudiée, près de
50% des gènes prédits ne ressemblent à aucun gène connu. La plupart de ces gènes peuvent être
spéciques à une lignée particulière, et peuvent jouer un rôle primordial pour l'adaptation à un
environnement donné.
Quant aux clones porteurs de nouveaux gènes d'intérêt industriel ou pharmaceutique, eux
aussi pourront être identiés par PCR ou hybridation. Ces techniques de criblage sont soit ba-
sées sur des similarités de séquences avec des gènes connus, ou soit basée sur la conservation de
motifs. Grâce à ces techniques, il est possible d'identier de nouvelles variantes de familles ou
bien de nouvelles classes fonctionnelles protéiques. Le criblage par PCR d'une banque métagé-
nomique a par exemple permis d'identier de nouvelles lipases (Bell et al., 2002). La technique
d'hybridation de l'ADN a quant à elle permis d'identier par exemple de nouvelles glycérol - et
diol dehydratases (Knietsch et al., 2003a). Cependant ces deux techniques de criblage présentent
le désavantage d'être conservatrices. Il faut en eet connaitre la séquence des gènes ciblés pour
pouvoir construire les sondes pour l'hybridation et les amorces pour la PCR. Celles-ci devront
en eet être dessinées de sorte à reéter des motifs conservés connus.
Une deuxième approche consiste quant à elle, à séquencer au hasard les clones d'une banque
métagénomique, et faire ce que l'on appelle en anglais du shotgun. Cette approche concerne
généralement les banques métagénomiques construites à l'aide de vecteurs de clonage acceptant
des petits inserts d'ADN.
46
Chapitre 2. L'ère de la métagénomique
Conduit à grande échelle, le séquençage aléatoire de milliers de clones d'une banque méta-
génomique (whole genome shotgun sequencing) permet théoriquement de reconstruire les gé-
nomes présents au sein de la communauté microbienne. Cependant, beaucoup d'environnements
contiennent des communautés bien trop complexes pour permettre de séquencer leur métagé-
nome complet. On se contente dans ce cas là de reconstituer partiellement les génomes, comme
ce fut le cas pour l'étude du métagénome de la mer des Sargasses (Venter et al., 2004) (voir
2.5.1). Cette approche donne une bonne idée du contenu et de l'organisation génétique des mé-
tagénomes. Dans le cas des communautés microbiennes peu complexes, on peut non seulement
faire l'inventaire complet des gènes présents, mais aussi tenter de reconstruire les génomes de
micro-organismes incultivés. Les premières études de reconstruction de génome ont été réalisées
sur des communautés virales (Breitbart et al., 2002, 2003), puis sur une communauté microbienne
peu diversiée provenant d'un biolm récolté sur un drainage acide d'une mine (Tyson et al.,
2004) (voir 4.5.2).
L'analyse des banques métagénomiques basée sur la recherche d'activités est très prometteuse
pour la découverte de nouveaux gènes. En eet, il n'est pas nécessaire de connaître la séquence des
gènes d'intérêt pour les identier. Cependant, cette approche ne donne pas toujours les résultats
espérés :
l'expression hétérologue nécessite que la transcription et la traduction du (/ou des gènes
d'intérêts s'il s'agit d'un cluster) puissent se faire sans encombre dans la cellule hôte,
il faut également que le produit du gène d'intérêt puisse être secrété par la cellule hôte
si le criblage ou le test le nécessitent. La plupart des études visant à exprimer les gènes
d'une banque métagénomique ont cependant été réalisées avec E. coli comme cellule hôte
étant donné que la manipulation génétique est facile et bien maîtrisée chez cet organisme
(Lorenz & Eck, 2005 ; pour revue).
Pour découvrir une gamme plus large de nouveaux produits, on peut améliorer le système
d'expression hétérologue des gènes de la banque métagénomique. E. coli peut ainsi être généti-
quement modiée an d'exprimer une gamme plus large de fonctions, en introduisant par exemple
47
Chapitre 2. L'ère de la métagénomique
des gènes codant de nouveaux facteurs sigma ou des ARNt rares (Riesenfeld et al., 2004). On
peut également construire une première banque métagénomique chez E. coli (en utilisant un
vecteur navette), puis transférer l'ADN recombinant chez un autre organisme (par exemple chez
Streptomyces, Bacillus ou chez des Archaea ) qui lui permettra l'expression hétérologue des gènes
(Lorenz et al., 2002). Enn, des techniques astucieuses ont été mises au point pour capturer
des gènes par complémentation de mutants auxotrophes avec de l'ADN métagénomique (Henne
et al., 1999 ; Majernik et al., 2001).
48
Chapitre 2. L'ère de la métagénomique
Ossature (SCAFFOLD)
lien
lecture
Fig. 4 Assemblage de l'ébauche génomique après séquençage aléatoire global (whole genome shotgun sequen-
cing). Les lectures ou séquences de chaque clone sont assemblées en contig. On relie, ordonne et oriente ensuite
les contigs entre eux, au sein d'ossatures (scaolds), en comparant par exemple les scaolds avec des séquences
homologues d'organismes pour lesquels le génome complet est connu. source : http://www.cns.fr/externe/
Francais/Projets/Projet_AK/AK.html
La procédure de reconstruction des génomes est largement détaillée dans l'article de Tyson
et ses collaborateurs Tyson et al., 2004. Elle deviendra certainement le protocole standard uti-
lisé pour les futures études de génomique environnementale (Galperin, 2004). Cette procédure
est d'autant plus facile à appliquer que la diversité microbienne de la communauté est faible,
et que le contenu en G+C des diérents génomes est susamment distinct d'un organisme à
une autre (Tyson et al., 2004). Le principe de cette procédure consiste à assembler entre eux
les contigs pour former des scaolds. Les scaolds sont ensuite classés dans des cases (bin
est le terme anglophone employé par les auteurs). Les cases sont ensuite assignées à un type
d'organisme donné, en fonction de leur contenu en G+C et de leur taux couverture de séquençage.
D'autres paramètres peuvent également être pris en compte pour assigner les scaolds au
bon organisme. Ces paramètres sont les suivants : la phylogénie de marqueurs conservés (gènes
codant l'ARNr 16S, recA/radA, rpoB/C, HSP60/70, EF-TU, et aIF2β ), l'usage des codons, la
fréquence des di-, tri-, et tetra-nucléotides (Teeling et al., 2004a,b) et enn, la comparaison des
scaolds avec des séquences homologues d'organismes pour lesquels le génome complet est connu
(Allen & Baneld, 2005).
49
Chapitre 2. L'ère de la métagénomique
Le gène codant la nouvelle bactériorhodopsine a été identié dans l'insert génomique (130
kpb) d'un BAC (Béjà et al., 2000a). Le clonage et l'expression de la bactériorhodopsine d'ori-
gine bactérienne chez E. coli a révélé qu'elle avait une activité identique à celle décrite chez H.
salinarum. Le fragment génomique portant le gène de la bactériorhodopsine a pu être phylogé-
nétiquement identié. En eet, ce fragment portait entre autre une séquence d'ARNr 16S. Sur la
base de cette séquence d'ARNr 16S, cette bactérie marine a été aliée aux γ -Proteobacteria, plus
précisément à un groupe de micro-organismes appelé SAR86 qui n'était jusqu'à présent connu
que par ses seules séquences d'ADNr 16S (Béjà et al., 2000a). Notons que le fragment génomique
ne contenait aucun autre gène d'origine archaéenne qui aurait pu indiquer un transfert de gène
horizontal (Béjà et al., 2000a).
Avant cette étude, le groupe SAR86 avait été détecté à de nombreuses reprises dans des
inventaires moléculaires d'habitats marins, mais aucune fonction n'avait pu leur être inférée.
L'existence de rhodopsine chez ce groupe de micro-organismes a suggéré que ces derniers se
développaient par phototrophie, formant ainsi un nouveau taxon de bactéries marines photo-
trophes.
50
Chapitre 2. L'ère de la métagénomique
Archaea étaient initialement connues pour dominer des habitats qualiés d'extrêmes tels que
les sources chaudes ou acides, les sources hydrothermales marines, les étangs hypersalins et les
écosystèmes strictement anoxique, de nombreux inventaires moléculaires ont depuis montré que
les Archaea étaient abondantes et largement distribuées sur Terre, occupant des biotopes tels
que le sol (Bintrim et al., 1997 ; Jurgens et al., 1997 ; Buckley et al., 1998 ; Sandaa et al., 1999 ;
Simon et al., 2000 ; Ochsenreiter et al., 2003), les lacs (MacGregor et al., 1997 ; Jurgens et al.,
2000 ; Keough et al., 2003 ; Schleper et al., 1997a), la mer (plancton océanique et sédiments
marins) (DeLong, 1992 ; Fuhrman et al., 1992 ; Boetius et al., 2000 ; Orphan et al., 2002) ou des
environnement terrestres souterrains (Takai et al., 2001b). Ces études montrèrent que les Archaea
n'étaient pas nécessairement des extrêmophiles. D'autre part, malgré la faible diversité métabo-
lique observée chez les Archaea cultivées (à titre d'exemple, toutes les Crenarcaeota cultivées
étaient encore jusqu'à peu, des thermophiles métabolisant principalement le soufre (Burggraf
et al., 1997)), ces études laissèrent présager que les Archaea pouvaient présenter une gamme de
métabolisme très variée.
Parmi le grand nombre de séquences d'Archaea mises en évidence par des méthodes molécu-
laires, seules quelques représentants ont pu être cultivés (Fig. 5 du chapitre 1). Les nombreuses
lignées archéennes n'ayant pas de représentant cultivé, nous laisse sans réponse concernant leur
métabolisme. L'étude de ces lignées archéennes incultivées par une approche métagénomique
(Fig. 5 du chapitre 1) a permis dans certains cas de conrmer certaines hypothèses métaboliques,
permettant d'apporter les bases nécessaires pour étudier l'impact écologique de ces espèces au
sein de leur communauté microbienne (Tableau 5).
Malgré ces dicultés, plusieurs fragments génomiques de grande taille, aliés à des crenar-
chaeotes, ont pu être identiés dans des banques métagénomiques construites avec de l'ADN
environnemental provenant d'échantillons du sol (Quaiser et al., 2002 ; Treusch et al., 2004).
L'analyse du contenu génique de ces fragments a révélé que des crenarchaeotes non thermophiles
étaient capable de nitrication, laissant sous-entendre que ces archaea utilisent l'ammonium
comme source principale d'énergie (présence dans ces séquences génomiques d'homologues des
gènes codant la petite et la grande sous-unité de l'ammonium monooxygénase (amoA et amoB )
51
Chapitre 2. L'ère de la métagénomique
Consortium de méthano- Rice cluster I methanogènes Fosmides Maintient stable du consortium bactéries/archaea, Erkel et al., 2005
gènes pendant 3 ans , en anaérobiose, à 50°C
BACs, bacterial artificial chromosomes.
Tableau 5 Analyses métagénomiques impliquant des Archaea incultivées (d'après Schleper et al., 2005).
Les premiers travaux de métagénomique portant sur des échantillons d'eau de mer, furent
initiés par DeLong et ses collaborateurs (1996). Ces derniers construisirent une banque métagé-
nomique (à l'aide de BACs) à partir d'un échantillon d'ADN planctonique de l'océan Pacique
nord-oriental. Parmi les 3552 clones de leur banque, ils purent identier puis caractériser un
fragment génomique (38.5 kpb) d'une crenarchaeote mésophile incultivée. D'autres fragments
génomiques d'Archaea marines ont depuis été isolés à partir de banques de BAC, fosmides ou
cosmides construites avec des échantillons provenant de l'Antarctique ou du nord de l'océan Pa-
cique (Lopez-Garcia et al., 2004 ; Moreira et al., 2004 ; Béjà et al., 2000b, 2002a). Dans une
plus large mesure, le séquençage aléatoire d'échantillons provenant de la mer des Sargasses a
considérablement augmenté la quantité de séquences archéennes marines (Venter et al., 2004).
Ainsi, environ 20 scaolds identiés dans cette étude (représentant 396 kpb) ont été aliés à
des Archaea. Parmi les activités métaboliques identiées dans cette étude, gurent les voies pour
52
Chapitre 2. L'ère de la métagénomique
Parmi la communauté microbienne présente dans les tissus de l'éponge marine Axinella mexi-
cana, un seul phylotype archaéen, C. symbosium, a été détecté par identication moléculaire
(ADNr 16S) (Preston et al., 1996). Cette archée peut être maintenue en co-culture avec son
hôte pendant des mois à des températures inférieures de 40o C à 50o C de l'optimum de ses plus
proches voisins phylogénétiques, des crenarchaeotes hyperthermophiles. Si C. symbosium ne peut
être cultivée sans son hôte et les autres bactéries de la communauté, des fractions cellulaires pro-
venant d'enrichissement de cette archée ont permis de construire des banques à large insert
(Schleper et al., 1998), conduisant à un projet de séquençage génomique (Schleper et al., 2005).
Une ADN polymérase de la famille B, montrant que C. symbosium est proche des crenarchaeotes
hyperthermophiles cultivées, a été identiée dans l'un des clones de ces banques génomiques. La
caractérisation biochimique de cet ADN polymérase a par la suite révélé que l'archée C. symbo-
sium était bien adaptée à des températures basses (Schleper et al., 1997b).
Dernièrement, une crenarchaeote marine mésophile a été isolée (Könneke et al., 2005). Il
s'agit d'une archaea aérobie chimiolithoautotrophe, qui oxyde l'ammonium en nitrites. En plus
d'être la première mésophile isolée du phylum des Crenarchaeota, cet isolat constitue également
le premier cas de nitrication observé chez une archée. En eet, ce métabolisme n'était jusqu'à
présent seulement connu chez des Proteobacteries-β et γ (Bock & Wagner, 2001). Les analyses
phylogénétiques portant sur l'ARNr 16S de cet isolat a montré qu'il était proche (>98%) des
crenarchaeotes marines du groupe I qui incluent l'archée C. symbosium ainsi que des séquences
crenarchaeotes identiées lors de l'analyse du métagénome de la mer des Sargasses (Venter et al.,
2004). Le métabolisme autotrophique de cet isolat, ainsi que son aliation à des séquences envi-
ronnementales de crenarchaeotes marines, suggèrent que les crenarchaeotes marines nitriantes
doivent jouer un rôle important dans la régulation globale des cycles du carbone et de l'azote
(Könneke et al., 2005).
3
On parle de synténie pour décrire, dans le cadre de comparaisons entre génomes, des groupes de gènes co-
localisés sur un génome, dont les correspondants, sur un autre génome, sont également co-localisés.
53
Chapitre 2. L'ère de la métagénomique
Ces bactéries symbiotiques jouent un rôle primordial en faveur de leur hôte puisqu'elles lui
fournissent du carbone xé. Pour cela, elles oxydent l'H2 S présent en grande quantité dans l'en-
vironnement hydrothermal. L'énergie produite est susante pour xer le carbone à partir du
CO2 , permettant la transformation de molécules inorganiques en sucres et acides aminés assimi-
lables pour le vestimentifère (Laue & Nelson, 1994 ; Felbeck & Jarchow, 1998). Des études de
biochimie ont montré que la xation du CO2 se faisait via le cycle de Calvin-Benson (Robinson
& Cavanaugh, 1995).
Jusqu'à présent, aucune culture pure de ces bactéries symbiotiques n'a pu être obtenue. Ce-
pendant, on peut facilement extraire spéciquement leur ADN génomique dans la mesure où
elles sont les seules à coloniser le trophosome de R. pachyptila, et qu'elles atteignent une densité
de population très importante. Ces bactéries ont donc pu être étudiées par une approche méta-
génomique.
Une banque métagénomique a été construite à partir de l'ADN génomique des bactéries sym-
biotiques (Robinson et al., 1998). Dans cette banque, Robinson et ses collaborateurs ont identié
le gène codant une Ribulose 1,5-biphosphate Carboxylase Oxygénase (RubisCO). Ce gène est
l'enzyme clé du cycle de Calvin-Benson. Sa présence conrme donc que la bactérie symbiotique
xe le carbone pour son hôte.
Une autre étude métagénomique a été réalisée pour ces mêmes symbiontes. Cette fois-ci, il
s'agissait de comprendre les mécanismes de communication cellulaire qu'entretiennent ces bacté-
ries avec leur hôte (Hughes et al., 1997). Un gène codant un homologue d'une histidine kinase a été
identié dans la banque métagénomique. Ce gène a été cloné puis exprimé chez E. coli, montrant
que cette histidine kinase s'autophosphorylait en réponse à un signal extérieur et fonctionnait
ainsi comme les autres capteurs à histidine kinase déjà caractérisés chez d'autres organismes. Un
deuxième gène codant un homologue de régulateurs de réponses a également été identié dans
les fragments génomiques du symbionte. La nature spécique des signaux reconnus par les sym-
biontes demeure inexpliquée. Cependant, ces résultats suggèrent que le symbionte dispose d'un
54
Chapitre 2. L'ère de la métagénomique
système classique de transduction du signal à deux composants (le capteur à histidine kinase et
le régulateur de réponse) qui lui permettent d'interagir avec leur hôte.
Enn, une dernière analyse métagénomique a permis d'identier chez ces symbiontes un
gène permettant la synthèse de agelles (Millikan et al., 1999). La présence de ce gène suggère
qu'au cours de son cycle de vie, les symbiontes passent par une étape pendant laquelle ils sont
présents sous forme libre. Lors de cette étape ils peuvent ainsi coloniser le trophosome des autres
vestimentifères.
Plusieurs tentatives ont été réalisées pour isoler ces bactéries lamenteuses de la communauté
épisymbiotique d'A. pompejana. Diérents types de bactéries ont été isolées, mais aucune d'entre
elles ne leur correspondaient (Prieur et al., 1990 ; Jeanthon, 2000 ; Miroshnichenko et al., 2002 ;
Campbell et al., 2001). Des études moléculaires ont permis d'identier la population symbiotique
d'A. pompejana, montrant que cette population était dominée par un seul clade monophylétique
groupant au sein de la sous-division des ε-Proteobacteria. (Haddad et al., 1995 ; Cary et al.,
1997 ; Campbell & Cary, 2001). Par la suite, des résultats d'hybridation in situ ont indiqué que
ces ε-Proteobacteria correspondaient à la bactérie lamenteuse associée aux expansions dorsales
(Cary et al., 1997).
Le rôle de l'association particulière entre les alvinelles et leurs épibiontes bactériens reste
à être élucidé. Les symbiontes pourraient à la fois fournir une source de nourriture au poly-
chète, mais également intervenir dans la détoxication de l'environnement du ver (Alayse-Danet
et al., 1987 ; Prieur & Jeanthon, 1987). Plusieurs études plaident pour que cette communauté
symbiotique soit chimiolithoautotrophe (Desbruyères et al., 1983 ; Van Dover & Fry, 1989 ; Des-
bruyères et al., 1998). Cependant ce n'est pas par la voie classique de Calvin-Bassham-Benson
(cycle de Calvin) que ces bactéries semblent xer le carbone (Desbruyères et al., 1983, 1998). Elles
xeraient plutôt le carbone par la voie du cycle inverse de l'acide tricarboxylique (rTCA) (Fig. 5).
55
Chapitre 2. L'ère de la métagénomique
Fig. 5 Fixation autotrophe du CO2 via le cycle inverse de l'acide tricarboxylique (rTCA). Les réactions enzy-
matiques clés sont indiquées par des èches marquées en gras. Activités enzymatiques : malatedehydrogenase (1),
fumarate hydratase (2), fumaratereductase (3), succinyl-CoAsynthase (4), 5,2-oxoglutarate :ferredoxin oxidore-
ductase (5), isocitratedehydrogenase (6), aconitatehydratase(aconitase) (7), ATP citrate lyase (8) et pyruvate :
ferredoxinoxidoreductase (9). Fdr ed : reduced ferredoxin. (D'après Hugler et al., 2005)
C'est en construisant des banques fosmidiques avec de l'ADN extrait de la biomasse épi-
symbiotique du polychaete, que Campbell et ses collaborateurs (2003) ont prouvé l'existence de
cette voie de xation du carbone chez ces épibiontes. Deux de leurs fosmides aliés au phy-
lotype des bactéries lamenteuses contenaient le gène codant l'ATP citrate lyase, une enzyme
clé impliquée dans le cycle rTCA. Ce résultat est surprenant, étant donné que la majorité des
chimiolithoautotrophes associés à des invertébrés marins (incluant les invertébrés des sources
hydrothermales) utilisent le cycle de Calvin pour la xation du CO2 . Cette voie métabolique
(rTCA) n'a été identiée que chez quelques micro-organismes, de plus l'utilisation de cette voie
et son importance dans les écosystèmes microbiens sont peu connues (Campbell & Cary, 2004).
Une sonde a été construite à partir de la séquence nucléotidique du gène codant l'ATP citrate
lyase an, par reverse transcriptase PCR, an de montrer la diversité et l'expression de ce gène
dans les communautés symbiotiques de diverses origines. Les résultats ont indiqué que ce gène
était exprimé non seulement chez les bactéries lamenteuses, mais également chez de nombreuses
ε-Proteobacteria existantes sous forme libre dans l'environnement hydrothermal marin. La pré-
sente étude a permis de montrer que le cycle du rTCA jouait un rôle majeur dans la xation du
CO2 pour l'écosystème hydrothermal marin.
56
Chapitre 2. L'ère de la métagénomique
Dans le cadre de ce projet de métagénomique, Venter et son équipe ont pompé quelques
centaines de litres d'eau au travers de ltres ayant une porosité de 0.1 à 3µm. Ils ont ensuite
extrait l'ADN génomique de la microore retenue dans ces ltres, puis ont construit plusieurs
banques métagénomiques (avec des inserts d'ADN de petite taille, 2-6 kpb). Plus de deux mil-
lions de séquences d'ADN (soit environ 1.6 Mpb d'ADN) issues de ces banques ont été obtenues.
Ces séquences ont été annotées, permettant d'identier plus de 1.2 millions d'ORFs provenant
d'environ 1800 espèces génomiques diérentes. En avril 2004, 5% des séquences accessibles sur
GenBank provenaient de la collection de la mer des Sargasses (Riesenfeld et al., 2004).
57
Chapitre 2. L'ère de la métagénomique
Fig. 6 Aliation phylogénétique des séquences provenant de l'analyse métagénomique de la mer des Sargasses.
Cette analyse est basée sur l'utilisation de plusieurs marqueurs phylogénétiques : l'ARNr 16S, RecA, EF-TU,
EF-G, HSP70 et l'ARN polymérase B (RpoB) (d'après Venter et al., 2004).
appartenant au genre Cytophaga. D'autres bactéries marines planctoniques comme les espèces
de Roseobacter, Alteromonas, le clade SAR116 et des crenarchaeotes marines ont également été
détectées.
La présence de rhodopsines chez des bactéries avait été démontrée la première fois par Béjà
(Béjà et al., 2000a) (Cf 4.1). Des études ultérieures ont par la suite montré que de nombreuses
bactéries aliées aux Proteobacteria avaient elles aussi des proteorhodopsines. En eet, 67
nouveaux homologues de protéorhodopsines ont pu être révélés (Sabehi et al., 2003). Ces proteo-
rhodopsines sont optimisées pour capter les diérentes longueurs d'onde de la lumière en fonction
de la profondeur de l'océan (Béjà et al., 2001 ; de la Torre et al., 2003 ; Sabehi et al., 2003 ; Man
et al., 2003 ; Béjà et al., 2002b). Parmi les 1.2 millions d'ORFs identiés dans l'étude du métagé-
nome de la mer des Sargasses, 782 d'entre eux présentaient une forte similarité avec des protéines
photo-réceptrices de type rhodopsine (Venter et al., 2004). Ces 782 rhodopsines identiées dans
le métagénome de la mer des Sargasses élargissent considérablement le spectre d'espèces ayant ce
type de pompes à protons. Ceci suggère que la phototrophie par la rhodopsine est un processus
marin microbien signicatif et largement distribué, pouvant jouer un rôle considérable sur le ux
58
Chapitre 2. L'ère de la métagénomique
Tout d'abord, il a été particulièrement dicile de reconstruire des génomes complets d'or-
ganismes à partir des séquences générées par cette étude, ceci malgré la quantité énorme de
données produites. La grande diversité microbienne présente dans la mer des Sargasses4 en est la
principale cause (Riesenfeld et al., 2004). Il semblerait de plus que les deux génomes reconstruits
par Venter et ses collaborateurs soient certainement des contaminants présents dans l'échantillon
d'eau de mer (DeLong, 2005). Des erreurs agrantes d'assemblages de séquences ont également
été repérées. Un exemple évident concerne des contigs contenant des gènes d'origine bactérienne
codants l'ARNr 5S et l'ARNr 23S juxtaposés à un gène d'origine archéenne codant l'ARNr 16S
(DeLong, 2005). Enn, l'interprétation de cette quantité énorme de données demeure dicile,
dans la mesure où aucune fonction connue n'a pu être inférée à 69% des ORFs identiés dans
cette étude (Venter et al., 2004). Cela suggère qu'il faudra que de nombreux génomes soient
entièrement séquencés an que l'on puisse interpréter au mieux les données issues de cette étude.
4
Les communautés marines sont caractérisées par une diversité microbienne très riche, de l'ordre de 100 à 200
espèces par millilitre d'eau (Curtis et al., 2002).
59
Chapitre 2. L'ère de la métagénomique
Fig. 7 Arbre phylogénétique illustrant les diérentes rhodopsines identiées dans la mer des Sargasses ainsi
que leurs homologues de la base de donnée GenBank (d'après Venter et al., 2004). Le nom des diérentes sous-
familles de séquences est indiqué sur la droite de la gure. Les séquences ayant plus de 75 aa ont été alignées avec
ClustalW. L'arbre a été construit grâce à la méthode du Neighbor-joining. Le code couleur est le suivant : en bleu,
il s'agit de séquences provenant d'espèces cultivées ; en jaune, les séquences issues de micro-organismes incultivés
provenant de divers échantillons environnementaux ; en rouge, les séquences d'espèces incultivées provenant de
la mer des Sargasses.
60
Chapitre 2. L'ère de la métagénomique
Fig. 8 (a) Photographie du biolm de la mine de Richmond ; (b) abondance relative des micro-organismes du
biolm évaluée par FISH.(D'après Tyson et al., 2004)
L'un des aspects les plus prometteurs de la métagénomique est de fournir les clés du fonction-
nement (voies métaboliques et cycles biogéochimiques) d'une communauté microbienne. L'ana-
lyse des fonctions spéciques de chaque membre d'une communauté peut permettre de générer
les modèles d'interactions entre micro-organismes qui maintiennent l'équilibre nutritionnel et
énergétique d'une communauté (Handelsman, 2004). Le plus bel exemple est celui de l'analyse
menée sur un biolm ottant à la surface d'une eau de drainage acide provenant de la mine
Richmond située dans la montagne Iron Mountain, en Californie (Tyson et al., 2004) (Fig. 8.a).
Cette étude, la première du genre, a permis de reconstruire les génomes d'organismes incultivés
d'une communauté microbienne, ainsi que de reconstituer les principales voies de xation de
carbone et d'azote ayant lieu au sein de cette communauté.
L'euent de drainage étudié représente l'un des environnements les plus extrêmes connu
sur Terre. La solution est caractérisée par un pH très acide de 0.8, une forte concentration en
métaux lourds, une température de 42o C, et des conditions de microaérophilie. Mis à part le
carbone et l'azote présents dans l'air atmosphérique, il n'y a pas d'autres apports en source de
carbone et d'azote dans cette solution. La mine est riche en sulfures parmi lesquels les pyrites
(FeS2 ) se trouvent sous forme dissoute suite à leur oxydation par des micro-organismes ferro-
oxydants (Bond et al., 2000 ; Baker & Baneld, 2003). La survie des micro-organismes dans
cet environnement acide riche en métaux lourds nécessite que les membres de cette communauté
microbienne aient des métabolismes chimiolithoautotrophes. Des études préliminaires ont montré
que la diversité microbienne de ce biolm était faible (Tyson et al., 2004).
61
Chapitre 2. L'ère de la métagénomique
A partir de l'ADN extrait de ce biolm, Tyson et ses collaborateurs ont construit une banque
métagénomique en clonant des inserts de petite taille (∼3 kpb) dans le vecteur pUC18. La
faible diversité microbienne du biolm (Fig. 8.b) leur a permis de cloner tout le métagénome
de cette communauté et de le séquencer avec un fort taux de recouvrement. Via le séquençage
aléatoire de 76.2 Mpb de séquences, ils ont reconstitué les génomes presque complets des deux
micro-organismes dominant le biolm : celui de la bactérie Leptospirillum group II (avec une
couverture de 10X, représentant ainsi le premier génome du phylum des Nitrospirae ) et celui de
l'archaea Ferroplasma type II (couverture de 10X)5 . De plus, ils ont reconstruit partiellement le
génome d'une autre espèce de Leptospirillum (Leptospirillum group III) et deux génomes appa-
rentés aux Ferroplasma (F. acidarmanus type I et G-plasma).
La reconstruction de ces génomes a été relativement facile étant donné que le biolm avait
une faible diversité microbienne et que le contenu en G+C des génomes des taxons dominants
étaient signicativement distincts les uns des autres (Tyson et al., 2004).
La reconstruction partielle ou presque complète des génomes du biolm a révélé les voies de
xation de carbone et d'azote et de production d'énergie pour chaque organisme. Par exemple,
les analyses ont montré que certaines enzymes comme la CO deshydrogénase et la formate hy-
drogénylase étaient apparemment présentes chez tous ces organismes, indiquant qu'ils étaient
capables de xer le carbone. D'autre part, seul l'organisme alié au group III de Leptospirillum
semblait pouvoir xer l'azote, laissant sous-entendre que la survie du biolm reposait sur cette
bactérie (Galperin, 2004). Ferroplasma et Leptospirillum semblent tous deux tirer leur énergie
de l'oxydation du fer (Fig. 9). Les génomes des deux groupes contiennent d'ailleurs leur propre
système de chaines de transports d'électrons. De plus, tous les génomes contiennent des gènes
dont la fonction est associée à l'expulsion d'éléments toxiques, de gènes responsables de l'eux
des protons (permettant de maintenir un pH intracellulaire proche de la neutralité) et des gènes
de résistance aux métaux.
L'analyse de la communauté de ce biolm est un bon modèle pour l'analyse future de nou-
velles communautés environnementales. Cependant, il sera certainement plus dicile de déter-
miner l'origine des fragments d'ADN et d'assigner des fonctions à des communautés qui sont
phylogénétiquement ou physiologiquement plus complexes (Galperin, 2004).
5
Ce génome de 1.82 Mpb contient un ARNr 16S ayant 99% de similarité avec celui de F. acidarmanus (isolé
plus tôt sur ce même site (Dopson et al., 2004)
62
Chapitre 2. L'ère de la métagénomique
Fig. 9 Schéma représentant les cycles biogéochimiques déduits de l'analyse métagénomique du biolm micro-
bien prélevé dans le drainage acide de la mine de Richmond. Ce schéma a été construit suite à l'analyse des 2,180
ORFs identiés dans le génome de la bactérie Leptospirillum du groupe II ainsi que les 1 931 ORFs identiés
dans celui de la bactérie Ferroplasma de type II. AMD : pour Acid Mine Drainage.(D'après Tyson et al., 2004)
63
Chapitre 2. L'ère de la métagénomique
Le méthane piégé sous forme d'hydrates de méthane, est présent en grande quantité dans
les sédiments marins (Kvenvolden, 1999). On trouve des gisements particulièrement vastes de
ces hydrates de méthane au niveau des talus continentaux des océans, entre 500 et 2000 m de
profondeur (Kvenvolden, 1988). Une grande partie de ce méthane enfermé dans les sédiments
est oxydée par des micro-organismes qui occupent les régions anoxiques des océans (Judd et al.,
2002 ; Boetius & Suess, 2004). Etant donné que le méthane est un gaz à eet de serre encore
plus puissant que le dioxyde de carbone, l'oxydation anaérobie du méthane est un processus
microbien de toute première importance, car il permet de limiter le réchauement du climat.
Ce processus microbien a été attribué à des consortia d'archaea méthanotrophes et de bactéries
sulfato-réductrices (Zehnder & Brock, 1979). Les archaea méthanotrophes ont été aliées sur la
base de leur ARNr 16S à de nouvelles lignées archaéennes appelées ANME-1, ANME-2, ANME-3
(Hinrichs et al., 1999 ; Boetius et al., 2000 ; Knittel et al., 2005).
Comme toutes les tentatives d'isolement en culture pure de ces méthanotrophes ont échouées,
les mécanismes de l'oxydation anaérobie du méthane (AOM) demeuraient jusqu'à peu à peine
connus. Seule l'hypothèse suivante avait été formulée : l'oxydation anaérobie du méthane serait
réalisée par des micro-organismes capables de conduire une voie inversée de la méthanogénèse
(Hoehler et al., 1994). An de comprendre les mécanismes de l'AOM, plusieurs études de méta-
génomique ont été menées ces dernières années (Hallam et al., 2003 ; Krüger et al., 2003 ; Hallam
et al., 2004) (Meyerdierks et al., 2005).
Les premières analyses métagénomiques ont montré que des fragments génomiques assignés
aux ANME-1 et ANME-2, contenaient une methyl-coenzyme-M réductase (MCR) modiée (Hal-
lam et al., 2003 ; Krüger et al., 2003). La MCR6 est une enzyme clé de la méthanogénèse ; elle en
assure la dernière étape (Fig. 10.a). Une analyse biochimique de cette nouvelle MCR révéla qu'elle
contenait un cofacteur F430 modié (Krüger et al., 2003). Plus récemment, presque tous les gènes
codant les enzymes typiquement associées à la voie de la méthanogénèse ont été identiés dans
des fragments génomiques assignés aux ANME-1 et ANME-2 (Hallam et al., 2004) (Fig. 10.b).
L'ensemble de ces données confortent la théorie que les archaea ANME conduisent une métha-
nogénèse inverse, reverse methanogenesis. La plus récente étude métagénomique traitant de
l'oxydation anaérobie du méthane a, quant à elle, permis d'aller plus loin dans les caractéris-
tiques génomiques des diérents groupes d'ANME (Meyerdierks et al., 2005). Les gènes et les
opérons potentiellement impliqués dans cette voie y sont analysés en détail.
6
Dans la voie de la méthanogénèse, la MCR catalyse la réduction de l'intermédiaire réactionnel méthyl-
coenzyme-M, conduisant à la formation de méthane. La MCR est composée de trois sous-unités distinctes (α2 β2 γ2 )
qui sont fortement liées à deux molécules d'un composé nickel, appelé cofacteur F430 (Ermler et al., 1997).
64
Chapitre 2. L'ère de la métagénomique
A CO2 B CO2
1 fmdABCDEFGH 1 fmdABCDEFGH
Formyl-MF Formyl-MF
2 ftr 2 ftr
Formyl-H4MPT Formyl-H4MPT
3 mch 3 mch
H2 or Methenyl-H4MPT H2 or Methenyl-H4MPT
F420-H2 F420-H2
4 mtd 4 mtd
F420 F420
Methylene-H4MPT Methylene-H4MPT
F420-H2 F420-H2
5 mer 5 mer
F420 F420
Methyl-H4MPT Methyl-H4MPT
mtrABC mtrABC
HS-CoM 6 Na+ 6 Na+
DEFGH HS-CoM DEFGH
C-X Methyl-S-CoM Methyl-S-CoM
C-X
[CO] HS-HTP [CO]
7 mcrABCDG HS-HTP mcrABCDG
7
CH4 CH4
CoM-S-S-HTP CoM-S-S-HTP
hdrABCDE hdrABCDE ?
2H+ 2H+
HS-HTP HS-CoM
+ +
HS-CoM HS-HTP
vhoACG 2H+ vhoACG 2H+
vhtACG vhtACG
H2 H2
F420-H2 F420-H2
frhABDG frhABDG
F420 F420
2H+ 2H+
H2 echADCDEF H2 echADCDEF
cdhABCDE 2 FERox H+ cdhABCDE 2 FERox H+
2 FERred 2 FERred
Acetyl-CoA Acetyl-CoA
pta pta
Acetyl-Pi acd Acetyl-Pi acd
ack ack
Acetate Acetate
Fig. 10 Modèle hypothétique de la méthanogénèse inverse chez les archaea de la lignée ANME-1. (A) Voie
de la méthanogénèse. Les gènes identiés sont indiqués en noir. (B) Voie de la méthanogénèse inverse chez les
ANME-1. Cette voie est déduite de la prédiction des gènes identiés dans les fosmides aliés aux ANME-1. Les
gènes identiés dans les fosmides sont indiqués en rouge, ceux n'ayant pas été identiés sont en gris (d'après
Hallam et al., 2004).
65
Chapitre 2. L'ère de la métagénomique
Le cycle de l'azote est étudié depuis le 19ème siècle, mais il n'a pas encore livré tous ses secrets.
Très récemment, on a observé que l'ammonium pouvait être oxydé par des bactéries anaérobies
dites bactéries anammox (pour anaerobic ammonium oxidation) (Fig. 11) (Schmid et al., 2000 ;
Strous & Jetten, 2004). La réaction métabolique anammox permet, sans l'apport d'oxygène, de
transformer l'ammonium et les nitrites en azote gazeux. Cette transformation produit comme
intermédiaire l'hydrazine qui est une substance hautement toxique. Les cellules se protègent de
l'hydrazine en la connant dans une vésicule appelée anammoxosome. Cette vésicule identiée
comme étant le siège de la réaction, est constituée de lipides particuliers appelés ladderanes, dont
la biosynthèse était jusqu'à présent inconnue.
Le processus anammox est un élément majeur du cycle de l'azote. On estime qu'il contribue
à plus de 50% de la transformation de l'azote dans les océans (Arrigo, 2005). Les quelques bacté-
ries anammox identiées jusqu'à présent, comme par exemple Kuenenia stuttgartiensis (Schmid
66
Chapitre 2. L'ère de la métagénomique
et al., 2000), appartiennent toutes à l'ordre des Planctomycetales. Ces bactéries n'ont pu être
isolées en culture pure ; elles nécessitent donc d'être étudiées par des approches de génomique.
Dans le cadre d'une étude métagénomique, le génome de la bactérie anammox K. stuttgartiensis
a pu être dernièrement reconstitué permettant d'apporter plusieurs éléments de réponses sur le
mécanisme du processus anammox (Strous et al., 2006).
K. stuttgartiensis est une bactérie qui se divise très lentement (une division toutes les 2 à 3
semaines). Cette bactérie n'a pu être isolée en culture pure. Cependant, pendant plus d'un an,
elle a pu être maintenue en coculture, dans un bioréacteur. Cette culture a été réalisée en condi-
tion d'anaérobiose, dans un bioréacteur alimenté par des eaux usées qui avaient la particularité
d'être riches en ammonium et en nitrites (Strous et al., 2006). L'ADN génomique contenu dans
le bioréacteur a été extrait, puis cloné an de construire des banques de banques de BAC et
fosmidiques. Le génome de K. stuttgartiensis a pu être reconstitué à plus de 98%. L'analyse du
génome de K. stuttgartiensis a permis :
d'identier les gènes responsables de la synthèse des ladderanes,
d'identier les gènes de la voie biochimique de l'oxydation anaérobie de l'ammonium, per-
mettant ainsi de comprendre comment l'hydrazine est métabolisé,
de mettre en évidence un très grand répertoire de voies métaboliques (plus de 200 gènes
directement impliqués dans le catabolisme et la respiration ont été identiés dans le gé-
nome),
de conrmer que la seule voie de xation du carbone chez cette bactérie anammox est
celle de l'acétyl CoA (aucune autre voie connue et complète n'a pu être identiée dans le
génome),
de mettre n à une controverse sur l'origine évolutive du groupe des Planctomycètes, en
montrant que les Planctomycètes ont plus de gènes en commun avec les Chlamydiées
qu'avec n'importe quel autre groupe, et que de ce fait, elles descendent donc du même
ancêtre commun que ces dernières.
67
Chapitre 2. L'ère de la métagénomique
68
Chapitre 3
70
Chapitre 3. L'écosystème hydrothermal marin
71
Chapitre 3. L'écosystème hydrothermal marin
donné naissance à l'arc des Antilles. La convergence de deux plaques lithosphériques peut
parfois ouvrir un espace océanique en arrière et parallèlement à une chaîne volcanique,
créant ce que l'on appelle un bassin arrière arc.
Enn, celui localisé au niveau des zones transformantes, le long desquelles coulissent des
plaques ou des fragments de plaques, sans création ni résorption de croûte. C'est le cas par
exemple de la faille de San Andreas en Californie.
A ce jour, seules quelques centaines de kilomètres de dorsales ont été explorées, et plus par-
ticulièrement celles ayant des expansions rapides. Au niveau de ces dorsales règne une activité
72
Chapitre 3. L'écosystème hydrothermal marin
Fig. 2 Les trois types de dorsales océaniques : celles à expansion rapide (en haut du schéma), à expansion
intermédiaire (au milieu) et à expansion lente (en bas). La topographie, la profondeur de la chambre magmatique,
les fréquences des activités volcaniques, les tailles des édices hydrothermaux, la diversité et la composition de
la faune hydrothermale dépendent tous de la vitesse d'expansion des océans. EPR, East Pacic Rise ; MAR,
Mid-Atlantic Ridge (d'après Kelley et al., 2002).
73
Chapitre 3. L'écosystème hydrothermal marin
Kolbeinsey
Baïkal Piyp
Explorer
Kraternaya
Juan de Fuca
Gorda Lucky Menez Milos
Kagoshima Strike Gwen
Okinawa
Suiyo/Mokuyo Palos Verdes Broken Spur Rainbow Capo Palinuro
Kaikata Lost City Capo Misseno
Nikko Guaymas
Loihi 21˚N/EPR TAG Snake Pit
Mariannes Logatchev
9-13˚N/EPR Aden
Manus 4˚N/EPR
Edison Galàpagos
7˚S/EPR
Fidji
14-22˚S/EPR
Lau 23-26˚S/EPR
Kairei
Bay of Plenty
Fig. 3 Localisation des dorsales océaniques et des sites hydrothermaux marins étudiés par les biologistes. Les
double-traits représentent les zones d'expansion, les traits simples indiquent les failles transformantes, les points
localisent les sites hydrothermaux et les triangles situent les zones de subduction (d'après Von Damm, 2001).
hydrothermale intense. La carte suivante présente une liste non exhaustive des sites hydrother-
maux étudiés jusqu'à présent (Fig. 3). A l'image des sites hydrothermaux récemment découvertes
dans l'océan Indien (Van Dover et al., 2001) et l'océan Atlantique (Kelley et al., 2001 ; Charlou
et al., 2002), de nombreux sites restent probablement à découvrir.
74
Chapitre 3. L'écosystème hydrothermal marin
PENETRATION
~20˚-100˚C
faible profondeur
(~10-100m)
grande profondeur isotherme
(3-4 km) précipitation en route: 360˚C
FeS, FeS2 , CuFeS2
~1200˚C basalte
Fig. 4 Principe de la circulation de l'eau de mer dans la croûte océanique, au niveau des zones d'expansion
(d'après Jannasch, 1995).
miques de ce uide hydrothermal anoxique et acide sont sans équivalent dans les milieux côtiers
et contrastent très fortement avec celle de l'eau de mer.
Selon le degré de mélange du uide avec l'eau de mer avant son émission, la composition,
le débit et la température du uide en sortie peuvent varier d'un site à l'autre conditionnant
ainsi la forme sous laquelle le uide va être émis et la distribution de la biocénose hydrothermale
(Desbruyeres et al., 2001).
75
Chapitre 3. L'écosystème hydrothermal marin
Ces édices minéraux qui canalisent la sortie du uide, peuvent atteindre de 1 à 20 m de hau-
teur. Leur morphologie et leur composition minéralogique varient en fonction du débit d'émission
du uide, des courants et de l'âge de la cheminée. Les cheminées sont généralement représen-
tées comme des structures cylindro-coniques, mais dans la réalité elles forment des structures
irrégulières présentant parfois des expansions latérales ou anges.
Lorsque le uide est dilué par l'eau de mer avant son émission (lors de son passage à travers la
lithosphère océanique), sa température est alors moins élevée ne permettant pas la précipitation
des sulfures métalliques. Ce uide diuse à faible vitesse (0.1-0.5 m.s−1 ) au travers de petits
canaux. Si la dilution du uide est supérieure à 70%, le uide qui en résulte n'est plus assez
chaud (<10o C à 50o C) pour permettre le transport d'importantes quantités de sulfures et de
métaux dissous. La faible minéralisation du uide et son faible débit entraîne la précipitation
de minéraux (silice amorphe, oxydes de fer) qui engendre l'édication de structures appelées
diuseurs. Cependant, si la dilution du uide ne dépasse pas les 50%, sa température est de
l'ordre de 100o C à 250o C. A ces températures, la précipitation de particules blanches de silice,
d'anhydrite et de barite participe à la formation d'édices hydrothermaux appelés diuseurs.
76
Chapitre 3. L'écosystème hydrothermal marin
Enn, un dernier exemple de système hydrothermal marin est celui que l'on observe par
exemple dans le bassin de Guaymas. Dans le cas présent, le uide percole au travers de couches
sédimentaires pouvant atteindre 400 m d'épaisseur (sédiments d'origine planctonique très riches
en matières organiques, en hydrocarbures et sulfates). Lorsque le uide atteint la surface des
sédiments, il diuse lentement et sa température n'est que de quelques dizaines de degrés.
77
Chapitre 3. L'écosystème hydrothermal marin
L'annélide polychète A. pompejana est, comme les autres Alvinellidae, strictement endémique
des sources hydrothermales du Pacique (de 21o N à 23o S) (Desbruyères et al., 1998). C'est parce
qu'il vit sous une pluie constante de cendres que les scientiques l'ont baptisé ver de Pompéi.
A. pompejana est remarquable pour son association obligatoire avec des bactéries lamen-
teuses épibiotiques qui recouvrent totalement la surface de leur corps. Cette communauté micro-
biennes épibiotique a fait l'objet d'études métagénomiques (chapitre 2, 4.4).
78
Chapitre 3. L'écosystème hydrothermal marin
A B
C D
E F
Fig. 5 Quelques représentants de la faune hydrothermale marine profonde : A et B, Alvinella pompejana ; C
et D, Riftia pachyptila ; E et F, Rimicaris exoculata. Sources Ifremer
79
Chapitre 3. L'écosystème hydrothermal marin
R. pachyptila vit dans des zones de températures variant entre 5 et 25o C. Son tube clos à
la base, est ancré au sol. Ce ver est dépourvu de bouche et d'organe digestif. Pour assurer leur
nutrition, R. pachyptila héberge dans un organe spécique appelé trophosome, des bactéries en-
dosymbiotiques sulfo-oxydantes (Fisher et al., 1988) qui ont fait l'objet d'études métagénomiques
(chapitre 2 4.3). Ces bactéries transforment les molécules inorganiques H2 S, O2 en sucres as-
similables pour le vestimentifère. Ces molécules inorganiques semblent être véhiculées par les
hémoglobines des Riftia (Arp & Childress, 1983 ; Fisher et al., 1988 ; Flores et al., 2005).
Par dénition, la chimiosynthèse désigne la xation de CO2 à l'obscurité, par analogie avec le
80
Chapitre 3. L'écosystème hydrothermal marin
terme photosynthèse (Jannasch & Wirsen, 1979 ; Jannasch, 1985). Ainsi, au sein de l'écosystème
hydrothermal marin profond, les éléments apportés par le uide hydrothermal (CO2 , CO, CH4 ,
H2 , H2 S, N2 ...) et par l'eau de mer (O2 , SO4 ) pourraient subvenir à la croissance d'organismes
chimiolithoautotrophes, qui obtiendraient leur énergie de l'oxydation des composés réduits pré-
sents dans le uide hydrothermal (Jannasch & Wirsen, 1979 ; Londsale, 1977 ; Jannasch, 1995 ;
Karl, 1995).
Caractérisé par une variation spatiale et temporelle très importante, l'écosystème hydrother-
mal constitue un biotope particulièrement dynamique. Sur une échelle de quelques centimètres
à quelques mètres autour d'une émission hydrothermale, la température peut passer de plus de
400o C à seulement 2o C. Ce gradient thermique abrupt et les forts gradients chimiques (potentiels
d'oxydo-réduction, pH) qui en découlent dénissent diérentes niches écologiques (Fig. 6). Ces
niches répertoriées dans la revue de Karl (1995) sont les suivantes :
les communautés microbiennes en association ecto-, epi- ou endosymbiotique avec les mé-
tazoaires hydrothermaux tels que les vestimentifères, les mollusques, les crustacés ou les
polychètes,
les micro-organismes se développant sous forme de tapis ou mattes microbiennes sur les
roches basaltiques, les cheminées et sédiments exposés aux uides hydrothermaux,
les micro-organismes inféodés au panache hydrothermal chaud. Cette microore pour-
rait être issue d'une biosphère souterraine sous-jacente aux cheminées hydrothermales,
ce concept de biosphère souterraine étant corroboré par de récentes études (Takai et al.,
2004a),
les micro-organismes présents sous forme libre ou entraînés par le uide hydrothermal, et
provenant probablement d'une biosphère profonde.
Cette classication théorique permet de décrire l'organisation spatiale de communautés mi-
crobiennes et d'orienter les stratégies d'échantillonnage. Grâce au développement de techniques
d'échantillonnage, les communautés microbiennes associées aux diérents habitats proposés par
Karl ont été étudiés en conjuguant les approches culturales et les approches moléculaires de la
biodiversité microbienne.
81
Chapitre 3. L'écosystème hydrothermal marin
MICRO ORGANISMES
MESOPHILES DU PANACHE
PENETRATION
BIOSPHERE SOUTERRAINE
basalte
Fig. 6 Localisation des principaux habitats microbiens des sources hydrothermales marines (d'après Karl,
1995.
82
Chapitre 3. L'écosystème hydrothermal marin
La microore aérobie. Divers groupes de procaryotes aérobies ont été isolés. Ces derniers
peuvent oxyder divers composés tels que les composés soufrés réduits, le dihydrogène, l'ammo-
nium, le méthane et les composés en C1 réduits (par ex. : le méthanol, les méthylamines, les
halométhanes), le fer (Fe2+ ) et le manganèse (Mn2+ ) (Kelley et al., 2002).
L'oxydation aérobie des composés soufrés a été particulièrement étudiée car elle pourrait être
à la base de toute la chaîne trophique hydrothermale. La production primaire de l'écosystème
hydrothermal semble en eet être essentiellement assurée par des bactéries chimio-autotrophes
sulfo-oxydantes. Ces bactéries sulfo-oxydantes sont des γ - et ε-Proteobacteria. Ce sont des méso-
philes aliées aux genres Thiomicrospira, Thiobacillus, Sulfurimonas et Sulfurovum. La plupart
de ces isolats ont été obtenus dans des échantillons de uides ou de surfaces exposées aux uides.
Ces derniers constituent une zone de mélange entre le uide hydrothermal (chaud, anoxique,
riche en composés soufrés réduits et en CO2 ) et l'eau de mer (froide et oxygénée). Dans cette
zone de mélange, les micro-organismes disposent des oxydants O2 et NO3 ainsi que de nombreux
composés soufrés comme le sulfure d'hydrogène, le soufre élémentaire, le thiosulfate, les sulfures
minéraux (par ex. la pyrite) et les polythionates. Des bactéries sulfo-oxydantes, hétérotrophes et
mixotrophes ont également été isolées de milieux hydrothermaux. Ce sont des γ -Proteobacteria
mésophiles associées aux genre Pseudomonas, Acinetobacter et Vibrio.
83
Chapitre 3. L'écosystème hydrothermal marin
(1) A ce jour, il n’y a pas d’isolats décrits capables d’oxydation aérobie ou anaérobie de l’ammoniac, et d’oxydation anaérobie du méthane.
Tableau 1 Types de métabolismes microbiens pouvant être observés au niveau des sources hydrothermales
océaniques profondes (d'après Karl, 1995 ; Alain, 2003).
L'oxydation aérobie de l'hydrogène n'a été que récemment mise en évidence dans le milieu
hydrothermal marin profond. Cette voie métabolique est la réaction énergétique clé des Aqui-
cales appartenant au genre Persephonella, mais certaines ε-Proteobacteria procèdent également
à l'oxydation aérobie de l'hydrogène. Ces dernières sont associées aux genres Hydrogenimonas,
Caminibacter, Nitratiruptor et Nitratifractor. Ces bactéries autotrophes sont des mésophiles ou
thermophiles. Elles sont jusqu'à présent endémiques aux sources hydrothermales marines. Outre
l'oxygène, elles peuvent également réduire les composés soufrés ou le nitrate. Au sein des Archaea,
ce métabolisme a été retrouvé uniquement chez Pyrolobus fumarii qui est une espèce chimioli-
thoautotrophe stricte et aérobie facultative, dont l'optimum de température est de 106o C.
84
Chapitre 3. L'écosystème hydrothermal marin
philes appartiennent entre autres aux genres Halomonas et Alteromonas ; et les thermophiles
appartiennent aux genres Thermus, Bacillus, Marinithermus, Oceanithermus et Vulcanithermus.
Ces bactéries utilisent une grande variété de composés organiques comme donneurs d'électrons.
Aeropyrum camini est à ce jour la seule Archaea hyperthermophile aérobie stricte isolée de
l'écosystème hydrothermal marin.
La réduction des composés soufrés est probablement le mode privilégié de respiration anaé-
robie dans le pôle chaud de l'écosystème hydrothermal. La sulfato-réduction est conduite par des
bactéries mésophiles et thermophiles et par des archaea hyperthermophiles. Certaines d'entre
elles peuvent également réduire le thiosulfate, les sultes et le soufre élémentaire. Ce type de mé-
tabolisme peut être conduit en condition d'autotrophie ou d'hétérotrophie. Les sulfato-réducteurs
autotrophes incluent les archaea hyperthermophiles aliées au genre Archaeoglobus et des bac-
téries thermophiles comme Thermodesulfobacterium hydrogeniphilum et Thermodesulfatator in-
dicus (Annexe C). Les sulfato-réducteurs hétérotrophes incluent, quant à eux, divers organismes
mésophiles comme par exemple Desulfovibrio hydrothermalis et des organismes thermophiles
comme Desulfonauticus submarinus. Les bactéries sulfato-réductrices hétérotrophes utilisent cou-
ramment l'acétate comme source de carbone, mais peuvent également utiliser d'autres acides
organiques.
La respiration lithotrophique du soufre a été mise en évidence chez une crenarchaeote hy-
perthermophile du genre Ignicoccus et chez les bactéries thermophiles appartenant aux genres
Desulfurobacterium et Balnearium. Jusqu'à ce jour, ces bactéries ont été trouvées uniquement
dans les environnements hydrothermaux marins profonds. Il semble que ces bactéries jouent un
rôle important en tant que producteurs primaires de matière organique dans les zones anaérobies
du pôle hydrothermal chaud. Des ε-Proteobacteria respirant la soufre ont également été mises en
évidence, il s'agit des espèces Nautilia litotrophica, Caminibacter hydrogeniphilus, Lebetimonas
acidiphila et Thioreductor micantisoli.
La culture d'ε-Proteobacteria issues d'échantillons hydrothermaux est très récente. Leur pré-
sence dans l'écosystème hydrothermal semblait évidente depuis de nombreuses années. Des in-
ventaires moléculaires réalisés sur des échantillons hydrothermaux avaient en eet montré que de
nombreux phylotypes aliés aux ε-Proteobacteria étaient fréquemment et abondamment iden-
tiés dans cet écosystème (cf 5.2.3). Cependant, ces phylotypes n'avaient jusqu'à ces dernières
85
Chapitre 3. L'écosystème hydrothermal marin
années pas de représentants cultivés. Très récemment, plusieurs ε-Proteobacteria ont pu nale-
ment être isolées de collecteurs in situ, de fragments de cheminées et de spécimens d'A. pompejana
(Takai et al., 2003 ; Miroshnichenko et al., 2004 ; Alain et al., 2002b ; Miroshnichenko et al.,
2002 ; Takai et al., 2005b, 2004b ; Nakagawa et al., 2005d ; Inagaki et al., 2004, 2003 ; Camp-
bell et al., 2001 ; Nakagawa et al., 2005a ; Voordeckers et al., 2005). Ces dernières sont toutes
des mésophiles ou thermophiles modérées chimiolithoautotrophes, anaérobies ou microaérophiles
ayant la capacité d'utiliser le nitrate et/ ou des composés soufrés comme accepteurs d'électrons.
Les ε-Proteobacteria semblent particulièrement adaptées aux conditions uctuantes des zones de
mélange entre le uide hydrothermal et l'eau de mer. Leur abondance, leur diversité génétique et
physiologique en font des producteurs primaires potentiels de premier ordre dans les zones anaé-
robies ou dans les zones de mélange entre le uide hydrothermal et l'eau de mer. Ces bactéries
participent au cycle du soufre en réduisant ou en oxydant le soufre élémentaire ou les composés
soufrés.
86
Chapitre 3. L'écosystème hydrothermal marin
Les bactéries organohétérotrophes les plus thermophiles des sources hydrothermales appar-
tiennent aux genres Thermosipho, Thermotoga et Marinitoga (ordre des Thermotogales ).
La réduction du fer ferrique, qui est un composé abondant dans l'écosystème hydrothermal
profond, a été montrée en présence d'hydrogène chez l'archaea hyperthermophile Geoglobus ahan-
garii et la bactérie thermophile Deferribacter abyssi.
Récemment, une archaea coccoïde de très petite taille (400 nm de diamètre) a été cultivée en
coculture avec une archaea hyperthermophile chimiolithoautotrophe du genre Ignicoccus. Cette
archaea Nanoarchaeum equitans possède le plus petit génome archaea connu (0.5 Mpb). Une
étude récente a d'ailleurs permis de détecter ce type d'organisme dans des sources hydrothermales
marines profondes (Hohn et al., 2002).
Les études moléculaires portant sur des échantillons du pôle tiède de l'écosystème hydro-
thermal ont révélé que les ε-Proteobacteria représentaient un groupe extrêmement divers et
abondant. Des séquences d'ARNr 16S aliées aux ε-Proteobacteria ont été majoritairement re-
trouvées dans des banques de clones réalisées à partir d'échantillons de tapis microbiens (Moyer
et al., 1995 ; Longnecker & Reysenbachach, 2001), dans des colonisateurs in situ (Reysenbach
et al., 2000 ; Corre et al., 2001 ; Lopez-Garcia et al., 2003a), dans la microore épibiotique des
métazoaires hydrothermaux (Haddad et al., 1995 ; Campbell & Cary, 2001 ; Alain et al., 2002a ;
Lopez-Garcia et al., 2002) et dans les émissions de uide hydrothermal dius (Huber et al., 2003).
87
Chapitre 3. L'écosystème hydrothermal marin
Outre les séquences aliées aux ε-Proteobacteria, des séquences aliées aux γ - α- δ - Proteo-
bacteria, aux Verrumicrobia, aux Aquicales, au groupe des Cytophaga-Flavobacterium-Bacteroides
(CFB), au genre Desulfurobacterium et aux divisions candidates OP8, OP11, WS6 et ABY ont
été recensées dans les inventaires moléculaires du pôle tiède de l'écosystème hydrothermal. Un
inventaire moléculaire portant sur un échantillon de tapis microbien se développant à proximité
de sources hydrothermales marines du volcan sous-marin Loihi a révélé la présence d'archaea
planctoniques aliées au marine Crenarchaeota groupe I et marine Euryarchaeota groupe II
(Moyer et al., 1998).
Les inventaires moléculaires portants sur des échantillons hydrothermaux profonds ont donc
mis en évidence une très grande diversité au sein des Bacteria et des Archaea, répartie dans
quasiment tous les phyla identiés à ce jour. Beaucoup de séquences détectées correspondent à
de nouvelles lignées ne possédant aucun représentant cultivé, certaines d'entres elles semblant
être inféodées à cet écosystème profond.
88
Chapitre 3. L'écosystème hydrothermal marin
Thermotoga maritima
Rhodothermus obamensis
BACTERIA Escherichia coli
DHVA1
Ancient Archaeal Group
SHVA1
Korarchaeota Korarchaeota
THSC1
Terrestrial Hot Spring
Crenarchaeotic Group
pJP41
THSC2
pJP33
Thermofilum pendus
Pyrobaculum aerophilum
Thermoproteus tenax
Sulfolobus metallicus
Sulfolobus solfataricus
Sulfolobus shibatae
Acidianus ambivalence
Acidianus brierleyi Hyperthermophilic Crenarchaeota
Sulfolobus acidocaldarius
Stygiolobus azoricus
Desulfurococcus mobilis
Staphylothermus marinus
Aeropyrum pernix
Pyrolobus fumarii
Hyperthermus butylicus
Pyrodictium occultum
Methanopyrus kandleri
pMC2A384
Methanococcus jannaschii
Methanococcus igneus
Methanococcus voltae
Methanococcus vannielli
Thermococcus fumicolans
Pyrococcus furiosus Hyperthermophilic Euryarchaeota
Thermococcus celer
ARCHAEA Methanothermus sociabilis
Methanobacterium formicicum
Methanobacterium thermoautotrophicum
pMC2A228
pJP9
Archaeglobus fulgidus
DHVE3
DHVE4
Deep-sea Hydrothermal Vent
DHVE5 Euryarchaeotic Group II (DHVE Group II)
DHVE6
Fig. 7 Arbre phylogénétique illustrant les nouvelles lignées d'Archaea (en gras) mises en évidence dans les
sources hydrothermales marines profondes par Takai et Horikoshi (1999) (voir cette référence pour le détail
des méthodes de phylogénétie utilisées). Les triangles suivis d'un nom en caractères gras indiquent les nou-
velles lignées identiées par les auteurs. DHVE, Deep-sea Hydrothermal Euryarchaeota. L'échelle indique 0.1
substitution par position (d'après Takai & Horikoshi, 1999).
89
Chapitre 3. L'écosystème hydrothermal marin
90
Chapitre 4
Objectifs de la thèse
Chapitre 4. Objectifs de la thèse
92
Chapitre 4. Objectifs de la thèse
L'une des activités du laboratoire dans lequel j'ai eectué ma thèse est centrée sur l'étude de
la diversité microbienne de l'écosystème hydrothermal marin profond. La première phase de cette
activité a tout d'abord consisté à faire appel à des techniques culturales pour étudier la diversité
microbienne de cet écosystème. Cette approche a permis d'isoler des centaines de souches ap-
partenant au domaine des Archaea et des Bacteria. Les premières souches isolées au laboratoire
furent essentiellement des archaea hyperthermophiles anaérobies stricts appartenant à l'ordre
des Thermococcales (Prieur et al., 1995). Des bactéries aérobies appartenant aux genres Bacillus
(Marteinsson et al., 1996) et Thermus (Marteinsson et al., 1995) furent également isolées. Par
la suite, les travaux ont été orientés vers la culture des micro-organismes autotrophes. Ces tra-
vaux ont abouti à l'isolement d'archaea méthanogènes hyperthermophiles appartenant à l'ordre
des Methanococcales (Jeanthon et al., 1998, 1999) , ainsi qu'à l'isolement de bactéries sulfo-
et sulfato-réductrices telles que les souches Desulfurobacterium thermolithotrophum (L'Haridon
et al., 1998) et Thermodesulfobacterium hydrogenophilum (Jeanthon et al., 2002).
An de compléter les informations issues de l'approche culturale, des techniques moléculaires
d'écologie microbienne ont été dans un second temps développées au laboratoire. L'approche
moléculaire a tout d'abord consisté à identier phylogénétiquement les micro-organismes de
l'écosystème hydrothermal. Pour cela, des inventaires d'ARNr 16S ont été générés par PCR
et/ou RT-PCR, puis ont été analysés. La mise au point de sondes oligonucléotidiques ciblant
l'ARNr 16S des micro-organismes fréquemment rencontrés dans les systèmes hydrothermaux a
ensuite permis de les quantier par Fluorescence In Situ Hybridization (FISH). Des échantillons
hydrothermaux provenant des diérentes niches de l'écosystème hydrothermal ont été ainsi étu-
diées au sein du laboratoire, faisant l'objet de plusieurs articles et thèses (Harmsen et al., 1997 ;
Corre, 2000 ; Corre et al., 2001 ; Nercessian, 2003 ; Nercessian et al., 2003, 2004, 2005b). Les
résultats issus de ces études ont notamment contribué à révéler l'étendue de la diversité des
micro-organismes incultivés. Des séquences d'ARNr 16S de bactéries et archaea dont la position
phylogénétique est éloignée de celles d'organismes isolés ont été identiées. Ce fut par exemple
le cas, au sein des Bacteria, de la mise en évidence de nombreux phylotypes associés à des ε-
Proteobacteria incultivées (Corre, 2000 ; Corre et al., 2001). Au sein des Archaea, des séquences
aliées aux DHVE, aux Crenarchaeota marines du groupe I et aux Korarchaeota ont pu égale-
ment être détectées (Nercessian, 2003 ; Nercessian et al., 2003, 2004, 2005b).
93
Chapitre 4. Objectifs de la thèse
suite utilisés, an d'étudier la diversité fonctionnelle des micro-organismes hydrothermaux (Ner-
cessian et al., 2005a). Plusieurs séquences obtenues lors de cette étude n'ont pu être aliées à
des séquences de gènes appartenant à des organismes cultivés, montrant l'existence de nouvelles
lignées au sein des trois groupes fonctionnels étudiés.
La microore incultivée présente dans la zone de mélange entre le uide hydrothermal et l'eau
de mer a été plus particulièrement ciblée pour ce travail de thèse. Pour cela, deux types d'échan-
tillons prélevés dans cette zone de mélange ont été étudiés. Le premier échantillon consistait en
un biolm microbien collecté lors d'une expérience de colonisation, à la surface d'un colonisateur
in situ. Le deuxième échantillon consistait quant à lui, en des tubes d'Alvinellidae prélevés sur
la paroi d'une cheminée hydrothermale active. Les deux échantillonnages ont été eectués lors
de la campagne océanographique PHARE qui s'est déroulée au printemps 2002, sur un site hy-
drothermal de la dorsale du Pacique oriental (13o N EPR).
J'ai commencé ma thèse par l'étude de la communauté microbienne du biolm. Pour cela, j'ai
utilisé les outils moléculaires déjà mis en place avant mon arrivée au laboratoire. Des banques
d'ADNr 16S générées par PCR ont été construites an d'inventorier les micro-organismes du
biolm, et leur abondance a été déterminée par FISH. Pour compléter les informations issues de
cette approche moléculaire, les micro-organismes ont été observés par microscopie électronique
à balayage (MEB) et la composition chimique de l'échantillon été déterminée par spectroscopie
dispersive en énergie (EDS) et par diraction aux rayons X.
Par la suite, j'ai choisi d'utiliser une seconde approche an d'étudier la microore incultivée
associée aux tubes d'Alvinellidae. Pour cela, j'ai mis au point au laboratoire l'utilisation d'une
nouvelle technique d'écologie microbienne, la métagénomique. Cette approche indépendante des
méthodes de culture, permet non seulement de s'aranchir des biais inhérents à la PCR, mais
également d'accéder aux génomes des micro-organismes incultivés. L'accès à ces génomes laisse
présager l'identication de gènes fonctionnels pouvant être placés sur le génome à proximité d'un
marqueur phylogénétique, permettant ainsi de faire un lien entre l'identité moléculaire, la fonc-
tion et l'activité métabolique d'un organisme incultivé.
94
Chapitre 4. Objectifs de la thèse
Ces diérents points sont abordés dans mes travaux de thèse. Après avoir détaillé le matériel
et les méthodes utilisés pour l'approche méthodologique de la métagénomique (deuxième partie
du manuscrit de thèse), ces diérents points sont présentés et discutés dans la troisième partie de
ce manuscrit, sous forme d'articles parus ou sous presse. Enn les résultats les plus importants
issus de ces travaux de thèse, sont commentés et mis en perspective dans une dernière partie
intitulée Discussion et Perspectives.
95
Chapitre 4. Objectifs de la thèse
96
Matériels et Méthodes
97
98
Construction et criblage de la banque
métagénomique
100
Matériels et Méthodes. Construction et criblage de la banque métagénomique
Dans le cadre de ma thèse, j'ai construit une banque métagénomique à partir d'ADN extrait
de la microore associée à des tubes d'A. pompejana. Cette banque, qui est présentée dans les
études 2 et 3 de ce manuscrit, a été réalisée en utilisant le kit CopyControlT M Fosmid Library
Production Kit (Epicentre). Avant celle-ci, la construction d'une banque métagénomique n'avait
jamais été tentée dans le laboratoire où j'ai eectué ma thèse.
Lors de la mission océanographique PHARE (2002, dorsale du pacique oriental, 13o N EPR),
des spécimens d'Alvinella pompejana associés à leur tube ont été récoltés à une profondeur de
2624 m. Ces polychètes ont été prélevés sur les parois d'une cheminée hydrothermale active du
site Elsa (12o 48.180 N, 103o 56.315 W) à l'aide du robot téléopéré Victor. Ils ont été ensuite trans-
férés dans une boîte étanche, an de minimiser leur contamination lors de la remontée à la surface.
A bord, les polychètes ont été extraits de leurs tubes. Ces tubes ont été déposés dans un
acon contenant de l'eau de mer stérile. Cette préparation a été agitée vigoureusement au vortex
an de détacher les cellules procaryotes se trouvant à la surface des tubes. Ces derniers ont été
retirés de la préparation et les cellules procaryotes ont été culotées par centrifugation pendant 15
min à 12000 g. Pour extraire l'ADN génomique de ces cellules, on a alors utilisé le kit UltraClean
DNA (MoBio), selon les indications du manufacturier.
An de purier au maximum cet ADN génomique, une extraction supplémentaire de l'ADN
a ensuite été réalisée en utilisant des solvants (phénol, chloroforme et acide isoamylique), comme
décrit ci-dessous :
ajouter un volume de PCI (phénol /chloroforme / acide isoamylique : 25 /24 /1),
agiter par retournement pendant ∼45 sec (une émulsion jaune laiteuse doit se former),
centrifuger à 20000 g pendant 15 min à 4o C,
101
Matériels et Méthodes. Construction et criblage de la banque métagénomique
récupérer la phase aqueuse supérieure contenant les acides nucléiques, avec un cône bleu
(dont on aura coupé le bout au ciseau de manière à en élargir l'ouverture pour ne pas
casser l'ADN).
Cette opération a été eectuée une deuxième fois, puis fut suivie d'un traitement au chloro-
forme. Ce traitement permet d'éliminer les traces de phénol pouvant inhiber les futures réactions
enzymatiques. Il a consisté à :
ajouter un volume du mélange chloroforme /alcool isoamylique (24 /1),
agiter vigoureusement à la main,
centrifuger à 20000 g pendant 10 min à 4o C,
récupérer la phase aqueuse supérieure qui contient les acides nucléiques, comme décrit
précédemment.
L'ADN contenu dans la phase aqueuse a été ensuite précipité à température ambiante avec
de l'isopropanol, en procédant de la manière suivante :
ajouter 0.1 volume d'acétate de sodium (3 M, pH 5.2) et 0.7 volume d'isopropanol 100%,
puis agiter doucement par retournement (des laments translucides d'ADN apparaissent
dans la solution),
laisser reposer environ 5 min à température ambiante,
pécher l'ADN en enroulant délicatement les laments sur une pipette Pasteur coudée.
L'ADN a alors été lavé en trempant l'extrémité de la pipette Pasteur dans un microtube
contenant 500 µL d'éthanol 75%. Après avoir laissé sécher à l'air l'ADN enroulé sur la pipette
pendant environ 5 min, l'extrémité de la pipette Pasteur portant l'ADN a été cassée puis placée
dans un autre microtube contenant 150 µL de tampon TE 1X (10 mM Tris/HCl, 2 mM EDTA,
pH 8). L'ADN se réhydrate ainsi dans le tampon pendant toute une nuit à 4o C.
L'extraction de l'ADN génomique est une étape cruciale pour la réussite de la construction
d'une banque métagénomique. La diculté de cette étape tient dans le fait que l'on doit obtenir
de l'ADN de haut poids moléculaire (>40 kpb), en quantité susante (un minimum de 20 µg à
une concentration de 0.5 µg.µL−1 est requis) et avec un excellent degré de pureté. An d'éviter
de la dégrader, l'ADN doit être manipulé (congélation/ décongélation, pipetage) un minimum
de fois et ne doit surtout pas être exposé aux rayons UV. En eet, même une brève exposition
aux rayons UV peut endommager l'ADN et réduire l'ecacité de clonage de 100 à 1000 fois.
102
Matériels et Méthodes. Construction et criblage de la banque métagénomique
Pour construire la banque métagénomique présentée dans ce travail de thèse, nous avons
choisi d'utiliser un vecteur de clonage de type fosmide. Ce type de vecteur permet de cloner
des fragments d'ADN dont la taille est comprise entre 35 et 45kpb (cf. introduction, chapitre 2,
3.3.1). Nous nous sommes donc assurés que l'ADN génomique que nous avions extrait avait un
poids moléculaire ≥40 kpb.
L'intégrité et l'estimation de la taille de l'ADN génomique ont été vériées par électrophorèse
en gel d'agarose. Un gel d'agarose LMP (Low Melting Point, Eurobio) à 1% (poids /vol.) dans du
tampon TAE 1X (0.04 M Tris-acétate, 0.001 M EDTA) a été coulé dans un moule rectangulaire
de 20 cm de long. Un échantillon de l'ADN génomique et le marqueur T7 (marqueur de taille
d'ADN migrant à 40 kpb, commercialisé par Epicentre) ont été chargés en parallèle dans ce gel
toute la nuit, sous une tension de 30 V. Une fois la migration terminée, le gel a été coloré pendant
15 min dans un bain de bromure d'éthidium (BET, agent intercalant de l'ADN) à 0.5 mg.L−1 ,
puis rincé pendant 20 min dans de l'eau distillée. L'échantillon d'ADN génomique a été visualisé
en exposant le gel aux rayons UV.
L'ADN génomique ayant migré à la même vitesse que le marqueur de taille T7, nous avons
procédé directement à l'étape suivante qui consiste à réparer les extrémités de l'ADN génomique.
Si l'ADN génomique avait migré plus lentement que le marqueur de taille T7 (dans ce cas l'ADN
génomique aurait eu un poids moléculaire >40 kpb), une étape supplémentaire de fragmentation
mécanique de l'ADN aurait été nécessaire. Cette fragmentation mécanique aurait consisté à
pipeter plusieurs fois l'ADN au travers d'un cône de 200 µL. Les étapes qui suivent ont été
réalisées en utilisant le matériel du kit CopyControlT M Fosmid library production (Epicentre)
en suivant les indications du manufacturier.
103
Matériels et Méthodes. Construction et criblage de la banque métagénomique
mélange d'enzymes de réparation des extrémités incluant les enzymes T4 ADN polymérase
et T4 polynucléotide kinase (Epicentre) : 4 µL
eau milliQ : quantité pour compléter le volume à 80 µL
Ajouter du tampon de charge puis incuber pendant 10 min à 70o C pour arrêter la réaction
de réparation.
Une fois la migration éléctrophorétique terminée, le protocole suivant a été réalisé an d'éviter
d'exposer l'ADN génomique aux rayons UV et de sélectionner malgré tout, les fragments d'ADN
génomique ayant une taille de 40 kpb. Les parties du gel contenant les marqueurs T7 et Low
Range PFG Marker (bandes se trouvant de part et d'autre de celle contenant l'ADN génomique)
ont été découpées avec des lames stériles. La bande contenant l'ADN génomique a été mise de
côté ; les bandes contenant les marqueurs ont été quant à elles colorées dans un bain de BET, puis
visualisées sous lumière UV. Un repère indiquant la position du marqueur T7 a été pointé sur les
bandes de gel à l'aide d'une pipette Pasteur. La lumière UV a été éteinte, puis toutes les bandes
ont été réassemblées an de reconstituer le gel. Une bande de gel de 2 à 4 mm d'épaisseur qui
contient l'ADN génomique ayant migré à hauteur des repères du marqueur T7, a été découpée
à l'aide d'une lame stérile puis placée dans un tube Falcon 15 mL qui aura été préalablement
taré. A cette étape, la bande de gel contenant les fragments d'ADN génomique qui ont migré à
40 kpb peut être stockée à 4o C ou à -20o C, pendant un an.
104
Matériels et Méthodes. Construction et criblage de la banque métagénomique
An d'éluer les fragments d'ADN génomique de 40 kpb contenus dans la bande de gel d'aga-
rose LMP, eectuer le protocole suivant :
peser le tube Falcon 15mL qui a été préalablement taré, pour déterminer le poids de la
bande d'agarose contenant les fragments d'ADN génomique de 40 kpb (considérer que 1
mg d'agarose solide donnera 1 µL d'agarose fondu),
préchauer le tampon GELase 50X (2mM Tris-Bis [pH 6], 2 M NaCl ; Epicentre) à 45o C,
faire fondre l'agarose dans un bain-marie préchaué à 70o C pendant 10 à 15 min, puis
transférer rapidement le tube dans un bain-marie préchaué à 45o C,
ajouter la quantité appropriée de tampon GELase 50X préchaué de manière à obtenir
une concentration nale de 1X,
ajouter 1 unité (1 µL) d'enzyme GELase (Epicentre) pour 100 µL d'agarose fondu, main-
tenir le tube à 45o C et l'agiter doucement,
incuber la solution à 45o C pendant au moins 1 heure (une incubation pendant toute la nuit
est possible),
transférer la réaction à 70o pendant 10 min an d'inactiver l'enzyme GELase,
écarter 15 µL de cette solution pour une quantication ultérieure de l'ADN sur gel d'agarose
et répartir dans des microtubes stériles de 1.5 mL, le restant de la solution en fractions de
500 µL
refroidir le(s) tube(s) dans un bain de glace pendant 5 min,
centrifuger pendant 20 min à 20000 g an de culoter les oligosaccharides insolubles,
prélever 90 à 95% du surnageant (l'ADN se trouve dans le surnageant) puis le transférer
dans un microtube de 1.5 mL. Prendre garde à ne pas prélever le culot gélatineux.
An de précipiter l'ADN qui se trouve dans le surnageant, procéder de la manière suivante :
105
Matériels et Méthodes. Construction et criblage de la banque métagénomique
La concentration de l'ADN avant précipitation a été évaluée sur un gel d'agarose, ceci an
de connaître la quantité de tampon TE qu'il faut ajouter pour obtenir, après la précipitation de
l'ADN une concentration nale de 0.1 µg.µL−1 . Les 15 µL de solution qui ont été écartés lors
de l'élution de l'ADN, ont été déposés dans un gel d'agarose à 0.9% préparé dans du tampon
TAE 1X. La migration éléctrophorétique a été eectuée à un voltage de 75 V pendant 1h30. Des
concentrations connues de marqueur d'ADN T7 ont été mises à migrer en parallèle avec l'ADN
an d'estimer par comparaison sa concentration.
5 Réaction de ligation
La réaction de ligation permet de cloner les fragments d'ADN génomiques de 40 kpb dans
des vecteurs de clonage de type fosmide. Cette réaction a été eectuée en mélangeant les réactifs
dans l'ordre indiqué ci-dessous :
eau milliQ stérile : quantité susante pour compléter le volume nal à 10 µL
tampon de ligation Fast-Link 10X (Epicentre) : 1 µL
ATP 10 mM : 1 µL
vecteur CopyControl pCC1FOS1 0.5 µg.µL−1 : 1 µL
ADN génomique : 0.25 µg d'ADN génomique de 40 kpb
ADN ligase Fast-Link (2 U.µL−1 , Epicentre) : 1 µL
Cette réaction a été réalisée dans un volume nal de 10 µL, à température ambiante, pen-
dant 2 heures. Le ratio de 10 :1 de vecteur CopyControl pCC1FOS1 pour de l'ADN génomique
est optimal pour la réaction de ligation (0.5 µg de vecteur CopyControl pCC1FOS équivaut à
0.09 pmole et 0.25 µg d'ADN génomique de 40 kpb équivaut à 0.009 pmole). Sous ces conditions,
une réaction permet d'obtenir entre 103 et 106 clones, en fonction de la qualité de l'insert d'ADN.
An d'inactiver la ligase, le mélange a été ensuite incubé pendant 10 min à 70o C. A ce
moment, on a le choix de conserver l'échantillon à -20o C ou bien de procéder à l'étape suivante.
106
Matériels et Méthodes. Construction et criblage de la banque métagénomique
de 40 kbp, dans des particules de phage λ. Cette réaction a été réalisée de la façon suivante :
décongeler dans de la glace, un tube d'extraits de phage MaxPlax λ Packaging (Epicentre),
une fois décongelé, transférer immédiatement la moitié du contenu du tube (soit 25 µL
d'extraits de phage) dans un second tube de 1.5 mL qu'on placera dans de la glace,
recongeler immédiatement les 25 µL restants d'extrait de phage à -70o C,
ajouter les 10 µL de la réaction de ligation dans les 25 µL d'extraits de phage décongelés,
mélanger plusieurs fois la préparation par pipetage, en évitant de former des bulles, puis
centrifuger brièvement le tube,
incuber 90 min à 30o C,
ajouter les 25 µL d'extraits de phage qui ont été recongelés,
incuber à nouveau les réactions à 30o C pendant 90 min,
ajouter du tampon de dilution de phage (10 mM de Tris-HCl [pH 8.3], 100 mM de NaCl,
10 mM de MgCl2), de manière à obtenir un volume nal de 1 mL, et mélanger doucement,
ajouter 25 µL de chloroforme (un précipité visqueux peut se former) et conserver à 4o C.
déterminer le titre des particules de phage et procéder à l'étape suivante, ou bien conserver
les particules de phage à 4o C (conservation possible pour quelques semaines).
107
Matériels et Méthodes. Construction et criblage de la banque métagénomique
9 Conservation de la banque
Les clones ont tous été individuellement repiqués dans des plaques de 96 puits contenant
200 µL de milieu de culture sélectif et mises à incuber pendant 17 heures à 37o C. Le milieu de
culture contenait du LB, du chloramphénicol à 12.5 µg.mL−1 et du milieu Hogness 1X. L'ajout
de milieu Hogness au LB permet de congeler directement les clones après les avoir fait pousser
dans ce milieu de culture. Les cultures ont d'abord été congelées à -20o C puis à -80o C. Le
milieu Hogness a été préparé à une concentration de 10X, aliquoté, autoclavé puis conservé à
température ambiante. A cette concentration, il contient : 36 mM de K2 HPO4 . 3H2 O, 13 mM
de KH2 PO4 , 20 mM de citrate-Na3 , 2H2 O 10mM MgSO4 . 7H2 O et 44% (v/v) de glycérol.
10 Criblage de la banque
Le criblage de la banque métagénomique a été réalisé par PCR. Les séquences cibles de ces
PCR étaient le gène codant l'ARNr 16S des Archaea et le gène codant l'ARNr 18S des eucaryotes.
Les clones de la banque ayant dans leur insert l'un de ces gènes ont ainsi pu être détectés.
Pour faciliter le criblage de la banque, les clones de la banque ont été mélangés de façon à
former des pools ; un pool étant constitué de 24 clones diérents (9 µL de culture par clone).
Le but de ce pooling était de minimiser le nombre de PCR nécessaire pour cribler la banque.
Les pools ont été centrifugés à 8000 g pendant 5 min, puis resuspendus dans 215 µL de tampon
TE [pH 8]. Un petit volume (2.5 µL) de chaque pool a été lysé à 95o C pendant 10 min puis a
servi comme matrice d'ADN pour la réaction de PCR. Le mélange réactionnel des PCR était le
suivant :
Tampon 10X : 1.25 µL (1X nal),
MgCl2 50 mM : 0.375 µL (1.5 mM nal),
108
Matériels et Méthodes. Construction et criblage de la banque métagénomique
Tableau 1 Liste des amorces utilisées pour l'amplication par PCR de fragments d'ADNr 16S archaéens et de
fragments d'ARNr 18S eucaryotes. S= amorce sens, AS=amorce anti-sens. La position des amorces correspond
à Thermococcus celer pour les amorces d'Archaea, et à Saccharomyces cerevisiae pour les amorces d'eucaryotes.
Les amorces suivantes (Tableau 1) ont été utilisées pour les diérentes réactions d'amplica-
tion.
Les produits d'amplications ont été ensuite visualisés sur gel d'agarose 0.8% préparé dans du
tampon TAE 1X. Seuls les pools contenant un ou plusieurs clones dont les fosmides ont l'un des
gènes ciblés dans leur insert, doivent présenter une bande d'amplication. Un second criblage par
PCR, a ensuite permis d'identier le(s) clone(s) positif(s) dans les pools présentant des produits
d'amplication.
109
Matériels et Méthodes. Construction et criblage de la banque métagénomique
110
Résultats
Étude 1
Novel uncultured Epsilonproteobacteria dominate a lamentous sulphur mat
from the 13o N hydrothermal vent eld, East Pacic Rise 113
Étude 2
Characterization of a 40 kbp uncultivated euryarchaeotal fosmid from a mi-
crobial community associated to the hydrothermal vent polychaete annelid,
Alvinella pompejana 139
Étude 3
Thermophilic lifestyle for an uncultured archaeon from hydrothermal vents :
evidence from environmental genomics 167
112
Étude 1
Novel uncultured
Epsilonproteobacteria dominate a
filamentous sulphur mat from the
13oN hydrothermal vent field,
East Pacific Rise
Étude 1
114
Etude 1. Introduction
La formation très rapide du biolm sur notre colonisateur in situ, nous a fait penser aux
dépôts très spectaculaires de oculats blancs répertoriés à plusieurs reprises sur des sites hy-
drothermaux profonds (Kelley et al., 2002 ; pour revue) (Fig. 1.A). Ces oculats blancs sont
entraînés et émis par le uide hydrothermal peu de temps après des éruptions volcaniques. Leur
émission est parfois tellement intense et massive, que pour imager le phénomène, on le compare
à une tempête de neige, et les édices hydrothermaux sont appelés snowblowers (Fig. 1.B).
Des analyses de ces oculats ont révélé qu'il s'agissait de laments de soufre biogénique
associés à des micro-organismes. Ces derniers n'ont été ni isolés en culture pure, ni phylogé-
nétiquement caractérisés. Toutefois, une expérience de culture réalisée en laboratoire a permis
d'enrichir ces micro-organismes (Taylor et al., 1999). Pour cela, des échantillons de biolms hy-
drothermaux (Fig. 2.A à D) ont été incubés en condition de microaérophilie, dans un réacteur.
Ce réacteur qui est alimenté en continu par de l'eau de mer, permet d'établir un gradient d'H2 S
allant d'une concentration de 400µM à 1200µM (Fig. 2.F). Des laments de soufre identiques à
ceux des sites hydrothermaux, ont été rapidement observés dans le réacteur (comparer Fig. 2.D
et G). Les micro-organismes responsables de leur formation étaient des vibrions mobiles de type
v (Fig. 2.E et H). Les micro-organismes de type c (bâtonnets assemblés en chaînes) qui étaient
également associés aux laments de soufre hydrothermaux, n'ont pas été enrichis dans ce réacteur
(Fig. 2.E). La caractérisation des vibrions responsables de la formation des laments de soufre,
115
Etude 1. Introduction
A B
Fig. 1 Quelques photographies de mattes microbiennes observées sur des sites hydrothermaux profonds. (A)
Photographie de mattes bactériennes (matériel blanc) tapissant des roches basaltiques provenant d'une éruption
volcanique sur la dorsale Juan de Fuca, en 1993. (B) Photographie montrant l'expulsion de oculats blancs
entraînés par le uide hydrothermal, peu de temps après une éruption volcanique sur la dorsale du Pacique
oriental (9o N EPR) (d'après Haymon et al., 1993). Ce phénomène donne l'impression d'assister à une tempête
de neige (source Kelley et al., 2002).
n'est pas allée plus loin. Cependant, leur morphologie est très comparable à celle d'un organisme
isolé d'eau de mer côtière qui produit des laments de soufre identiques à ceux observés sur
les sites hydrothermaux (comparer Fig. 2.H et I) (Taylor & Wirsen, 1997 ; Taylor et al., 1999).
Cet organisme marin a été par la suite caractérisé (Wirsen et al., 2002). Il s'agit d'une bactérie
microaérophile, sulfo-oxydante et autotrophe, qui est aliée aux Epsilonproteobacteria, et pour
laquelle le nom de Candidatus Arcobacter Suldicus a été proposé.
Le biolm qui s'est formé sur le otteur de notre module de colonisation ressemblait à ce-
lui qui avait été caractérisé par Taylor et ses collaborateurs (1999). Cet article présente l'étude
approfondie de ce biolm. Ce dernier a été observé en microscopie électronique à balayage. Sa
composition chimique a été caractérisée par diraction aux rayons X et par observation micro-
scopique électronique à balayage couplée à une analyse de spectroscopie à dispersion d'énergie
(SEM-EDS). La composition microbienne du biolm a été ensuite étudiée par des techniques
phylogénétiques moléculaires (inventaires des gènes aclB et des gènes codant les ARNr 16S).
Enn, une sonde ciblant les micro-organismes présents dans ce biolm a été mise au point, an
de les quantier.
116
Etude 1. Introduction
Fig. 2 Formation de biolms contenant des laments de soufre d'origine microbienne. Ces biolms ont été
observée sur le site hydrothermal 9o N EPR et dans une culture de micro-organismes réalisée à bord d'un bateau.
(A et B) : Observation du biolm contenant des laments de soufre, sur un module de colonisation déployé au
niveau du site hydrothermal 9o N EPR ; barre : 5 cm. (C) : Agrandissement photographique du biolm ; barre :
1 cm. (D) : Photographie à contraste de phase du biolm ; barre : 10 µm. (E) : Observation microscopique
des micro-organismes du biolm ; barre : 2 µm. (F) : Schéma du réacteur ayant permis la culture en continue
des micro-organismes du biolm. L'inoculum provient d'un échantillon du biolm prélevé sur le module de
colonisation. SW : eau de mer oxygénée. (G) : Microphotographie à contraste de phase des laments de soufre
produits à bord du bateau, dans le réacteur ; barre : 10 µm. (H) : Micro-organismes enrichis dans le réacteur.
(I) : Micro-organisme isolé d'eau de mer cotière peu profonde, produisant le même type de biolm que celui
observé sur le site hydrothermal 9o N EPR ; barre : 2 µm (d'après Taylor et al., 1999).
117
Etude 1. Introduction
118
Etude 1
2 H. Moussard et al.
filamentous bacteria have also often been observed after Material and methods
recent eruptive events or at sites of extensive emission
discharges at Loihi hydrothermal vents, Guaymas Basin, on Hydrothermal site description
the East Pacific Rise (EPR) and Juan de Fuca ridge (Nelson
The hydrothermal sample was collected at the 131N hydro-
et al., 1991; Haymon et al., 1993; Embley et al., 1995, 2000;
thermal vent field on the EPR during the oceanographic
Moyer et al., 1995; Shank et al., 1998; Taylor et al., 1999).
cruise PHARE conducted with the research vessel ‘L’Ata-
Subsequent studies of the emitted particles showed that they
lante’ and the remoted operated vehicle (ROV) ‘Victor 6000’.
were composed of inorganic, sulphur-rich filaments with a
The portion of the EPR situated at 131N is about 300 km
low organic carbon content (Nelson et al., 1991). The
south of the Orozco fracture zone and 100 km north of a
associated microorganisms have never been isolated or
small transform fault located at 11149 0 N. At 131N, the
phylogenetically characterized. However, the formation of
dome-shaped ridge has a central rift valley varying between
filamentous sulphur of morphology nearly identical to the
200 m and more than 600 m in width and with a mean depth
material discharged from diffuse-flow hydrothermal vents
of about 2600 m (Hekinian & Fouquet, 1985). The volcanic
was documented for a sulphide-oxidizing bacterium iso-
activities at 131N give rise to a wide range of hydrothermal
lated from shallow coastal marine waters (Taylor & Wirsen,
venting structures from diffuse vents (up to 100 1C) to black
1997; Taylor et al., 1999). An extensive characterization
smokers with temperatures above 350 1C. Our study focuses
revealed that this motile vibrioid autotrophic organism
on the PP12 chimney of the Genesis hydrothermal site
clustered with members of the genus Arcobacter within the
(12148 0 6600 N, 103156 0 4400 W). The chimney was colonized
Epsilonproteobacteria (Wirsen et al., 2002).
by dense populations of the polychaetous annelid Alvinella
Molecular examination of mats attached to chimneys,
pompejana that builds tubes directly in contact with the
animal surfaces and various sampling devices also revealed
sulphides. Few specimens of the tube-worm Riftia pachyptila
microbial communities dominated by a wide diversity of
were also observed.
uncultured groups of Epsilonproteobacteria (Polz & Cava-
naugh, 1995; Cary et al., 1997; Corre et al., 2001; Longnecker
Sample collection
& Reysenbachach, 2001; Huber et al., 2003; Lopez-Garcia
et al., 2003; Alain et al., 2004). Although there is generally no An in situ collector (Nercessian et al., 2003), designed to
evidence available that they are also numerically abundant concentrate the microorganisms discharged by hydrother-
in situ, it is now recognized that the Epsilonproteobacteria are mal emissions, was deployed on the PP12 chimney (Fig. 1).
the predominant bacteria in the global deep-sea hydrother- The in situ collector was brought to the deployment site into
mal systems (Polz & Cavanaugh, 1995; Cary et al., 1997; an insulated container and settled down by the arm of the
Corre et al., 2001; Longnecker & Reysenbachach, 2001; ROV. Just before deployment of the in situ collector, the
Huber et al., 2003; Lopez-Garcia et al., 2003; Alain et al., chimney’s surface was scraped by the arm of the ROV during
2004). Genes for key enzymes of the reductive tricarboxylic the sampling of Alvinella pompejana specimens. The me-
acid (rTCA) cycle, e.g. aclB – the b subunit of the ATP citrate chanical removing of the overlying sulphide structure re-
lyase, were detected in cultured Epsilonproteobacteria and sulted in an increase of the vent emission. The collector was
recovered in various hydrothermal vent habitats (Campbell settled at the exact location where alvinellids were taken, a
et al., 2003; Campbell & Cary, 2004; Hügler et al., 2005; few centimeters above the vent emission (Fig. 1). Immedi-
Takai et al., 2005). These reports suggested that autotrophic ately after deployment and prior to removal, discrete
CO2 fixation via the rTCA cycle operate in diverse Epsilon- temperature measurements were achieved at the bottom
proteobacteria and might sustain the predominant primary and at the top of the collector using the thermoprobe
production in situ. (Micrel, Hennebont, France) held by the teleoperated arm
In this study we investigated the bacterial community from of the ROV. Video imagery of the in situ collector was
a white filamentous mat formed within a few days on a acquired during successive dives. The collector was surveyed
syntactic foam float associated with an in situ collector during the following Victor dives. At the fourth day of
deployed at the 131N hydrothermal site (EPR). The goal in deployment, a thick and dense white biofilm was observed
this study was to determine the microbial compositions of the on the syntactic foam float attached to the collector (Fig. 1).
mat that was morphologically comparable to that observed After 5 days of exposure, the in situ collector was
and described by Taylor et al. (1999). On the basis of transferred into enclosed containers to minimize contam-
molecular phylogenetic surveys based on 16S rRNA and aclB ination from surrounding seawater during transportation to
genes and quantitative fluorescence in situ hybridization surface. Once onboard the ship, the microbial mat covering
(FISH), we demonstrate the actual in situ dominance of yet the marker was aseptically collected by scraping and im-
uncultured Epsilonproteobacteria including the prevalence of mediately subsampled. Material for scanning electron mi-
Arcobacter relatives in the hydrothermal sulphur mat. croscopy (SEM) was fixed with 2.5% glutaraldehyde in
c
2006 Federation of European Microbiological Societies FEMS Microbiol Ecol xx (2006) 1–15
Published by Blackwell Publishing Ltd. All rights reserved
120
Etude 1
30 g L 1 sea salts (Sigma) and stored at 4 1C. Aliquot for was determined by comparing sample diffraction patterns to
molecular and X-ray diffraction (XRD) analyses was stored mineral standards provided by the JCPDS files.
in ethanol at 20 1C. For FISH experiments, biomass was
fixed for 3 h at 4 1C with 4% paraformaldehyde in 3 Nucleic acid isolation and purification
phosphate-buffered saline (PBS) (Sambrook et al.,
The sample was centrifuged at 4000 g for 10 min. The pellet
1989).The fixation buffer was then replaced by a mixture of
was suspended in 150 mL of homogenization buffer [50 mM
equal volumes of 3 PBS and 100% ethanol and the fixed
Tris (pH 8), 25% sucrose]. Cells were lysed at room tempera-
sample was stored at 20 1C until further use.
ture with 1 mg mL 1 lysozyme for 10 min, followed by 10 min
of incubation after addition of 1% SDS. Then, proteinase K
Scanning electron microscopy coupled to
(1 mg mL 1) were added to the lysis suspensions and the
energy-dispersive X-ray spectroscopy
tubes were incubated at 50 1C for 60 min. Nucleic acid
Macroscopic mat filaments were deposited on a 10-mm- extraction was performed with prewarmed (55 1C) phenol–
pore-size membrane filter (Millipore) and fixed overnight at chloroform–isoamyl alcohol mixture as previously described
5 1C in 2.5% formaldehyde. After salt was eliminated, the (Teske et al., 2002). Nucleic acids were precipitated with NaCl
preparation was dehydrated in increasing ethanol concen- 5 M (0.1 vol) and 100% ethanol (2 vol). After overnight
trations (50%, 70%, 90% and 100%). Samples were then incubation at 20 1C, the precipitated DNA was centrifuged
critical point dried and gold coated. Observation was carried (10 000 g for 30 min) and washed with 75% ethanol. Nucleic
out with a Philips (XL 30-LaB6) scanning electron micro- acids was dried and suspended in 50 mL of sterile water.
scope operated at 25 kV.
The elemental composition of the sample was analyzed by PCR amplifications and cloning
energy-dispersive X-ray spectroscopy (EDS) coupled to the
Small-subunit rRNA genes were amplified by PCR using uni-
scanning electron microscope.
versal primer 1492R (5 0 -CGGTTACCTTGTTACGACTT-3 0 ),
Bacteria-specific primer 8F (5 0 -AGAGTTTGATYMTGGCT
X-ray diffraction
CAG-3 0 ), and Archaea-specific primer 4F (5 0 -TCCGGTTGA
XRD analysis was accomplished with a Brucker D-500 goni- TCCTGCCRG-3 0 ). The final 25 mL PCR mixture consisted
ometer coupled with the automated DACO-MP system for in 1 buffer (Promega), 1.5 mM MgCl2, 0.25 mM of each
data acquisition. Mineral phases were identified on the dNTP, 0.2 mM of each primer, 1 U of Taq DNA Polymerase
diffraction spectra using the EVA program. Powder XRD scans (Promega) and 2 mL of DNA. Contaminants in PCR reaction
were performed on dried crushed samples under the following mixtures were avoided as previously described (Goldenber-
conditions: Cu Ka radiation, 25 mA, 35 kV, and 5 s per step ger & Altwegg, 1995). PCR cycles were performed on a
with a step size of 0.021(2y). The scan range for all samples Perkin Elmer 9700 thermal cycler. After a denaturation step
was 5–701. Background and Kalph2 lines were removed from at 95 1C for 5 min, the following conditions were repeated
the diagrams. The mineralogical composition of the sample for 30 cycles: denaturation at 95 1C for 1 min, annealing at
121
Etude 1
4 H. Moussard et al.
53 1C for 1 min, and chain extension at 72 1C for 2 min. A Phylogenetic trees were constructed using the PHYLO-
final extension step of 8 min at 72 1C was performed. Under WIN program (Galtier et al., 1996). Distance trees were
these conditions, no PCR products were visible on 0.8% (w/ constructed using the neighbor-joining algorithms (Saitou
v) agarose gels stained with ethidium bromide. To obtain & Nei, 1987) with the Kimura two-parameters correction
visible PCR products, primary amplifications using primer (Kimura, 1980) for nucleotides and PAM correction for
pairs 8F-1492R and 4F-1492R were stopped at 15 cycles. proteins. Maximum-likelihood analyses on protein se-
Aliquots (1 mL) of the primary amplifications were then quences were performed using the PHYML program (Ki-
used as templates for secondary amplifications. Nested mura, 1980). The robustness of inferred topologies was
PCRs were performed using forward primers 50F (5 0 -AA evaluated using a bootstrap analysis (Felsentein, 1985). The
CACATGCAAGTCGAACG-3 0 ) and 63F (5 0 -CAGGCCTAAC sequences obtained in this study have been deposited in the
ACATGCAAGTC-3 0 ) specific for Bacteria and 341F (5 0 -CCT GenBank/EMBL/DDBJ database with the following acces-
AYGGGGYGCASCAGGCG-3 0 ) specific for Archaea with sion numbers: DQ071274–DQ071290 (16S rRNA gene) and
universal reverse primer 1407R (5 0 -GACGGGCGGTGWGT AM181241–AM181291 (aclB).
RCAA-3 0 ). The PCR mixtures and conditions were as
described before except that 30 cycles were applied.
16S rRNA oligonucleotide probe design and
PCR detection of the ATP citrate lyase beta subunit (aclB)
optimization
was based on previously designed primers (Campbell et al.,
2003). The cycling parameters for amplification of aclB The 16S rRNA oligonucleotide probe EPSI682 [S--Epsi-
genes were that described by Campbell & Cary (2004). 0682-a-A-19 according to (Alm et al., 1996)] specific to all
Negative controls were performed without DNA template Epsilonproteobacterial lineages identified in this study was
or PCR products. designed using the PROBE_DESIGN function of the ARB
PCR products were cloned using the TOPO XL PCR software package (http://www.arb-home.de). The probe
Cloning Kit (Invitrogen) into in Escherichia coli TOP 10 EPSI682 (5 0 -CGGATTTTACCCCTACACM-3 0 ) was checked
cells. Plasmids containing 16S rRNA genes were extracted for specificity using the PROBE_MATCH function in the
using the QIAprep Miniprep kit (Qiagen). RDP (http://rdp.c:e.msu.edu).
Dot-blot hybridization was performed to estimate the
specificity of the designed probe. The probe was labeled at its
Restriction fragment length polymorphism
5 0 end with T4 polynucleotide kinase (phosphatase-free;
analysis, clone sequencing and phylogenetic
Boehringer Mannheim Biochemicals, Meylan, France) and
analysis
[g-32P] ATP (Amersham, Les Ulis, France).
Screening of clones containing 16S rRNA gene sequences For determination of probe specificity, PCR-amplified
was performed by restriction fragment length polymorph- 16S rRNA gene fragments from Alvinella pompejana epi-
ism (RFLP) analysis. The PCR products of the clone inserts biont clone APG13B (Haddad et al., 1995), and environ-
amplified with primers M13F (5 0 -GTAAAACGACGGC mental clones VC1.2 (Corre et al., 2001) and VC2.2 (Corre,
CAG-3 0 ) and M13R (5 0 -CAGGAAACAGCTATGAC-3 0 ) were 2000) were used as targets. Total nucleic acids from Sulfur-
cut with the restriction endonuclease BstU1 (New England ospirillum barnesii (DSM 10660T), Wolinella succinogenes
Biolabs) according to manufacturer instructions. The DNA (DSM 1740T), Arcobacter nitrofragilis (DSM 7299T), Cam-
fragments were separated by electrophoresis on 2% agarose pylobacter coli (DSM 4689T), C. jejuni (DSM 4688T), Thio-
gels run in 1 Tris-acetate buffer (Sambrook et al., 1989). microspira denitrificans (DSM 1251T), Helicobacter pylori
One to three clones per RFLP pattern were sequenced (ATCC 43579), Zobellia galactanivorans (DSM 12802T), E.
with a 4200 IR2 Licor DNA sequencer, using the Thermo coli (DSM 3950) and Bacillus sp. strain SG9 (Marteinsson
Sequenase Primer Cycle sequencing kit (Amersham Phar- et al., 1996) were also used.
macia Biotech) and the infrared-labeled primers M13F and The probe specificity was determined as previously de-
M13R (MWG, Germany). DNA sequences were submitted scribed (Harmsen et al., 1997b) with slight modifications.
to the CHECK_CHIMERA program of the Ribosomal Denatured PCR-amplified 16S rRNA gene fragments and
Database Project (RDP) (http://rdp.cme.msu.edu/html/). total nucleic acids from cultured strains were applied on
Sequences were subjected to BLAST searches within the nylon membrane (Hybond-N1, Amersham Biosciences,
GenBank database (http://www.ncbi.nlm.nih.gov/) to deter- Orsay, France) using a dot-blot unit (SRC 96D, MinifoldI,
mine 16S rRNA gene sequence similarities to cultured and Schleicher and Schuell, Dassel, Germany). The dissociation
not yet cultured organisms. Sequence alignments were temperature (Td) was determined for the[g-32P]ATP-labeled
performed using the CLUSTALW program (Thompson et al., probe and hybridization was carried out as described by
1994) and refined manually using the SEAVIEW program (Franks et al., 1998). In addition to the newly designed
(Galtier et al., 1996). probe, the 16S rRNA-targeting oligonucleotide probe
c
2006 Federation of European Microbiological Societies FEMS Microbiol Ecol xx (2006) 1–15
Published by Blackwell Publishing Ltd. All rights reserved
122
Etude 1
EUB338 (S-D-Bact-0338-a-A-18) specific for bacteria diffuse flow and seawater (Fig. 1a). The temperatures
(Amann et al., 1990) was used as control in the dot-blot recorded in the shimmering vent fluid near the collector
analysis. Hybridization responses of the radioactively la- ranged between 11 and 45 1C, in the range of, or exceeding,
beled probe were detected with a Posphor Imager (Molecu- temperatures recorded a few days earlier (Alain et al., 2004).
lar Dynamics, Sunnyvale) and printed with Adobe (Seattle, No temperature measurements were performed near the
USA) Photoshop 3.0. float, but given that the distance between the collector and
Campylobacter jejuni (DSM 4688T), Arcobacter skirrowii the float was about 15 cm, we can reasonably assume that
(DSM 7302T), Nautilia lithotrophica (DSM 13520T) and average temperatures at which the biofilm formed were
Desulfurobacterium thermolithotrophum (DSM 11699T) below 20 1C. Chemical analyses had also previously shown
were used for specificity studies in whole-cell hybridization that diffuse-flow fluids of this chimney contained high
experiments with the newly designed oligonucleotide probe sulphide levels and negligible amounts of iron (Alain et al.,
ARC94 which targets the genus Arcobacter (Snaidr et al., 2004). At the fourth day of deployment, a thick and dense
1997) and the bacterial probe EUB338. Fluorescein-, Cy-3- white biofilm visible on video imagery was observed on the
and rhodamine-labeled and unlabeled oligonucleotides were syntactic foam float attached to the collector and at the
synthesized and purified by Eurogentec (Seraing, Belgium). collector’s base (data not shown). The collector was recov-
Cells were fixed for 3 h in 4% paraformaldehyde in 1 PBS ered after 5 days of incubation (Fig. 1b). The in situ collector
(3 PBS for marine strains) at 4 1C, washed in 1 (or had been colonized by several specimens of juvenile and
3 ) PBS and stored at 20 1C in 50% (v/v) ethanol-1 adult Alvinella worms in their freshly secreted organic tubes.
PBS. FISH analysis was performed as previously described The white mat that remained on the marker was collected
(Harmsen et al., 1997b). The optimal formamide concentra- for further detailed analyses. SEM analysis revealed that
tion of probe EPSI682 was evaluated by varying the for- the mat consisted in a dense network of cells (mainly
mamide concentration from 0% to 60%. rods) embedded within a mucous matrix (Supplementary
Fig. 1a and b). Cells were interconnected by the matrix
Fluorescence in situ hybridization on the throughout the biofilm.
hydrothermal mat sample The elemental microanalysis of the mat was investigated
by EDS and XRD. The SEM-EDS analysis indicated that the
To quantify the amount of cells hybridizing with probes
network of microorganisms was coated with elemental
EPSI682, ARC94, EUB338 and ARCH945, 250 mL of mat
sulphur. XRD diagrams confirmed the dominance of ele-
sample fixed in 3 PBS containing 4% paraformaldehyde
mental sulphur (with 2y peaks at about 23.11, 25.91, 27.81,
were centrifuged 6 min at 3500 g. The pellet was resus-
28.71, 28.951 and 31.41) (data not shown). No traces of
pended in 50 mL of the hybridization buffer used above with
sulphide minerals, such as pyrite, were detected.
250 ng of each labeled probe used and incubated at 46 1C for
3 h. Cells were then washed for 30 min with 5 mL of
prewarmed (48 1C) wash-buffer before being filtered onto Molecular characterization of the mat-
0.2-mm-pore-size Nucleopore polycarbonate filters (Costar, associated microbial communities
Dutscher, France). The cells were viewed and counted with
The genetic diversity of the microbial assemblages associated
an Olympus BX60 epifluorescence microscope equipped
with the mat sample was analyzed by constructing 16S rRNA
with a U-MWIB (for fluorescein) and U-MWG (for rhoda-
gene. Regardless of the PCR conditions used, no archaeal
mine) filter cubes (Olympus). A minimum of 25 cells per
16S rRNA genes could be amplified from the DNA extrac-
field, 15 fields per filter and a minimum of three filters per
tions. 16S rRNA gene amplification products were obtained
probe tested were counted.
using two different bacterial primer pairs. A total of 78
clones containing full-length inserts (59 clones from the
Results library obtained using 50F-1407R and 19 clones from the
library generated with primers 63F-1407R) were categorized
Habitat characterization of the mat-forming
by RFLP. The clones were then grouped into distinct clusters
organisms
on the basis of their restriction pattern. Verification of the
In order to better understand microbial diversity, dynamics RFLP clone family groupings was obtained by comparing
and colonization processes at vents, an in situ collector was full 16S rRNA gene sequences of up to three representative
deployed on the chimney PP12 at the Genesis site of the clones from each family. Sequences that were Z97% similar
131N vent field (EPR). The deployment site was selected to each other were grouped as a sequence type (Table 1).
based on the maximum temperature observed in the venting None of the sequences were identified as chimeras from
fluid (o100 1C). The collector was placed a few centimeters RDP analysis. Homologous coverage values (Singleton et al.,
above the vent orifice within the zone of active mixing of 2001) of the libraries generated using primers 50F-1407R
123
Etude 1
6 H. Moussard et al.
Table 1. Phylogenetic affiliations of bacterial type sequences detected in the hydrothermal mat sample
Clone numbers in libraries
Sequence type Other representatives 50F-1407R 63F-1407R Closest cultivated strains (% identity)
L50-WB6 L50-WB9, L50-WB56, 48 15 Arcobacter strain KT0913 (AF235110) (92%)
L63-WB2, L63-WB6
L50-WB53 1 Arcobacter strain KT0913 (AF235110) (93%)
L50-WB13 L63WB19 1 1 Epsilonproteobacterial strain 49MY (AB091293) (96%)
L50-WB17 1 Epsilonproteobacterial strain 49MY (AB091293) (94%)
L50-WB20 L50-WB49 5 Epsilonproteobacterial strain 49MY (AB091293) (95%)
L50-WB2 1 Nitratifractor salsuginis (AB175500) (93%)
L63-WB1 L63-WB8, L63-WB16 3 Sulfurovum lithotrophicum (AB091292) (96%)
L50-WB11 L50-WB7 2 Sulfurimonas autotrophica (AB088431) (98%)
Sequence types were identified by RFLP analysis and phylogenetic analysis. All sequence types had generally different RFLP profiles. However, clones
L50-WB20 and L63-WB1 displayed the same RFLP profile and were categorized in distinct sequence types on the basis of the phylogenetic analysis.
Clones L50-WB6, L50-WB9 and L50-WB56 that had different RFLP types were categorized in one sequence type as their sequence similarity was
Z97%. For the same reason, L50-WB20 and L50-WB49 were assigned to a unique sequence type.
(C‘50F’ = 93.2%) and 63F-1407R (C‘60F’ = 94.7%) indicated capable of growth on sulphur, thiosulphate and sulphide
that a significant part of their 16S rRNA gene diversity was (Inagaki et al., 2003).
assessed. To get more insight into the ecophysiological character-
All clone sequence types were affiliated to the Epsilonpro- istics of microbial components of the mat sample commu-
teobacteria (Fig. 2; Table 1). A majority of the clones nity, the presence and the diversity of aclB genes were
(80%) had only 92% sequence identity with an unchar- evaluated. A total of 51 aclB clones were obtained and they
acterized Arcobacter strain isolated from marine surface showed high identity level between them (495% on protein
water (Eilers et al., 2000) and was more closely related level). All were affiliated to the Epsilonproteobacteria (Fig. 3)
(95% similarity) with an environmental clone sequence and clustered with sequences of Nautilia strain Am-H,
(AY225610) recovered from a Mid-Atlantic ridge hydrother- Lebetimonas acidophila, and environmental clones from
mal system (Lopez-Garcia et al., 2003). Five sequence types alvinellid tubes (Inagaki et al., 2003) regardless the recon-
clustered within the group F defined by Corre et al. (2001) struction methods used. Although Takai et al. (2005)
(Fig. 2). Three of them (L50-WB13, L50-WB17, and recognized that phylogenies for the 16S rRNA and aclB
L50-WB20) had clones obtained from the hydrothermal genes are incongruent, no significant differences could be
environment as closest relatives (97–99% similarity) made between tree topologies when the 16S rRNA gene
(Lopez-Garcia et al., 2002) (K.A. Kormas, M.K. Tivey, sequence dataset matched that of the available aclB se-
K. von Damm, and A. Teske, unpublished data). Their quences (cultured Epsilonproteobacteria) (Nye et al., 2006).
closest cultivated relative was a yet uncharacterized meso- This suggests that the aclB sequences retrieved from the mat
philic microaerophile (strain 49MY) isolated from a yellow sample were not that of the Arcobacter-like populations.
mat sample from the Okinawa Trough (Takai et al., 2003).
The closest relatives of the two other clone sequences from
Design and specificity of probe EPSI682
group F (L-50WB2 and L63-WB1) were an environmental
clone sequence obtained from tubes of A. pompejana (M.A. The designed probe EPSI682 (5 0 -CGGATTTTACCCCTA-
Cambon-Bonavita, V. Riou, K. Alain, V. Cueff, F. Lesongeur, CACM-3 0 ) matched perfectly all the sequences identified in
G. Barbier, and J. Querellou, unpublished data) and Sulfur- the study (Fig. 2). The specificity of the probe encompassed
ovum lithotrophicum, respectively. The latter organism, the 16S rRNA gene sequences of environmental clones and
recently isolated from a deep-sea hydrothermal sediment cultured strains of families Campylobacteraceae, Helicobac-
core, is a mesophilic chemolithoautotroph capable of teraceae and ‘Hydrogenimonaceae’. The probe EPSI682 also
sulphur and thiosulphate oxidation and nitrate reduction matched all the sequences affiliated to the group F defined
(Inagaki et al., 2004). by Corre et al. (2001), except that of the epibionts of
The remaining sequence type (L50-WB11) clustered into hydrothermal invertebrates (one M : A mismatch at position
the family Helicobacteraceae (Corre et al., 2001) and had 682; E. coli numbering). Members of the new family
Sulfurimonas autotrophica as closest relative (98% similar- Nautiliaceae (Miroshnichenko et al., 2004) and of group G
ity); this strain was recently isolated from hydrothermal vent defined by Takai et al. (2003) contained a T : G mismatch at
sediment and is a microaerophilic chemolithoautotroph position 693.
c
2006 Federation of European Microbiological Societies FEMS Microbiol Ecol xx (2006) 1–15
Published by Blackwell Publishing Ltd. All rights reserved
124
Etude 1
Epsilonproteobacteria
66 Thiomicrospira denitrificans (L40808)
Sulfurimonas autotrophica (AB088431) Helicobacteraceae
100 41 clone L50-WB11 (DQ071281)
73 clone AT_cs10 (AY225615)
98 VC1.2 clone 26 (AF367490)
40 clone FT17B08 (AY251059)
Alvinella pompejana epibiont clone APG44b
(L35521)
Nitratifractor salsuginis (AB175500)
72 strain BHI60-53 (AJ431213)
89 54
Probe 97 clone L50-WB2 (DQ071280)
57 VC2.1BAC31 (AF068805)
EPSI682
VC2.2 clone 03 (AY766315)
92
100 VC2.2 clone 02 (AY766314)
Paralvinella palmiformis clone C/A18 (AJ441207)
strain 49MY (AB091293)
56 clone SF_C7-A1 (AY531561)
95
63 100 Riftia pachyptila clone R103-B19 (AF449233)
92 clone L50-WB20 (DQ071275) Group F
100 Riftia pachyptila clone R76-B67 (AF449249)
82
98 clone L50-WB13 (DQ071277)
94 Riftia pachyptila clone R103-B46 (AF449238)
clone L63-WB1 (DQ071278)
58 Riftia pachyptila clone R103-B23 (AF449235)
100
75 Sulfurovum lithotrophicum (AB091292)
clone SF_C4-C4 (AY327881)
clone CH1_23_BAC_16SrRNA_9N_EPR (A672506)
100
99 clone L50-WB17 (DQ071279)
48
Rimicaris exoculata ectosymbiont (U29081)
82 Alvinella pompejana epibiont clone APB13b (L35520)
0.1
Fig. 2. Phylogenetic position of the epsilonproteobacterial sequences retrieved from the hydrothermal mat sample (in bold). The tree topology was
obtained using the neighbour-joining method. Two ‘Gammaproteobacteria’, Escherichia coli and Riftia pachyptila endosymbiont, and Bacillus subtilis
were used as outgroup. The reference 16S rRNA gene sequences were obtained from GenBank; all environmental clone sequences presented in the tree
have been retrieved from hydrothermal vents. The numbers at the nodes represent the bootstrap values (Z50%) obtained with 500 resamplings. Scale
bar indicates the expected number of changes per sequence position. Environmental clone group F and group G are according to Corre et al. (2001) and
Takai et al. (2003), respectively. The light grey and dark grey boxes encompass sequences targeted by probes EPSI682 and ARC94, respectively.
125
Etude 1
8 H. Moussard et al.
Fig. 3. Phylogenetic position of translated alcB clone sequences retrieved from the hydrothermal mat sample (in bold). Other aclB sequences were
obtained from GenBank. The tree topology was obtained using the maximum likelihood method. The numbers at the nodes represent the bootstrap
values (Z50%) obtained respectively with 500 resamplings in neighbour-joining and 100 resampling in maximum likelihood method. Scale bar
indicates the expected number of changes per amino acid position.
The specificity of radioactively labeled probe EPSI682 was ARC94 (Snaidr et al., 1997). The probe ARC94 was also tested
also ensured by optimization of experimental hybridization as a majority of the phylotypes retrieved in both libraries
conditions. The Td value for probe EPSI682 experimentally clustered within the Arcobacter group. The new designed
measured at 46 1C was used as the posthybridization wash- probe showed the brightest fluorescence when hybridization
ing temperature to test its specificity by dot-blot hybridiza- buffers with 20% formamide were used. Only C. jejuni and A.
tion of nucleic acids from 27 target and nontarget species skirrowii cells, specifically as target strains, had positive
and environmental clones (Fig. 4). Confirming the in silico hybridization signals with probe EPSI682 (Fig. 5). The
analysis, probe EPSI682 gave positive signals for environ- simultaneous hybridization with probes EPSI682 and ARC94
mental clones and strains belonging to families Helicobacter- distinguished Arcobacter cells from that of C. jejuni (Fig. 5c).
aceae and Campylobacteraceae. As expected, no
hybridization signals were obtained for members of the
Quantification of cells in the mat sample
family ‘Nautiliaceae’ (Fig. 4c, blots A4 and B4) and non-
target strains (Fig. 4c, line 9). The probes EPSI682 and ARC94 were used simultaneously
The specificity of the fluorescently labeled probe EPSI682 with bacterial specific EUB338 or the archaeal specific probe
was tested by whole-cell hybridization of paraformaldehyde- ARCH915 to identify and to quantify the microorganisms in
fixed cells of reference strains. The formamide concentration the mat sample. No signals were obtained when paraformal-
was optimized using mixtures of target (Arcobacter skirrowii dehyde-fixed cells were hybridized with probe ARCH915.
and Campylobacter jejuni) and nontarget strains (Nautilia This result and the failure to amplify archaeal 16S rRNA
lithotrophica and Desulfurobacterium thermolithotrophum). genes from the mat DNA suggest strongly that Archaea were
The hybridizations were performed simultaneously with absent, or are present in amounts undetectable by the
either bacterial probe EUB338 or Arcobacter-specific probe currently applied methods.
c
2006 Federation of European Microbiological Societies FEMS Microbiol Ecol xx (2006) 1–15
Published by Blackwell Publishing Ltd. All rights reserved
126
Etude 1
A B C A B C
‘Hydrogenimonaceae’ 1 1
Helicobacteraceae 2 2
Campylo- 3
Nautiliaceae 3
bacteraceae
4 4
Group F
5 5
Campylobacteraceae strains 6 6
Helicobacteraceae strains 7 7
Fig. 4. Dot blot analysis of the probe specificities. Hybridization responses of radioactively labeled probes to nucleic acids from 27 target and nontarget
DNAs (left) of environmental clones (light grey background) and strains (dark grey background). The blots were hybridized with the following probes:
BACT338 (middle) and EPSI682 (right). The layout of nucleic acid samples on the blot is the following: 1A, VC1.2 clone 01; 1B, VC1.2 clone 10; 1C,
VC1.2 clone 42; 2A, VC1.2 clone 26; 2B, VC1.2 clone 32; 2C, VC1.2 clone D; 3A, VC1.2 clone 21; 3B, VC1.2 clone 57; 3C, VC1.2 clone 31; 4A, VC1.2
clone 69; 4B, VC2.2 clone 01; 4C, VC2.2 clone 02; 5A, VC2.2 clone 03; 5B, Alvinella epibiont APB13B; 5C, Campylobacter jejuni; 6A, Campylobacter
coli; 6B, Geospirillum barnesii; 6C, Arcobacter nitrofigilis; 7A, Thiomicrospira denitrificans; 7B, Wolinella succinogenes; 7C, Helicobacter pylori; 8A,
Escherichia coli; 8B, Zobellia galactanivorans; 8C, Bacillus sp. strain SG9).
FISH experiments (Fig. 6a and b) revealed that 95% of cally comparable to that observed at 91N and Guaymas
the bacterial cells reacted with probe EPSI682. Cells hybri- Basin hydrothermal sites (Taylor et al., 1999) formed in a
dizing with probe EPSI682 were morphologically diverse. few days during our colonization experiments. Our goal in
Simultaneous hybridization with probes EPSI682 and this study was to examine the chemical composition of this
ARC94 (Fig. 6c–e) showed that cells of the Arcobacter group material and the diversity of the microbial community
represented around 60% of the cells detected by probe involved in its formation. The microscopic and chemical
EPSI682. The cells that had positive hybridization signals analyses of the sample revealed that it consisted in a network
with both probes had the same morphologies. of microorganisms embedded in a mucous sulphur-rich
matrix. Given that hydrothermal chemical precipitates from
the 131N hydrothermal site do not generally contain such
Discussion amounts of elemental sulphur (Y. Fouquet, unpublished
One of the objectives of the oceanographic cruise PHARE results), we hypothesized that the sulphur formation had a
was to identify the microbial communities involved in the microbial origin.
first steps of colonization processes on virgin surfaces Our goal in this study was to determine the diversity of
exposed to the deep-sea hydrothermal vent fluids at the the microbial community involved in the mat formation.
131N (Le Bris et al., 2002). Visible structures, macroscopi- We applied the full-cycle rRNA approach, including the
127
Etude 1
10 H. Moussard et al.
Fig. 5. Whole cell hybridizations of different mixtures of fixed cells hybridized simultaneously with fluorescein-labeled (green fluorescence) and a
rhodamine- or Cy3-labeled probe (red fluorescence). Epifluorescence photomicrographs (double exposures) are shown at a magnification of 1140
(scale bar, 10 mm). Cells that hybridized with both types of probes appeared yellowish or orange on the double-exposed film. (a) Cells of Campylobacter
jejuni and Nautilia lithotrophica simultaneously hybridized with probes EPSI682 (green fluorescence) and EUB338 (red fluorescence). (b) Cells of
Arcobacter skirrowii and Desulfurobacterium thermolithotrophum simultaneously hybridized with probes EPSI682 (red fluorescence) and EUB338
(green fluorescence). (c) Cells of A. skirrowii and C. jejuni simultaneously hybridized with probes EPSI682 (green fluorescence) and ARC94 (red
fluorescence). (d) Cells of A. skirrowii and C. jejuni simultaneously hybridized with probe EUB338 (green fluorescence) and ARC94 (red fluorescence).
Fig. 6. Whole-cell hybridizations of cells from the mat collected on the 131N EPR with probes EPSI682 (green fluorescence) and EUB338 (red fluorescence)
(a–b), with probes EPSI682 (green fluorescence) and probe ARC94 (red fluorescence) (c) and with probes ARC94 (red fluorescence) and EUB338 (green
fluorescence) (d and e). Epifluorescence photomicrographs (double exposures) are shown at a magnification of 1,140 (scale bar, 10 mm).
c
2006 Federation of European Microbiological Societies FEMS Microbiol Ecol xx (2006) 1–15
Published by Blackwell Publishing Ltd. All rights reserved
128
Etude 1
construction of 16S rRNA gene libraries and FISH experi- of Epsilonproteobacteria isolated from hydrothermal vents
ments to identify the components of the mat community (Inagaki et al., 2003; Takai et al., 2003), it seems reasonable
and to assess quantitatively the dominant microbial popula- to suggest that the mat dominant organisms might also share
tions. The libraries were entirely composed of clones as- this metabolic capacity as ‘Candidatus Arcobacter sulfidicus’,
signed to the Epsilonproteobacteria. These results were in line which is the only described organism able to excrete sulphur
with many phylogenetic molecular surveys that showed filaments comparable to that of our mat, is a sulphide-
that Epsilonproteobacteria can represent 40–98% of the oxidizer (Wirsen et al., 2002).
clone libraries from hydrothermal environments sampled Given that autotrophic CO2 fixation through the rTCA
throughout the world’s oceans (Haddad et al., 1995; Moyer cycle has been recently shown in Epsilonproteobacteria, the
et al., 1995; Polz & Cavanaugh, 1995; Cary et al., 1997; mat sample was analysed for the presence and diversity of
Reysenbach et al., 2000; Corre et al., 2001; Longnecker & the ATP citrate lyase gene. Although the recovered aclB
Reysenbachach, 2001; Alain et al., 2002, 2004; Lopez-Garcia environmental clones were also all affiliated to Epsilonpro-
et al., 2002, 2003; Teske et al., 2002; Takai et al., 2003; teobacteria, phylogenetic analyses showed that they did not
Goffredi et al., 2004). However, contrary to previous studies correspond to that of Arcobacter-like populations. It could
that showed that the Epsilonproteobacteria of groups F and B suggest that the main microbial components of the mat
(family ‘Hydrogenimonaceae’) were the most frequently sample may use a different carbon fixation pathway. This
retrieved phylotypes (Corre et al., 2001; Alain et al., 2002, hypothesis seems however unlikely as it has been demon-
2004; Lopez-Garcia et al., 2002, 2003; Takai et al., 2003; strated that the rTCA cycle operates in a significant number
Goffredi et al., 2004), the majority of our sequences grouped of representative strains from widespread phylogenetic sub-
into a phylotype related to the genus Arcobacter. This finding groups and physiological types of Epsilonproteobacteria
was somewhat unusual as no Arcobacter isolates have been (Campbell et al. 2003; Hügler et al., 2005; Takai et al.,
reported from deep-sea vents and Arcobacter-related phylo- 2005). Since the primers used in this study were designed
types account generally for a minor fraction of the sequences using a limited number of aclB sequences, it is also possible
obtained from this environment (Lopez-Garcia et al., 2002, that a range of aclB sequence types have escaped molecular
2003; Huber et al., 2003; Alain et al., 2004). detection. These hypotheses need to be evaluated in the
The genus Arcobacter is unique among the Epsilonproteo- future to clarify the main microbial pathways used in the
bacteria as it contains validly published species isolated from hydrothermal sulphur mat formations.
both animal and environmental sources, including marine The ecological dominance of the Epsilonproteobacteria in
habitats (McClung et al., 1983; Vandamme et al., 1992; the hydrothermal environment has been mostly hypothe-
Mansfield & Forsythe, 2000; Donachie et al., 2005; Houf sized on the basis of their distribution in 16S rRNA gene
et al., 2005). Furthermore, a number of potentially novel libraries. However, for a variety of reasons (copy number,
species have been described from environments such as oil bias during DNA extraction, PCR, cloning), the frequency of
fields, marine waters and sediments (Eilers et al., 2000; 16S rRNA gene clone appearance does not reflect the actual
Gevertz et al., 2000; Kaeberlein et al., 2002; Wirsen et al., microbial community structure (Farrelly et al., 1995; von
2002). Arcobacter species are generally known as common Wintzingerode et al., 1997). Several studies have reported
human and animal pathogens or free-living organisms that that biases in PCR amplification could just explain the
respond poorly in conventional biochemical and growth tests overwhelming abundance of Epsilonproteobacteria (Corre,
(On, 1996). Typical features of characterized species are 2000; Watanabe et al., 2002). Therefore, quantitative char-
optimal growth under microaerophilic conditions at room acterization was required to test if this dominance was also
temperature (Vandamme et al., 1991). Given that the 16S reflected in the makeup of the mat-associated populations in
rRNA gene sequence of the microorganisms dominant in the situ. Oligonucleotide probes specific to uncultured groups
mat libraries shared 92% similarity with that of validly of Epsilonproteobacteria have been designed over recent
published Arcobacter species, we can only speculate about years (Polz & Cavanaugh, 1995; Cary et al., 1997; Snaidr
their ecophysiology. However, because XRD analyses identi- et al., 1997; Longnecker & Reysenbachach, 2001; Engel et al.,
fied elemental sulphur as a main component of the mat, it is 2003). However, some 16S rRNA gene sequences identified
tempting to suggest that our dominant group might be in this study were not targeted by the existing probes,
sulphur-oxidizing bacteria. Consistent with this hypothesis, justifying the development of a probe with a wider coverage.
the ability to oxydize sulphur compounds and to use oxygen Although probe EPSI682 demonstrated the actual omnipre-
as electron acceptor is a common trait in various members of sence of Epsilonproteobacteria, it is likely that nontargeted
the Epsilonproteobacteria isolated from deep-sea hydrother- members of this lineage (Fig. 2) may also have contributed
mal vents (Inagaki et al., 2003, 2004; Takai et al., 2003, 2004; to the bacterial cells detected with the probe EUB338.
Nakagawa et al., 2005). Although direct oxidation of hydro- It is interesting to notice that striking differences exist
gen sulphide has been demonstrated for a restricted number between our results and that of Alain et al. (2004) although
129
Etude 1
12 H. Moussard et al.
both colonization experiments took place on the same on board. We thank the captain and crews of ‘L’Atalante’ and
diffuse vent for the same time period. The very thin the pilots and support crew of the ROV ‘Victor’. We are
microbial veils that grew on the colonization device de- grateful to Philippe Crassous (Ifremer, Brest) and Monique
ployed by Alain et al. (2004) were macroscopically different Briand for their valuable contribution in SEM experiments
from our thick sulphur mats. The absence of Archaea, or and figure drawings, respectively. We also thank the two
their very low representation, is one of the only common anonymous reviewers for their constructive criticisms of an
findings between both studies. This is probably due to the earlier draft of the manuscript. We thank Stéphanie Gouriou
fact that biofilms had formed in environmental conditions (Faculté de Médecine, Brest), Tristan Barbeyron (Station
(low temperatures, presence of oxygen) that are not compa- Biologique, Roscoff), Cathy Ragimbeau (CNEVA, Ploufra-
tible with the lifestyle of most known archaea (Alain et al., gan), Jan Kuever (Max Plank Institute, Bremen), Barbara
2004). Although Epsilonproteobacteria also prevailed in the Campbell (University of Delaware, USA) for having pro-
clone libraries derived from the veils, the dominant phylo- vided us in cells or DNA of reference strains. HM was
types belonged to group F and no Arcobacter-related supported by a grant from the Ministère de la Recherche.
sequences were retrieved. Several indications suggest that
the two biofilm communities had settled under distinct
environmental parameters (such as temperature, oxygen
and sulphide concentrations). Just before the deployment References
of our collector, the mechanical removing of the overlying Alain K, Olagnon M, Desbruyères D, Pagé A, Barbier G, Juniper
sulphide structure resulted in an increase of the vent SK, Quérellou J & Cambon-Bonavita MA (2002) Phylogenetic
emission (Fig. 1). This explains why the fluid temperatures characterization of the bacterial assemblage associated with
measured with the ROV thermocouple and probably the mucous secretions of the hydrothermal vent polychaete
sulphide concentrations to which our collector was exposed Paralvinella palmiformis. FEMS Microbiol Ecol 42: 463–476.
were generally higher than that recorded earlier (14–860 mM) Alain K, Zbinden M, Le Bris N, Lesongeur F, Querellou J, Gaill F
(Alain et al., 2004). Consistent with this hypothesis, filamen- & Cambon-Bonavita MA (2004) Early steps in microbial
tous sulphur formation by ‘Candidatus Arcobacter sulfidicus’ colonization processes at deep-sea hydrothermal vents.
required high sulphide concentrations (4400 mM) and its Environ Microbiol 6: 227–241.
sulphide optimum was higher (1.5 mM) than those reported Alm EW, Oerther DB, Larsen N, Stahl DA & Raskin L (1996) The
for other sulphur-oxidizers (Wirsen et al., 2002). The capacity oligonucleotide probe database. Appl Environ Microbiol 62:
to grow optimally and selectively at high sulphide concentra- 3557–3559.
tions may also explain how these bacteria can locally out- Amann RI, Binder BJ, Olson RJ, Chisholm SW, Devereux R &
compete other sulphur-oxidizers as we observed in our sample. Stahl DA (1990) Combination of 16S rRNA-targeted
This report further expands the known diversity of the oligonucleotide probes with flow cytometry for analyzing
Epsilonproteobacteria from the initial reports of the prevalence mixed microbial populations. Appl Environ Microbiol 56:
of this group at deep-sea vents. Given that the ecological 1919–1925.
dominance of these microorganisms had been hypothesized Campbell BJ, Stein JL & Cary SC (2003) Evidence of chemolitho-
autotrophy in the bacterial community associated with
on the only basis of their distribution in 16S rRNA gene
Alvinella pompejana, a hydrothermal vent polychaete. Appl
libraries, we provide here a first demonstration of the
Environ Microbiol 69: 5070–5078.
numerical abundance of these microorganisms in situ. We
Campbell BJ & Cary SC (2004) Abundance of reverse
showed that bacteria taxonomically different from ‘Candida-
tricarboxylic acid cycle genes in free-living microorganisms at
tus Arcobacter sulfidicus’ are probably involved in filamen-
deep-sea hydrothermal vents. Appl Environ Microbiol 70:
tous sulphur formation. This process can be ecologically
6282–6289.
significant in environments where opposing oxygen-sulphide Cary SC, Cottrell MT, Stein JL, Camacho F & Desbruyeres D
gradients are available at the necessary concentrations and (1997) Molecular identification and localization of
can contribute significantly to the overall organic matter filamentous symbiotic bacteria associated with the
production at hydrothermal vents. It would therefore be hydrothermal vent annelid Alvinella pompejana. Appl Environ
significant now to delineate the environmental parameters Microbiol 63: 1124–1130.
that govern this efficient sulphide oxidation and the extent of Corre E (2000) Approches moléculaires de la diversité
the diversity and distribution of the responsible organisms. microbienne de deux environnements extrêmes: les sources
hydrothermales profondes et les réservoirs pétroliers. PhD
Thesis, Université de Bretagne Occidentale.
Acknowledgements
Corre E, Reysenbach AL & Prieur D (2001) e-Proteobacterial
We thank Nadine Le Bris and Françoise Gaill, chief scientist diversity from a deep-sea hydrothermal vent on the mid-
and project leader of the Phare cruise for having inviting us Atlantic ridge. FEMS Microbiol Lett 205: 329–335.
c
2006 Federation of European Microbiological Societies FEMS Microbiol Ecol xx (2006) 1–15
Published by Blackwell Publishing Ltd. All rights reserved
130
Etude 1
Donachie SP, Bowman JP, On SL & Alam M (2005) Arcobacter thermophilic bacteria in marine hydrothermal vents. Appl
halophilus sp. nov., the first obligate halophile in the genus Environ Microbiol 63: 4061–4068.
Arcobacter. Int J Syst Evol Microbiol 55: 1271–1277. Haymon RM, Fornari DJ, Von Damm KL et al. (1993) Volcanic
Eilers H, Pernthaler J, Gloeckner FO & Amann R (2000) eruption of the mid-ocean ridge along the East Pacific Rise
Culturability and in situ abundance of pelagic bacteria from crest at 9 degree 45-52 0 N: direct submersible observations of
the North Sea. Appl Environ Microbiol 66: 3044–3051. seafloor phenomena associated with an eruption event in
Embley RW Jr, Chadwick WW, Jonasson IR, Butterfield DA & April, 1991. Earth Planet Sci Lett 119: 85–101.
Baker ET (1995) Initial results of the rapid response to the Hedrick DB, Pledger RD, White DC & Baross JA (1992) In situ
1993 CoAxial event: relationships between hydrothermal and microbial ecology of hydrothermal vent sediments. FEMS
volcanic processes. Geophys Res Lett 22: 143–146. Microbiol Lett 101: 1–10.
Embley RW, Chadwick WW Jr, Perfit MR, Smith MC & Hekinian R & Fouquet Y (1985) Volcanism and metallogenesis of
Delaney JR (2000) Recent eruptions on the CoAxial segment of axial and off-axial structures on the East Pacific Rise near
the Juan de Fuca ridge: implications for mid-ocean ridge 131N. Econ Geol 80: 221–249.
accretion processes. J Geophys Res 105: 16501–16526. Houf K, On SL, Coenye T, Mast J, Van Hoof J & Vandamme P
Engel AS, Lee N, Porter ML, Stern LA, Bennett PC & Wagner M (2005) Arcobacter cibarius sp. nov., isolated from broiler
(2003) Filamentous ‘Epsilonproteobacteria’ dominate carcasses. Int J Syst Evol Microbiol 55: 713–717.
microbial mats from sulfidic cave springs. Appl Environ Huber JA, Butterfield DA & Baross JA (2002) Temporal
Microbiol 69: 5503–5511. changes in archaeal diversity and chemistry in a Mid-Ocean
Farrelly V, Rainey FA & Stackebrandt E (1995) Effect of genome Ridge subseafloor habitat. Appl Environ Microbiol 68:
size and rrn gene copy number on PCR amplification of 16S 1585–1594.
Huber JA, Butterfield DA & Baross JA (2003) Bacterial diversity in
rRNA genes from a mixture of bacterial species. Appl Environ
a subseafloor habitat following a deep-sea volcanic eruption.
Microbiol 61: 2798–2801.
FEMS Microbiol Ecol 43: 393–409.
Felsentein J (1985) Confidence limits on phylogenies: an
Hugler M, Wirsen CO, Fuchs G, Taylor CD & Sievert SM (2005)
approach using the bootstrap. Evolution 30: 783–791.
Evidence for autotrophic CO2 fixation via the reductive
Franks AH, Harmsen HJM, Raangs GC, Jansen GJ, Schut F &
tricarboxylic acid cycle by members of the e subdivision of
Welling GW (1998) Variations of bacterial populations in
proteobacteria. J Bacteriol 187: 3020–3027.
uman feces measured by fluorescent in situ hybridization with
Inagaki F, Takai K, Kobayashi H, Nealson KH & Horikoshi K
group-specific 16S rRNA-targeted oligonucleotide probes.
(2003) Sulfurimonas autotrophica gen. nov., sp. nov., a novel
Appl Environ Microbiol 64: 3336–3345.
sulfur-oxidizing e-proteobacterium isolated from
Galtier N, Gouy M & Gautier C (1996) SEAVIEW and
hydrothermal sediments in the Mid-Okinawa trough. Int J Syst
PHYLO_WIN: two graphic tools for sequence alignment and
Evol Microbiol 53: 1801–1805.
molecular phylogeny. Comput Appl Biosci 12: 543–548.
Inagaki F, Takai K, Nealson KH & Horikoshi K (2004) Sulfurovum
Gevertz D, Telang AJ, Voordouw G & Jenneman GE (2000)
lithotrophicum gen. nov., sp. nov., a novel sulfur-oxidizing
Isolation and characterization of strains CVO and FWKO B,
chemolithoautotroph within the epsilon-Proteobacteria
two novel nitrate-reducing, sulfide-oxidizing bacteria isolated
isolated from Okinawa Trough hydrothermal sediments. Int J
from oil field brine. Appl Environ Microbiol 66: 2491–2501. Syst Evol Microbiol 54: 1477–1482.
Goffredi SK, Waren A, Orphan VJ, Van Dover CL & Vrijenhoek Jannasch HW & Wirsen CO (1981) Morphological survey of
RC (2004) Novel forms of structural integration between microbial mats near deep-sea thermal vents. Appl Environ
microbes and a hydrothermal vent gastropod from the Indian Microbiol 41: 528–538.
ocean. Appl Environ Microbiol 70: 3082–3090. Jannasch HW, Nelson KE & Wirsen CO (1989) Massive natural
Goldenberger D & Altwegg M (1995) Eubacterial PCR: occurence of unusually large bacteria (Beggiatoa sp.) at a
contaminating DNA in primer preparations and its hydrothermal deep-sea vent. Nature 342: 834–836.
elimination by UV light. J Microbiol Methods 21: 27–32. Jeanthon C (2000) Molecular ecology of hydrothermal vent
Haddad A, Camacho F, Durand P & Cary SC (1995) Phylogenetic microbial communities. Antonie Van Leeuwenhoek 77:
characterization of the epibiotic bacteria associated with the 117–133.
hydrothermal vent polychaete Alvinella pompejana. Appl Jones WJ, Leigh JA, Mayer F, Woese CR & Wolfe RS (1983)
Environ Microbiol 61: 1679–1687. Methanococcus jannaschii, sp. nov., an extremely thermophilic
Harmsen H, Prieur D & Jeanthon C (1997a) Distribution of methanogen from a submarine hydrothermal vent. Arch
microorganisms in deep-sea hydrothermal vent chimneys Microbiol 136: 254–261.
investigated by whole-cell hybridization and enrichment Kaeberlein T, Lewis K & Epstein SS (2002) Isolating ‘uncultivable’
culture of thermophilic subpopulations. Appl Environ microorganisms in pure culture in a simulated natural
Microbiol 63: 2876–2883. environment. Science 296: 1127–1129.
Harmsen HJM, Prieur D & Jeanthon C (1997b) Group-specific Karl DM (1995) Ecology of free-living, hydrothermal vent
16S rRNA-targeted oligonucleotide probes to identify microbial communities. The Microbiology of Deep-Sea
131
Etude 1
14 H. Moussard et al.
Hydrothermal Vents (Karl DM, ed), pp. 35–124. CRC Press Inc, during ADVENTURE dive program to the EPR crest at 9145 0 -
Boca Raton. 52 0 N. EOS Trans Am Geophys Union 72: 481.
Kimura M (1980) A simple model for estimating evolutionary Nercessian O, Reysenbach AL, Prieur D & Jeanthon C (2003)
rates of base substitutions through comparative studies of Archaeal diversity associated with in situ samplers deployed on
nucleotide sequences. J Mol Evol 16: 111–120. hydrothermal vents on the East Pacific Rise (13 degrees N).
Le Bris N, Gaill F, Alain K et al. (2002) Biogeochemical Environ Microbiol 5: 492–502.
interactions in extreme environmental conditions: an Nye TMW, Lio P & Gilks WR (2006) A novel algorithm and web-
integrated study (PHARE 2002/EPR 131N). InterRidge News based tool for comparing two alternative phylogenetic tress.
11: 20–23. Bioinformatics 22: 117–119.
Longnecker K & Reysenbachach AL (2001) Expansion of the On SLW (1996) Identification methods for campylobacters,
geographic distribution of a novel lineage of e-Proteobacteria helicobacters, and related organisms. Clin Microbiol Rev 9:
to a hydrothermal vent site on the Southern East Pacific Rise. 405–422.
FEMS Microbiol Ecol 35: 287–293. Polz MF & Cavanaugh CM (1995) Dominance of one bacterial
Lopez-Garcia P, Gaill F & Moreira D (2002) Wide bacterial phylotype at a Mid-Atlantic Ridge hydrothermal vent site. Proc
diversity associated with tubes of the vent worm Riftia Natl Acad Sci USA 92: 7232–7236.
pachyptila. Environ Microbiol 4: 204–215. Reysenbach AL, Longnecker K & Kirshtein J (2000) Novel
Lopez-Garcia P, Duperron S, Philippot P, Foriel J, Susini J & bacterial and archaeal lineages from an in situ growth chamber
Moreira D (2003) Bacterial diversity in hydrothermal deployed at a mid-Atlantic ridge hydrothermal vent. Appl
sediment and epsilonproteobacterial dominance in Environ Microbiol 66: 3798–3806.
experimental microcolonizers at the Mid-Atlantic Ridge. Saitou N & Nei M (1987) The neighbor-joining method: a new
method for reconstructing phylogenetic trees. Mol Biol Evol 4:
Environ Microbiol 5: 961–976.
Mansfield LP & Forsythe SJ (2000) Arcobacter butzleri, A. 406–425.
Sambrook J, Fritsch EF & Maniatis T (1989) Molecular Cloning: A
skirrowii and A. cryaerophilus -potential emerging human
Laboratory Manual. Cold Spring Harbor Laboratory Press,
pathogens. Rev Med Microbiol 11: 161–170.
New York.
Marteinsson VT, Birrien J-L, Jeanthon C & Prieur D (1996)
Shank TM, Fornari DJ, Von Damm KL, Lilley MD, Haymon RM
Numerical taxonomic study of thermophilic Bacillus isolated
& Lutz RA (1998) Temporal and spatial patterns of biological
from three geographically separated deep-sea hydrothermal.
community development at nascent deep-sea hydrothermal
FEMS Microbiol Ecol 21: 255–266.
vents (9150 0 N, East Pacific Rise). Deep-Sea Res II 45: 465–515.
McClung CR, Patriquin DG & Davis RE (1983) Campylobacter
Singleton DR, Furlong MA, Rathbun SL & Whitman WB (2001)
nitrofragilis sp. nov., a nitrogen-fixing bacterium associated
Quantitative comparisons of 16S rRNA gene sequence libraries
with roots of Spartina alterniflora. Int J Syst Microbiol 133:
from environmental samples. Appl Environ Microbiol 67:
605–612.
4374–4376.
Miroshnichenko ML, L’Haridon S, Schumann P, Spring S,
Snaidr J, Amann R, Huber I, Ludwig W & Schleifer KH (1997)
Bonch-Osmolovskaya EA, Jeanthon C & Stackebrandt E
Phylogenetic analysis and in situ identification of bacteria in
(2004) Caminibacter profundus sp. nov., a novel thermophile
activated sludge. Appl Environ Microbiol 63: 2884–2896.
of Nautiliales ord. nov. within the class ‘Epsilonproteobacteria’, Takai K & Horikoshi K (1999) Genetic diversity of archaea in
isolated from a deep-sea hydrothermal vent. Int J Syst Evol deep-sea hydrothermal vent environments. Genetics 152:
Microbiol 54: 41–45. 1285–1297.
Moyer CL, Dobbs FC & Karl DM (1995) Phylogenetic diversity of Takai K, Komatsu T, Inagaki F & Horikoshi K (2001) Distribution
the bacterial community from a microbial mat at an active, of Archaea in a black smoker chimney structure. Appl Environ
hydrothermal vent system, Loihi seamount, Hawaii. Appl Microbiol 67: 3618–3629.
Environ Microbiol 61: 1555–1562. Takai K, Inagaki F, Nakagawa S, Hirayama H, Nunoura T, Sako Y,
Nakagawa S, Takai K, Inagaki F, Horikoshi K & Sako Y (2005) Nealson KH & Horikoshi K (2003) Isolation and phylogenetic
Nitratiruptor tergarcus gen. nov., sp. nov. and Nitratifractor diversity of members of previously uncultivated e-
salsuginis gen. nov., sp. nov., nitrate-reducing Proteobacteria in deep-sea hydrothermal fields. FEMS
chemolithoautotrophs of the e-Proteobacteria isolated from a Microbiol Lett 218: 167–174.
deep-sea hydrothermal system in the Mid-Okinawa Trough. Takai K, Nealson KH & Horikoshi K (2004) Hydrogenimonas
Int J Syst Evol Microbiol 55: 925–933. thermophila gen. nov., sp. nov., a novel thermophilic,
Nelson DC, Wirsen CO & Jannasch HW (1989) Characterization hydrogen-oxidizing chemolithoautotroph within the e-
of large, autotrophic Beggiatoa spp. abundant at hydrothermal Proteobacteria, isolated from a black smoker in a Central
vents of the Guaymas basin. Appl Environ Microbiol 55: Indian Ridge hydrothermal field. Int J Syst Evol Microbiol 54:
2909–2917. 25–32.
Nelson D, Haymon RM, Lilley M & Lutz R (1991) Rapid growth Takai K, Campbell BJ, Cary SC et al. (2005) Enzymatic and
of unusual hydrothermal bacteria observed at new vents genetic characterization of carbon and energy metabolisms by
c
2006 Federation of European Microbiological Societies FEMS Microbiol Ecol xx (2006) 1–15
Published by Blackwell Publishing Ltd. All rights reserved
132
Etude 1
deep-sea hydrothermal chemolithoautotrophic isolates of samples: pitfalls of PCR-based rRNA analysis. FEMS Microbiol
e-proteobacteria. Appl Environ Microbiol 71: 7310–7320. Rev 21: 213–229.
Taylor CD & Wirsen CO (1997) Microbiology and ecology of Watanabe K, Kodama Y & Kaku N (2002) Diversity and
filamentous sulfur formation. Science 277: 1483–1485. abundance of bacteria in an underground oil-storage cavity.
Taylor CD, Wirsen CO & Gaill F (1999) Rapid microbial BMC Microbiol 2: 23.
production of filamentous sulfur mats at hydrothermal vents. Wirsen CO, Sievert SM, Cavanaugh CM, Molyneaux SJ, Ahmad A,
Appl Environ Microbiol 65: 2253–2255. Taylor LT, DeLong EF & Taylor CD (2002) Characterization of an
Teske A, Hinrichs KU, Edgcomb V, de Vera Gomez A, Kysela D, autotrophic sulfide-oxidizing marine Arcobacter sp. that produces
Sylva SP, Sogin ML & Jannasch HW (2002) Microbial diversity filamentous sulfur. Appl Environ Microbiol 68: 316–325.
of hydrothermal sediments in the Guaymas basin: evidence for
anaerobic methanotrophic communities. Appl Environ
Microbiol 68: 1994–2007. Supplementary material
Thompson JD, Higgins DG & Gibson TJ (1994) CLUSTAL W: The following supplementary material is available for this
improving the sensitivity of progressive multiple sequence article:
alignment through sequence weighting, position-specific gap Figure S1. Scanning electron microphotographs of the
penalties and weight matrix choice. Nucleic Acids Res 22: bacterial mat. (A) Micrograph showing the dense network of
4673–4680.
cells; bar: 5 mm; (B) Enlargement showing mostly rod cells
Vandamme P, Falsen E, Rossau R, Hoste B, Segers P, Tytgat R &
embedded in a polymeric matrix, bar: 2 mm.
De Ley J (1991) Revision of Campylobacter, Helicobacter, and
This material is available as part of the online article
Wolinella taxonomy: Emendation of generic descriptions and
proposal of Arcobacter gen. nov. Int J Syst Bacteriol 41: 88–103.
from: http://www.blackwell-synergy.com/doi/abs/10.1111/
Vandamme P, Vancanneyt M, Pot B et al. (1992) Polyphasic j.1574-6941.2006.00192.x (This link will take you to the
taxonomic study of the emended genus Arcobacter with article abstract).
Arcobacter butzleri comb. nov. and Arcobacter skirrowii sp. Please note: Blackwell Publishing are not responsible
nov., an aerotolerant bacterium isolated from veterinary for the content or functionality of any supplementary
specimens. Int J Syst Bacteriol 42: 344–356. materials supplied by the authors. Any queries (other than
von Wintzingerode F, Gobel UB & Stackebrandt E (1997) missing material) should be directed to the corresponding
Determination of microbial diversity in environmental author for the article.
133
Etude 1
134
Etude 1. Résultats complémentaires
Avant que de récentes études ne soient réalisées sur des ε-Proteobacteria chimiolithoautrophes,
tout portait à croire que dans l'écosystème hydrothermal marin profond, la principale voie de
xation du carbone était celle du cycle de Calvin. En eet, des souches hydrothermales sulfo-
oxydantes, autotrophes obligatoires ou facultatives, principalement aliées aux γ -Proteobacteria
avaient été isolées et caractérisées (Thiomicrospira spp., Beggiatoa spp., par ex.) ; et des γ -
Proteobacteria sulfo-oxydantes avaient été mises en évidence dans des invertébrés hydrother-
maux (Cavanaugh et al., 1981 ; Felbeck et al., 1981 ; Cavanaugh, 1983 ; Karl et al., 1988 ; Nelson
et al., 1989 ; Ruby et al., 1981). Dans tous les cas, l'utilisation du cycle de Calvin chez ces orga-
nismes, avait été expérimentalement validée ou bien supposée. Des mesures d'activité réalisées
sur l'enzyme clé de cette voie, la RubisCO, avaient permis de montrer l'utilisation de cette voie
chez quelques uns de ces isolats ainsi que sur des échantillons environnementaux hydrothermaux
(Wirsen et al., 1993).
Alors, que tout laissait présager que la chaîne trophique reposait sur le cycle de Calvin, dans
le milieu hydrothermal marin profond, il a été récemment montré que les ε-Proteobacteria chimio-
lithoautotrophes utilisaient la voie du cycle inverse de l'acide tricarboxylique (rTCA) pour xer
leur carbone (Campbell et al., 2003 ; Campbell & Cary, 2004 ; Hugler et al., 2005 ; Takai et al.,
2005a). Avant ces études, le cycle rTCA n'avait été démontré que chez quelques micro-organismes
appartenant à des espèces du genre Chlorobium, certains membres des δ -Proteobacteria (par ex.,
Desulfobacter hydrogenophilus ), des Aquicales et des archaea de la famille des Thermoprotea-
ceaea (Evans et al., 1966 ; Fuchs et al., 1980 ; Hugler et al., 2003). Des analyses d'expressions par
RT-PCR des gènes clés du cycle rTCA, ainsi que l'abondance et la diversité phylogénétique de
ces mêmes gènes ont permis de suggérer que les micro-organismes vivants sous forme libre utili-
saient préférentiellement cette voie pour xer le carbone dans le milieu hydrothermal, et que ces
organismes étaient des ε-Proteobacteria (Campbell & Cary, 2004 ; Campbell et al., 2006). Nous
avons donc utilisé des marqueurs fonctionnels du cycle rTCA, pour savoir si les ε-Proteobacteria
que nous avions détectées dans le biolm, utilisaient elles aussi la voie rTCA pour xer leur
carbone.
Deux marqueurs du cycle rTCA ont été utilisés pour ce travail de thèse : le gène aclB codant
pour l'ATP citrate lyase et le gène oorA codant pour la 2-oxoglutarate : ferredoxin oxidoreductase
(également connue sous le nom de alpha-ketoglutarate synthase). Les résultats liés à l'utilisation
du marqueur aclB ont été détaillés dans l'étude 1, ceux concernant le marqueur oorA sont dé-
taillés dans cette partie Résultats complémentaires.
135
Etude 1. Résultats complémentaires
Tableau 1 Récapitulatif des résultats obtenus après amplication par PCR des gènes codant pour la sous-
unité beta de l'ATP citrate lyase (gène aclB ), la sous-unité alpha de la 2-oxoglutarate ferrodoxine oxidoreductase
(gène oorA et le gène codant pour les ARNr 16S, à partir de l'ADN extrait de cinq souches d'ε-Proteobacteria
et de l'ADN extrait du biolm. Le signe + désigne qu'une bande spécique de la taille attendue a été obtenue.
Le signe - désigne qu'aucune bande spécique de la taille attendue n'a été obtenue.
L'ATP citrate lyase et la 2-oxoglutarate : ferredoxin oxidoreductase sont deux enzymes clés
du cycle rTCA. A l'aide d'amorces spéciques mises au point par Campbell et ses collaborateurs
(2003), nous avons tenté d'amplier les gènes de ces deux enzymes, à partir de l'ADN extrait du
biolm.
Des produits d'amplication ayant la taille attendue, ont été obtenus avec le couple d'amorces
spéciques du gène aclB (voir étude 1). L'analyse phylogénétique des séquences des gènes aclB
ampliés, a révélé qu'elles étaient aliées à des ε-Proteobacteria. Cependant, aucune de ces sé-
quences groupait avec celles des Arcobacer, groupe pourtant dominant dans le biolm si l'on
considère l'inventaire des séquences codant pour les ARNr 16S. Lorsque nous avons voulu am-
plier les gènes oorA à partir de l'ADN extrait du biolm, nous n'avons pas réussi à obtenir des
produits d'amplication.
Nous avons donc voulu vérier l'ecacité des amorces utilisées sur des ADN d'ε-Proteobacteria
phylogénétiquement diverses. Les souches suivantes ont été sélectionnées : Sulfurospirillum halo-
respirans, Arcobacter skirowii, Campylobacter jejuni, Nautilia lithotrophica et Sulfurimonas au-
totrophica. Parallèlement à cela, nous avons également tenté d'amplier les gènes codant pour
les ARNr 16S de ces mêmes souches à l'aide d'amorces spéciques des Bacteria (voir Tableau 1).
Comme attendu, les gènes codant pour ARNr 16S des diérentes ε-Proteobacteria que nous
avions sélectionnées, ont tous été ampliés. Des produits d'amplication des gènes aclB et oorA
ont été obtenus pour les souches N. lithotrophica, S. halorespirans et S. autotrophica. Cependant,
l'amplication des gènes aclB et/ou oorA a posé des problèmes pour les souches C. jejuni et A.
skirowii. En eet seul, seul le gène oorA a pu être amplié pour la souche C. jejuni. Nous n'avons
pas non plus réussi à amplier les gènes aclB et oorA à partir de l'ADN extrait d'A. skirowii.
136
Etude 1. Résultats complémentaires
Les gènes aclB et oorA ont pourtant été mis en évidence et ampliés chez la souche Candidatus
Arcobacter suldicus (Hugler et al., 2005).
Cette expérience a donc révélé que les amorces préalablement dessinées pour cibler les gènes
aclB et oorA ne couvraient pas l'ensemble des ε-Proteobacteria. L'absence de gènes aclB pouvant
être aliés à des Arcobacter dans l'ADN extrait du biolm ainsi que notre incapacité à amplier
des gènes oorA à partir de ce même ADN, n'indiquent donc pas forcément leur absence de
l'échantillon. On peut penser que cela est dû aux amorces utilisées qui n'ont pas une spécicité
susamment étendue pour couvrir l'ensemble des ε-Proteobacteria. Ces amorces ont d'ailleurs
été dessinées à partir du faible nombre de séquences disponibles à l'époque (celles provenant de
deux fragments génomiques aliés à des ε-Proteobacteria, ainsi que celles de Chlorobium limicola
et de quelques organismes eucaryotes). Il serait donc intéressant de refaire cette expérience en
redessinant des amorces spéciques des gènes aclB et oorA à l'aide des nouvelles séquences
environnementales qui ont été récemment inventoriées (Takai et al., 2005a).
137
Etude 1. Résultats complémentaires
Nous pourrions également essayer d'amplier le gène codant pour l'enzyme clé du cycle
de Calvin, c'est-à-dire la RubsiCO, à partir de l'ADN extrait du biolm. L'absence d'un pro-
duit d'amplication spécique de ce gène permettrait de soutenir l'hypothèse selon laquelle les
membres de la communauté microbienne du biolm ont bien xé leur carbone via le cycle rTCA
et non pas via le cycle de Calvin.
138
Étude 2
Characterization of a 40 kbp
uncultivated euryarchaeotal
fosmid from a microbial community
associated to the hydrothermal
vent polychaete annelid, Alvinella
pompejana
Étude 2
140
Etude 2. Introduction
Le développement des techniques moléculaires a permis de mettre en évidence une très grande di-
versité microbienne au sein des écosystèmes hydrothermaux marins profonds (Cary et al., 1997 ;
Harmsen et al., 1997 ; Takai & Horikoshi, 1999 ; Corre et al., 2001 ; Longnecker & Reysenba-
chach, 2001 ; Slobodkin et al., 2001 ; Takai et al., 2001a ; Nercessian et al., 2003 ; Schrenk et al.,
2003). Ces études basées sur l'amplication puis l'analyse phylogénétique de séquences d'ARNr
16S, ont également démontré l'existence, parfois prépondérante, de nouvelles lignées au sein des
Archaea (Takai & Horikoshi, 1999 ; Takai et al., 2001a ; Nercessian et al., 2003). Certaines de ces
lignées semblent être inféodées à l'écosystème hydrothermal profond et représentent des groupes
d'organismes incultivés jusqu'alors totalement inconnus. La métagénomique représente une nou-
velle approche prometteuse pour mieux caractériser ces micro-organismes incultivés.
Cette étude avait pour objet d'analyser la diversité spécique d'une communauté microbienne
associée à des tubes d'A. pompejana. Ces tubes ancrés aux parois de cheminées hydrothermales
actives sont exposés aux uides hydrothermaux. Ils forment un substrat idéal pour la colonisa-
tion de populations microbiennes thermophiles. La diversité de la communauté microbienne a
été analysée dans un premier temps par l'amplication et le séquençage des ADNr 16S. Cette
analyse a révélé que la population archéenne était dominée par des Euryarchaeota incultivées.
Dans un deuxième temps, nous avons choisi d'analyser cette communauté microbienne par une
approche métagénomique, dans l'espoir d'obtenir des fragments génomiques de ces Euryarchaeota
incultivées.
141
Etude 2
2 H. Moussard et al.
approaches have been extended to the characterization of Microscopic observations have shown that inner and
functional genes (Nercessian et al., 2005). outer surfaces of alvinellid tubes are densely covered with
Single gene phylogenetic surveys do not, however, pro- morphologically diverse microorganisms (Desbruyères
vide information about the functional role of the different et al., 1985), but their molecular identification has not been
microorganisms within the community and the genetic yet assessed. Because the tubes of A. pompejana are directly
information they contain. The use of small- and large-insert exposed to the hydrothermal fluid emissions, we hypothe-
genomic libraries has been recently initiated as a powerful sized that their surfaces might provide suitable micro-
approach for isolating and identifying genes from habitats for uncultured microorganisms adapted to high
uncultured microorganisms and complex microbial assem- temperatures. In the process of extending our studies of
blages (Stein et al., 1996; Beja et al., 2000a, b; Rondon et al., hydrothermal archaea, we evaluate here the archaeal diver-
2000; Venter et al., 2004). Such metagenomic libraries have sity associated with the alvinellid tubes through a phyloge-
been successfully applied to identify novel genes of uncul- netic analysis of a 16S rRNA gene library. A large-insert
tured archaea from soils and diverse marine habitats fosmid library constructed with the DNA of the same
(Stein et al., 1996; Schleper et al., 1997, 1998; Beja et al., microbial assemblage was screened for archaeal 16S rRNA
2000a, b; Quaiser et al., 2002; Hallam et al., 2003, 2004; genes to identify clones that can be used to explore the
Kruger et al., 2003; Lopez-Garcia et al., 2004; Moreira et al., genetic and metabolic potential of specific phylogenetic
2004; Treusch et al., 2004; Tyson et al., 2004; Venter et al., groups. We report the identification of six archaeal 16S
2004; Erkel et al., 2005). To date, two fosmid libraries rRNA gene-containing genomic fragments, five of them
obtained from hydrothermal samples have contributed to belonging to uncultured lineages. Finally, we also present
our current understanding of obligate associations between the first genomic sequence isolated from an uncultured
invertebrates and bacteria (Hughes et al., 1997; Campbell hydrothermal euryarchaeon.
et al., 2003).
In addition to their thermophilic microorganisms, the
surfaces of deep-sea hydrothermal chimneys are also colo-
nized by polychaete worms. One of these, Alvinella pompe-
Materials and methods
jana, inhabits organic tubes secreted along the walls of active
Sample collection and nucleic acid extraction
black smokers on the East Pacific Rise (Desbruyères et al.,
1998). The microenvironment of the worm colonies is Alvinella pompejana specimens in their associated tubes
characterized by spatial and temporal variability with were collected at the 131N hydrothermal vent field on the
extreme temperature gradients and high concentrations of East Pacific Rise during the oceanographic cruise Phare
sulphide and heavy metals. Although thermal conditions (Le Bris et al., 2002). The samples were collected by the
of the fluids inside the tubes are difficult to characterize manipulator arm of the remotely operated vehicle (ROV)
accurately (Di Meo-Savoie et al., 2004; Le Bris et al., Victor from the wall of an active sulfide chimney of the
2005), A. pompejana is considered to be one of the Elsa hydrothermal site (PP-Hot3 marker; 12148.180 0 N,
most thermotolerant metazoans known (Chevaldonné 103156.315 0 W; 2624 m depth). They were placed into
et al., 1992; Cary et al., 1998). One of the most spectacular enclosed containers to minimize contamination from
features of A. pompejana is the unique epibiotic community surrounding seawater during transportation to the surface.
associated with its dorsal integument. Although these Once aboard ship, the worms were removed from their
microbial assemblages are composed of morphologically tubes and discarded. The alvinellid tubes were rinsed with
and metabolically diverse microorganisms (Gaill et al., sterile seawater and vortexed vigorously to separate the
1987; Jeanthon & Prieur, 1990; Campbell & Cary, 2001; prokaryotic cells from their surfaces. The alvinellid tubes
Campbell et al., 2001), their predominant members are were discarded from the homogenate and the remaining
filamentous Epsilonproteobacteria that have eluded all at- content was centrifuged (12 000 g for 15 min). DNA
tempts at culturing (Haddad et al., 1995; Cary et al., 1997). was immediately extracted on board from this preparation
Isolation of Epsilonproteobacteria has, however, been re- using an UltraClean DNA kit (MoBio Laboratories,
ported from diverse hydrothermal samples, including from Carlsbad, CA), according to the manufacturer’s instructions.
A. pompejana tubes and epibitotic microbiota (Alain et al., This step was followed by two supplementary extractions
2002; Miroshnichenko et al., 2002; Takai et al., 2003). All with a phenol–chloroform–isoamyl alcohol and once with
these isolates are mesophilic to thermophilic chemolitho- chloroform–isoamyl alcohol. Nucleic acids were precipi-
trophs using hydrogen or sulfur compounds as electron tated at room temperature with 3 M acetate sodium (0.1
donor and oxygen, nitrate and/or elemental sulfur as vol) and 100% ethanol (2 vol). The precipitate was washed
electron acceptors. with cold ethanol (70%) and resuspended in milliQ water.
c
2006 Federation of European Microbiological Societies FEMS Microbiol Ecol xx (2006) 000–000
Published by Blackwell Publishing Ltd. All rights reserved
143
Etude 2
Construction of the archaeal 16S rRNA gene GELase (Epicentre). The DNA (250 ng) excised from the gel
libraries was cloned in 0.5 mg of the fosmid vector CopyControl
pCC1FOS (Epicentre). The ligated fosmid (2 mg) was pack-
Small-subunit RNA genes were amplified by PCR using the
aged in one tube of phage particles (MaxPlax Lambda
archaeal-specific forward primers 4F (5 0 -TCCGGTTGATCC
Packaging Extracts, Epicentre) and used to transfect Escher-
TGCCRG-3 0 ) and W36 (5 0 -TCCAGGCGCTACGGGG-3 0 )
ichia coli EPI300-T1 cells. Clones were arrayed in 96-well
with the prokaryotic reverse primer 1492R (5 0 -CGGTTA
plates containing 200 mL of chloramphenicol (12.5 mg mL 1)
CCTTGTTACGACTT-3 0 ). The final 25-mL PCR mixtures
– LB medium with 1 Hogness buffer (Werner et al., 1997).
consisted of 1 DNA polymerase buffer (Interchim,
The 96-well plates were kept frozen at 80 1C after re-
Wörgel, Austria), 1.5 mM MgCl2, 0.25 mM of each dNTP,
growth. A total of 5017 fosmid clones were obtained, which
0.2 mM of each primer, 1 U of Uptitherm DNA Polymerase
corresponds to 175–225 Mbp environmental DNA assuming
(Interchim) and 1 mL of DNA. PCR cycles were performed
an average insert size of 35–45 kb.
on a Perkin Elmer 9700 thermal cycler. After a denaturation
step at 95 1C for 5 min, the following conditions were
repeated for 40 cycles: denaturation at 95 1C for 30 s, Screening of the fosmid library and sequence of
annealing at 53 1C for 30 s and chain extension at 72 1C for fosmid clone Alv-FOS5
1.5 min. A final extension step of 8 min at 72 1C was The fosmid library was pooled into groups of 24 clones that
performed. Under these conditions, no PCR products were served for PCR screening. A pool consisted of 9 mL of each
visible on 0.8% (weight in volume) agarose gels stained with clone that was centrifuged at 8000 g for 5 min and resus-
ethidium bromide. pended in 215 mL of TE buffer (pH 8). A small volume (2.5
To obtain visible PCR products, primary amplifications mL) of each pool was lysed by heat (95 1C for 10 min) and
using primer pairs 4F-1492R and W36-1492R were stopped served as DNA template for the PCR. The fosmid library was
at 15 cycles. Aliquots (1 mL) of the primary amplifications screened by PCR (under the conditions described above
were then used as templates for secondary amplifications. except that the final volume was 12.5 mL and the number of
Nested PCRs were performed using forward primers W36 cycles was 40) using the 16S rRNA gene Archaea-specific
and 1407R (5 0 -GACGGGGGGTGWGTRCAA-3 0 ). The PCR forward primer 21F (5 0 -TTCCGGTTGATCCTGCCGGA-3 0 )
mixtures and the thermal cycles were the same as described and the prokaryotic reverse primer 1492R (5 0 -GGTTA
above, except that 25 cycles were applied. All amplifications CCTTGTTACGACTT-3 0 ). Eukarya-specific primers 42F
were performed in triplicate, and the resulting products (5 0 -CTCAARGAYTAAGCCATGCA-3 0 ) and 1498R (5 0 -CAC
were pooled. Negative controls were performed without CTACGGAAACCTTGTTA-3 0 ) were also used to screen the
DNA template or PCR products. The archaeal 16S rRNA fosmid library. Amplicons of the expected sizes were
gene libraries were constructed using the TOPO TA Cloning obtained for five pools using the archaeal primers and for
kit (Invitrogen) according to the manufacturer’s instruc- six pools using the eukaryal primers. Further PCR screening
tions. These libraries were designed as ‘4F’ (constructed of individual clones integrating these pools led to the
using the primer pair 4F-1492R in the primary PCR) and identification of the 11 clones containing either 16S or 18S
‘W36’ (using the primer pair W36-1492R in the primary rRNA genes. One of these clones, designed Alv-FOS5, was
PCR). Clones were arrayed in 96-well plates containing 175 entirely sequenced (Genome Express) as described pre-
mL of kanamycin (50 mg mL 1) – Luria-Bertani (LB) med- viously (Lopez-Garcia et al., 2004). The average coverage of
ium. Cultures were kept frozen in 12% glycerol at 80 1C. the sequence was 10.7.
144
Etude 2
4 H. Moussard et al.
(NC_002578) for the codon usage matrix. Predicted pro- beck & Ronquist, 2001), under a general time reversible
teins were classified according to the clusters of orthologous (GTR) model assuming a gamma distribution with six rate
groups of proteins (COGs) database (Tatusov et al., 2001). categories and a proportion of invariable sites. Bayesian
The programs TBLASTN and BLASTP were used to look for posterior probabilities were computed by running four
sequence similarity with published protein sequences chains for 1 000 000 generations. Trees were sampled every
(Altschul et al., 1997). If putative ORFs were detected in 100 generations and 2000 trees were discarded as ‘burn-in’.
different reading frames, only those that had homologues in The maximum-likelihood (ML) analysis was carried out
databases (e value o e-05) were selected. In the case of using the program TREEFINDER (Jobb et al., 2004) using
several ORFs that showed no homologues, the longer was the same model described above. ML bootstrap proportions
conserved. Signal peptides were predicted using the SignalP were estimated based on 200 replicates.
program (http://www.cbs.dtu.dk/services/SignalP/) and tra- The 23S rRNA gene sequences of Alv-FOS5 and selected
nsmembrane segments were predicted using the TMHMM Archaea were also aligned using the program ED. Then, they
program (http://www.cbs.dtu.dk/services/TMHMM). Con- were manually concatenated to the aligned 16S rRNA gene
served domains of the predicted protein sequences were sequences. A total of 3502 positions were used for the
detected using the program InterProScan (http://www.ebi.a- phylogenetic 16S plus 23S rRNA gene analyses, after removal
c.uk/InterProScan). Comparative analyses of the predicted of gaps and unambiguously aligned positions. Phylogenetic
protein sequences were performed by RPS-BLAST, using the analyses of the concatenated sequences were performed
CDART tool (http://www.ncbi.nlm.nih.gov/Structure/lex- using Bayesian and ML methods as described above.
ington/lexington.cgi?cmd=rps). Comparative genome ana-
lyses were done with GENOMAPPER (http://www-archbac. Phylogenetic analyses of the Alv-FOS5 predicted
u-psud.fr/Genomap/GenomapBrowser.html). proteins
In the case of proteins, the sequences homologous to Alv-
Phylogenetic analysis of 16S and 23S rRNA gene FOS5 identified by BLAST were retrieved from GenBank and
sequences aligned using CLUSTAL W (Thompson et al., 1994). Amino
acid alignments were inspected manually using the ED
Archaeal clones were sequenced by cycle sequencing using program of the MUST package (Philippe, 1993). All am-
the DYEnamic ET terminator cycle sequencing kit (Amer- biguously aligned regions were excluded from phylogenetic
sham Biosciences) and M13F (5 0 -GTAAAACGACGGCC analysis. For all alignments, neighbour-joining phylogenetic
AG-3 0 ) and M13R (5 0 -CAGGAAACAGCTATGAC-3 0 ) pri- trees were constructed using MUST. In several cases, addi-
mers. The sequences were determined using an ABI Prisms tional Bayesian analyses were carried out with MrBayes v3.0,
3730xl DNA analyser (Applied Biosystems). using the JTT model with a gamma distribution and a
The closest relatives to the 16S rRNA gene sequences were proportion of invariant sites. The number of generations
identified in the GenBank database by BLASTN (http:// and trees sampled were the same as for the rRNA gene
www.ncbi.nih.gov/BLAST/). Sequences were aligned using phylogenetic Bayesian analysis. The numbers of amino acid
CLUSTALW (Thompson et al., 1994) and distance matrices positions considered in the Bayesian analyses corresponded
were constructed using DNADIST from the PHYLIP pack- to 259 (transcriptional factor B), 225 (Sua5-related protein)
age with the Jukes–Cantor correction for multiple substi- and 105 (predicted permease).
tutions (http://evolution.genetics.washington.edu/phylip.
html). Sequences diverging more than 3% in similarity were Nucleotide sequence accession numbers
defined as having unique phylotype. At least one sequence
The 16S rRNA gene sequences reported in this study are
per phylotype was chosen for complete clone sequencing.
deposited in the GenBank database under accession num-
The 16S rRNA gene sequences were submitted to the
bers DQ082929 to DQ082984. The complete sequence of the
program CHECK-CHIMERA of the Ribosomal Database
fosmid Alv-FOS5 is available at GenBank under accession
Project (RDP) (http://rdp8.cme.msu.edu/cgis/chimera.cgi?-
number DQ178753.
su=SSU). The relative richness of the two archaeal 16S rRNA
gene libraries was estimated by calculating their homolo-
gous coverage (C) (Singleton et al., 2001).
Results and discussion
To construct the phylogenetic trees, sequences were
Archaeal 16S rRNA gene diversity associated
aligned using the program ED of the MUST package
with A. pompejana tubes
(Philippe, 1993). After removal of gaps and unambiguously
aligned positions, a total of 795 positions were used for all To identify the archaeal communities associated with the
the phylogenetic analyses. Bayesian Markov Chain Monte tubes of alvinellid polychaetes, a cultivation-independent
Carlo analysis was carried out with MrBayes v3.0 (Huelsen- approach was used. Archaeal clone libraries 4F and W36
c
2006 Federation of European Microbiological Societies FEMS Microbiol Ecol xx (2006) 000–000
Published by Blackwell Publishing Ltd. All rights reserved
145
Etude 2
were constructed and a total of 115 clones were sequenced. Of the 24 euryarchaeal phylotypes (Table 1), four repre-
Two sequences were found to be chimeric and were omitted senting over 50% of the sequences retrieved from both
from subsequent analysis. The libraries were composed of 26 libraries were closely related to cultured species. These
phylotypes (e.g. sequences showing less than 97% similarity) phylotypes belonged to the orders Thermococcales, Metha-
(Table 1). Homologous coverage values (C‘W36’ = 0.83 and nococcales and Archaeoglobales (Fig. 1), members of which
C‘4F’ = 0.82) indicated that a significant part of the 16S rRNA are known as common inhabitants of deep-sea hydrother-
archaeal gene diversity of the libraries was detected in both mal vents (Huber et al., 2002a, b; Nercessian et al., 2003a, b,
libraries. Phylogenetic analysis of the 16S rRNA gene 2004). The 20 remaining euryarchaeal phylotypes were not
sequences showed that all phylotypes except two were related (o90%) to any known cultured organism. Phyloge-
affiliated to the Euryarchaeaota. netic analyses placed them among the uncultured Deep-sea
Table 1. Distribution of the representative archaeal 16S rRNA gene sequences identified from tubes of Alvinella pompejana collected at 131N on the
East Pacific Rise
Libraries
G1C Sequence
Sequence content Other Closest similarity 4F
Phylogenetic group type (mol%) representatives relatives (%) W36 (n = 55) (n = 58)
Crenarchaeota
Desulfurococcales metD6 66.67 – Staphylothermus 94 1.8 (1) –
marinus
Euryarchaeota
Thermococcales
Thermococcus met58 65.8 metF5, metA3, metA5, Thermococcus 98 36.4 (20) 24.1 (14)
met71, sulfurophilus
met26, met53, met19,
metD3
Archaeoglobales
Archaeoglobus met59 64.25 met18, met30 Clone pEPR796 99 3.6 (2) 1.7 (1)
Methanococcales
Methanocal- met22 64.09 metH4, metD1, metD11 Methanocaldococcus 99 5.5 (3) 1.7 (1)
dococcus vulcanius
Methanother- met25 59.65 met65, met81 Clone G26_C45 99 7.3 (4) 24.1 (14)
mococcus
DHVE group I
DHVE1 metC10 57.29 met9, met56 Clone WCHD3-02 88 9.1 (5) 8.6 (5)
DHVE2 met24 61.44 met43, met50, Clone VC2.1 Arc13 97 9.1 (5) 19 (11)
metF2, metF8
met21 61.44 Clone FT17A09 97 5.5 (3) –
DHVE group II
DHVE4 metB11 50.14 – Clone pISA35 97 1.8 (1) –
DHVE5 met62 51.11 met60 Clone ESYB24 85 – 3.4 (2)
met28 53.97 – Clone ESYB68 89 1.8 (1) –
metA11 51.50 metD4 Clone ESYB25 93 3.6 (2) –
met87 55.01 met13, metF11 Clone ESYB25 93 1.8 (1) 3.4 (2)
met64 53.57 – Clone KuA18 91 – 1.7 (1)
metE6 52.50 – Clone ESYB51 91 – 1.7 (1)
metD12 53.78 met35 Clone ESYB51 93 3.6 (2) –
met80 53.28 – Clone ESYB50 94 – 1.7 (1)
met66 52.03 – Clone ESYB51 96 – 1.7 (1)
met36 53.38 – Clone ESYB50 93 1.8 (1) –
met1 54.05 metG3 Clone ESYB50 93 1.8 (1) 1.7 (1)
DHVE6 met20 49.12 – Clone pISA3 90 1.8 (1) –
met23 48.97 – Clone pISA48 93 1.8 (1) –
metF7 48.87 – Clone pISA48 92 – 1.7 (1)
metH8 50.39 – Clone pISA13 94 – 1.7 (1)
Novel lineage met57 59.85 Clone CH-A3 88 – 1.7 (1)
Nanoarchaeota metC1 67.44 – Clone CU-1 87 1.8 (1) –
Numbers correspond to the percentages of clones that appeared in the library.
146
Etude 2
6 H. Moussard et al.
DHVE group I
0.98 1 met21 (DQ082953)
1 Alv-FOS3 (DQ082976)
0.91 VC2.1 Arc13 (AF068820)
pSSMCA108 (AB019740)
Thermoplasma acidophilum (M38637)
1 Ferroplasma acidiphilum (AJ224936)
1 Picrophilus oshimae (X84901)
1 VC2.1 Arc6 (AF068817)
ESYB28 (AB119584)
0.96 SRI-298 (AF255608)
0.96 pMC2A203 (AB019737)
0.95 1 pMC2A33 (AB019738) DHVE1
0.96 metC10 (DQ082935)
WCHD3-02 (AF050616)
0.93 vadinCA11 (U81778)
1
1 pa203 (AB062320)
pMC1A4 (AB019754)
0.90 Methanosarcina mazeiQAF028691
Methanococcus thermolithotrophicus (M59128)
met25 (DQ082952)
1
1 Methanothermococcus okinawensis (AB05772)
1 Methanocaldococcus jannaschii (L77117)
Methanocaldococcus vulcanius (AF051404)
1 met22 (DQ082951)
pMC2A384 (AB019734)
1 metB11 (DQ082934) DHVE4
1 pISA35 (AB019748)
1 AT4 32 (DQ114471)
0.97 0.99 CH-A3 (AY280439) Novel
Alv-FOS5
1 1
1 met57 (DQ082950)
lineage
pMC2A5 (AB019743)
1 pMC2A211 (AB019746) DHVE3
pISA18 (AB019749)
ESYB68 (AB119624)
met28 (DQ082947)
met62 (DQ082946)
1 1 met60 (DQ082945)
met80 (DQ082942)
1 0.98 ESYB50 (AB119606)
1 1 met66 (DQ082941)
DHVE group II
1 ESYB51 (AB119607)
met36 (DQ082940)
1 met1 (DQ082939)
1 DHVE5
1 1 metE6 (DQ082930)
0.88 0.97 metD12 (DQ082929)
metA11 (DQ082931)
1 met87 (DQ082943)
1 0.95 ESYB25 (AB119581)
1 met64 (DQ082944)
1 KuA18 (AB077228)
Nubeena78 (AY500128)
0.99 ESYB24 (AB119580)
pISA1 (AB019751)
1 pISA38 (AB019750)
ACE-6 (AF142788)
pMC2A35 (AB019753)
1 met20 (DQ082949)
1 1 pISA3 (AB019752)
metH8 (DQ082933) DHVE6
0.97 metF7 (DQ082932)
0.1 1 met23 (DQ082948)
pISA48 (AB019755)
0.82 pISA13 (AB019756)
c
2006 Federation of European Microbiological Societies FEMS Microbiol Ecol xx (2006) 000–000
Published by Blackwell Publishing Ltd. All rights reserved
147
Etude 2
Hydrothermal Vent Euryarchaeota (DHVE) groups I and II previously used for the construction of the 16S rRNA gene
(Takai & Horikoshi, 1999) (Table 1 and Fig. 1). Within libraries.
DHVE group I, most of our sequences were closely related
(97% similarity) to members of the DHVE2 lineage (14.5%
and 19% of libraries W36 and 4F, respectively). The dis- Identification of fosmid clones containing
tribution of this lineage is to date restricted to the deep-sea archaeal and eukaryotic small-subunit rRNA
hydrothermal vent environment and its members have been genes
detected only in the hottest parts of this ecosystem (Reysen- A total of 5017 fosmid clones were obtained. Assuming that
bach et al., 2000; Takai et al., 2001; Huber et al., 2002a,b; the size of the inserts ranged from 35 to 45 kb, an estimated
Hoek et al., 2003; Nercessian et al., 2003a, b, 2004). One total of 200 Mb of environmental DNA has been cloned in
phylotype (metC10) grouped within the DHVE1, the second our library. We screened the library by using a primer set
cluster of the DHVE group I (Table 1). This phylotype specific for 16S rRNA genes of Archaea. Five 16S rRNA gene-
shared distant relationship (88% similarity) with its closest containing euryarchaeal genome fragments (Alv-FOS0, 1, 2,
relative, a sequence (clone WCHD3-02) recovered from a 3 and 4) were recovered in the library. Sequences analyses of
contaminated aquifer (Dojka et al., 1998). Other DHVE1 the archaeal 16S rRNA genes showed that Alv-FOS0 be-
sequences available in databases have been retrieved from longed to the order Thermococcales (Fig. 1). The four other
diverse environments, including hydrothermal vent systems archaeal 16S rRNA genes were closely related (497%
(Takai & Horikoshi, 1999), coastal marine sediments (N. sequence similarity) and formed a cluster within the
Kaku & K. Watanabe, unpublished results) and terrestrial DHVE2 lineage. Interestingly, these 16S rRNA gene se-
hot springs (Skirnisdottir et al., 2000). quences were identical or almost identical (99–100% simi-
The sequence types that grouped within the DHVE group larity) to 16S rRNA gene sequences recovered in the PCR-
II were primarily related to the DHVE5. They consisted of 11 derived libraries.
phylotypes (Table 1) and most of them had environmental To look for the presence of microbial eukaryotes, the
clones retrieved from coastal marine sediments (N. Kaku & library was further screened by using 18S rRNA gene
K. Watanabe, unpublished results) as closest relatives. Five eukaryal-specific primers. Six clones exhibited PCR pro-
minor phylotypes found in either library 4F or library W36 ducts of the expected size. Four of them contained 18S rRNA
clustered within the DHVE4 and DHVE6 lineages and had gene sequences highly related to that of hydrothermal
sequences retrieved from hydrothermal sediments as closest annelids (97–99% similarity), and one had that of a Candida
relatives (Takai & Horikoshi, 1999). Lastly, a unique se- fermentati strain as closest relative (98% similarity) (Suh &
quence (phylotype met57) that could not be assigned a Blackwell, 2004). Surprisingly, the last clone recovered in the
previously described lineage formed a cluster with clone library by this screening contained an archaeal 16S rRNA
sequences recovered from deep-sea hydrothermal vents gene sequence. This clone, designated Alv-FOS5, had the
(Pagé et al., 2004; P. López-Garcı́a and D. Moreira, unpub- phylotype met57 obtained in this study as closest relative
lished results). (497% similarity). These clones formed an independent
The two remaining phylotypes that did not group within cluster distantly related (88–90%) to the phylotypes CH-A3
the Euryarchaeota were only present in the library W36. and AT4-32 (Fig. 1) recovered from deep-sea hydrothermal
The phylotype metD6 was related (94% similarity) to vents. Interestingly, clone AT4-32 had also been retrieved
the heterotrophic sulfur-reducing crenarchaeote Staphy- using 18S rRNA gene-specific primers during a molecular
lothermus marinus, a common inhabitant of deep-sea survey of eukaryotic diversity in hydrothermal sediment
hydrothermal vents (Huber & Stetter, 2001). Finally, the from the Mid-Atlantic ridge (Lopez-Garcia et al., 2003;
phylotype metC1 clustered with the archaeal symbiont P. López-Garcı́a and D. Moreira, unpublished results). The
Nanoarchaeum equitans (Huber et al., 2002a, 2002b) and failure to identify the clone Alv-FOS5 with the archaeal-
the uncultured nanoarchaeote OP-9 (Hohn et al., 2002) specific primers was probably due to the presence of five
(87% similarity). mismatches between primer 21F used in the library screen-
To gain insight into the genomic features of some of the ing and its targeted sequence in the Alv-FOS5 genomic
uncultured organisms associated with the A. pompejana fragment. The reasons why we identified the clone Alv-FOS5
tubes, a fosmid library was generated from the DNA with the eukaryal-specific primer pair are still unclear as
Fig. 1. Bayesian phylogenetic tree of archaeal 16S rRNA gene sequences retrieved from Alvinella pompejana tubes. The 16S rRNA gene sequences
derived from the PCR-based libraries W36 and 4F are shown in bold type and those identified in the fosmid library are in bold type and shaded in grey.
Accession numbers of sequences retrieved from GenBank are given in parentheses. In total, 795 unambiguously aligned positions were used in the
analysis. Posterior probabilities 4 0.8 are indicated at nodes; the scale bar represents the estimated number of nucleotide substitutions per site.
148
Etude 2
8 H. Moussard et al.
only 12 of the 20 bases of the 18S-42F primer perfectly operons) displayed a similar arrangement to that found in
matched with the Alv-FOS5 16S rRNA gene. Alv-FOS5. However, this feature had not been observed in
Given that only six archaeal 16S rRNA gene-containing genomic fragments from uncultured Euryarchaeota of group
genomic fragments have been identified, the comparison II, which have the 16S and 23S rRNA genes separated in the
between the composition of the metagenomic library and genome, nor their closest cultured relatives the Thermoplas-
PCR libraries is impossible. However, the fact that four of matales (Beja et al., 2000a,b; Moreira et al., 2004). The
the six clones from the metagenomic library belonged to the 16S–23S intergenic transcribed spacer (ITS) of Alv-FOS5
DHVE2 lineage (Alv-FOS1 to Alv-FOS4) was surprising as (228 bp in length) contained an Ala-tRNA (Table 2 and
DHVE2-related sequences were not dominant in our two Fig. 2). The occurrence of an Ala-tRNA in the 16S–23S ITS
PCR-derived libraries and in previous surveys (Takai & has been described for all complete euryarchaeal sequenced
Horikoshi, 1999; Reysenbach et al., 2000; Takai et al., 2001; genomes that displayed at least the 16S 1 23S rRNA gene
Nercessian et al., 2003a, b). This could suggest that these arrangement. The genome fragment contained two addi-
organisms may be more abundant in the hydrothermal vent tional tRNAs, a Thr- and a Leu-tRNA gene, the latter being
environment than previously thought. Their real signifi- located directly downstream of the 3 0 -end of the 23S rRNA
cance could be addressed via fluorescence in situ hybridiza- gene.
tion or DNA–DNA hybridization experiments (Nercessian The G1C content was quite homogeneous along the Alv-
et al., 2004). FOS5 sequence, except for the region that contained the 23S
Fosmids Alv-FOS1 and Alv-FOS4 were selected for full and the 16S rRNA genes and linked tRNA genes (Table 2).
sequencing of their inserts and the analysis of the sequences The low sequence similarity between the Alv-FOS5 16S
flanking their 16S rRNA gene sequences will be presented rRNA gene sequence and its closest cultured relatives makes
elsewhere. The fosmid Alv-FOS5 was also chosen for full any metabolic prediction unreasonable. By contrast, the
sequencing as representative of a novel lineage of the DHVE high G1C content of its 16S rRNA gene sequence
II group. (60.2 mol%) may be indicative of a thermophilic way of life
(Dalgaard & Garrett, 1993; Galtier et al., 1999). Interestingly,
the Alv-FOS5 16S rRNA gene sequence formed a cluster
Sequence analysis of the euryarchaeal fosmid with other sequences (clones met57 and CH-A3) that also
clone Alv-FOS5 have high G1C contents (459 mol% on the basis of 1000
The entire sequence of the genome insert of clone Alv-FOS5 bases).
was determined. The genome fragment had a size of A total of 32 ORFs longer than 50 amino acids were
39843 bp with an average G1C content of 43.95 mol%. This predicted in Alv-FOS5 (Table 2 and Fig. 2). ORFs were
value is in the range of the G1C content of Thermococcales densely packed (92% of the complete Alv-FOS5 was pre-
(40–51 mol%), some of whose members are the closest dicted to be coding sequences), as has been previously
cultured relatives to Alv-FOS5 based on 16S rRNA gene reported for archaeal genomes. Among the 32 predicted
sequence similarity (o90%). The rRNA operon of clone ORFs, 17 showed significant sequence similarity with pro-
Alv-FOS5 consisted only of 16S and 23S rRNA genes, ducts of genes of known functions, six were homologous to
without linked 5S rRNA genes (Fig. 2). This 16S 1 23S uncharacterized proteins, and nine were predicted proteins
rRNA gene arrangement is common in crenarchaeotal of unknown function without homologues in databases.
genomes and also exists in Euryarchaeota. Among the Among the proteins of unknown function, ORF27
completely euryarchaeal sequenced genomes, Archaeoglobus was found to have one transmembrane segment and to
fulgidus, Pyrococcus species, Thermococcus kodakarensis and harbour a signal peptide while ORF28 exhibited a weak
Methanocaldococcus jannaschii (for one of its two rRNA domain signature of the nucleotidyltransferase superfamily.
0 39843
23S rRNA 16S rRNA
1 2 3 4 5 6 7 8 9 101112 13 14 151617 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32
Fig. 2. Schematic representation of the euryarchaeal clone Alv-FOS5. ORFs categorized in proteins with assigned functions (COGs), conserved
hypothetical proteins, unknown proteins and rRNA genes are labelled as indicated in the inset. The tRNA genes are indicated by black bars. See Table 1
for ORF numbers of the respective fragments.
c
2006 Federation of European Microbiological Societies FEMS Microbiol Ecol xx (2006) 000–000
Published by Blackwell Publishing Ltd. All rights reserved
149
Table 2. Predicted RNA and protein coding genes in the euryarchaeotal fosmid Alv-FOS5. ORFs are numbered 1 to 32 following the sense 5 0 to 3 0 in Fig. 2
150
Protein
size Putative function Most similar
Etude 2
(COG0459)
5 8171–8722 183 Unknown No homologues 41.12
6 8746–9651 301 Sugar kinase of the Methanopyrus kandleri NP_614100 (9e-22) Poorly resolved phylogeny. Only present in Archaea 47.46
ribokinase family (most of the cases in two copies) and Bacteria
(COG0524)
7 9706–10734 342 Putative translation Pyrococcus horikoshii NP_142416 (e-103) Distributed in the three domains 47.42
factor, SUA5-related
protein (COG0009)
8 10829–11047 1 72 Unknown No homologues 41.55
9 11052–12476 1 474 Archaeal transcriptional Methanosarcina mazei NP_633796 (1e-92) Present only in Archaea and Eukarya. FOS5 protein 43.16
initiation factor TFB longer than other homologues (45 amino acids)
c
(COG1405)
10 12481–12786 101 Unknown No homologues 41.5
11 12832–13470 1 212 Thymidilate kinase Pyrococcus furiosus NP_579459 (1e-23) Widely distibuted in the three domains 41.94
(COG0125)
12 13458–13946 1 162 Conserved hypothetical Pyrococcus abyssi NP_127369 (4e-46) Only present in Archaea and few Bacteria. ORF 42.94
protein assigned as uncharacterized conserved protein
(COG1839)
13 13948–15672 574 Kef-type K1 transport Pseudomonas syringae AAO58938 (2e-32) 15 predicted transmembrane helices. Present 42.2
system (COG0475) in various Bacteria and Euryarchaeota. In
Crenarchaeota, only present in
Pyrobaculum aerophilum and in Sulfolobales
14 15714–16922 402 Kef-type K1 transport Lactobacillus 12 predicted transmembrane helices. Only present in 44.67
system, membrane acidophilus Bacteria and Archaea
component (COG0475) YP_194758 (1e-12)
9
151
Etude 2
Etude 2
64.94
41.33
58.41
60.23
36.11
41.61
Four predicted proteins were homologous to components
involved in the transcription and translation processes. They
included a transcription factor IIB (ORF9), a putative
translation factor Sua5 (ORF7) and two aminoacyl-tRNA
synthetases (ORF18 and 19). ORF18 and 19 showed a
tandem gene arrangement that suggests cotranscription.
This situation has not been detected so far in archaeal
genomes available to date.
The predicted proteins involved in cellular processes and
Truncated ORF. Only present in
Anticodon TGC
Alanine tRNA
Predicted HD
(COG1418)
heat shock
23S rRNA
16S rRNA
1 91
31
32
152
Etude 2
12 H. Moussard et al.
1
Methanosarcina acetivorans (Q8TT29)
Methanosarcina barkeri (ZP_00295754)
0.82
Methanosarcina mazei (Q977U3)
Archaeoglobus fulgidus (O28970)
Thermococcus kodakaraensis (BAB21262)
Fig. 3. Phylogenetic tree of the archaeal transcription factors TFB as determined by a Bayesian phylogenetic analysis of 259 amino acids. Posterior
probabilities 40.8 are indicated at nodes; the scale bar represents the estimated number of amino acid substitutions per site.
of the ribokinase family (ORF6), a thymidilate kinase ribokinases and the thymidilate kinases, involved in the
(ORF11), two KefB, Kef-type K1 transport system proteins pentose phosphate pathway and in pyrimidine metabolism,
(ORF13 and 14) and a Sec59 dolichol kinase (ORF26). The respectively, shared significant similarities with euryarchaeal
c
2006 Federation of European Microbiological Societies FEMS Microbiol Ecol xx (2006) 000–000
Published by Blackwell Publishing Ltd. All rights reserved
153
Etude 2
Alv-FOS5 ORF7
0.98 Thermococcus kodakaraensis (YP_183361)
1
Pyrococcus abyssi (NP_127270)
1 Pyrococcus horikoshii (BAA29521)
1 Pyrococcus furiosus (AAL80430)
Methanococcoides burtonii (ZP_00148142)
1 Methanosarcina barkeri (ZP_00297637)
1 Methanosarcina acetivorans (AAM07893)
0.98 Methanosarcina mazei (AAM30944)
Thermotoga maritima (AAD35934)
Aeropyrum pernix (BAA81412)
1
Pyrobaculum aerophilum (AAL64582)
Sulfolobus solfataricus (AAK40968)
0.97 1 Sulfolobus tokodaii (BAB66597)
Thermoplasma volcanium (BAB60463)
0.99
1 Thermoplasma acidophilum (CAC11447)
1 Picrophilus torridus (AAT43529)
1 Ferroplasma acidarmanus (ZP_00306043)
Clostridium thermocellum (ZP_00314127)
Thermoanaerobacter tengcongensis (AAM23435)
1 Clostridium perfringens (NP_563116)
1 Clostridium tetani (AAO34947)
0.99 Clostridium acetobutylicum (AAK80825)
Archaeoglobus fulgidus (AAB90461)
0.93 Chlorobium tepidum (AAM72939)
Leptospira interrogans (AAS70308)
0.92 Borrelia burgdorferi (AAC67081)
0.86 Bacteria
Bacteria
0.1
Euryarchaeota
Crenarchaeota
Bacteria
Fig. 4. Phylogenetic tree of the Sua5-related proteins showing a possible case of horizontal gene transfer between Alv-FOS5 and the Thermococcales.
This tree was determined by a Bayesian phylogenetic analysis of 259 amino acids. Posterior probabilities 40.8 are indicated at nodes; the scale bar
represents the estimated number of amino acid substitutions per site.
proteins. The KefB transporters are transmembrane chan- Phylogenetic analysis of the 16S and 23S rRNA
nels involved in potassium efflux by a K1/H1 antiporter genes
transport system. Based on their global alignment, the two
predicted KefB proteins were 31.3% similar. These two ORFs The Bayesian phylogenetic analysis of the 16S rRNA gene
were contiguous in the genomic fragment, separated by an sequences showed that the euryarchaeotal fosmid Alv-FOS5
intergenic region of 41 nt, suggesting a duplication. They strongly clustered within a group of environmental se-
showed a cluster organization with a cystathionine beta quences retrieved from deep-sea hydrothermal vents (Fig.
synthase (CBS) domain-containing protein (ORF15) for 1). This group included sequences met57 obtained in this
which no function was predicted. CBS domains are defined study, CH-A3 (Pagé et al., 2004), AT4-32 (P. Lopez-Garcia
as sequence motifs that occur in CBS and in several other and D. Moreira, unpublished results), and pMC2A and pISA
proteins in all kingdoms of life. Their functions are still belonging to the DHVE3 and DHVE4 groups defined by
unknown but point mutations within them cause several Takai & Horikoshi (1999). These hydrothermal vent se-
hereditary diseases in humans (Scott et al., 2004). The quences formed a branch sister to diverse environmental
three latter ORFs were most closely related to bacterial sequences clustering within the DHVE5 and DHVE6 groups
proteins. Lastly, the predicted protein involved in phos- (Takai & Horikoshi, 1999). According to the Bayesian tree,
pholipid biosynthesis (ORF26) shared significant similari- the closest cultured microorganisms related to Alv-FOS5
ties with only few homologues but all were euryarchaeal appeared to be members of the hyperthermophilic Metha-
protein sequences. nococcales. This relationship was strongly supported by a
154
Etude 2
14 H. Moussard et al.
posterior probability (PP) of 1 (Fig. 1). However, the sequences), pointing to the existence of many paralogues.
phylogenetic tree resulting from an ML analysis did not In general, these paralogues appear to have followed com-
support this affiliation (see supplementary Fig. S1). To plex evolutionary histories with independent duplications
check this disagreement and to increase the phylogenetic and losses and probable HGT events. As a consequence, we
resolution, we carried out phylogenetic analyses with con- obtained very complex trees, in which the monophyly of
catenated 16S and 23S rRNA gene sequences. The Bayesian many groups (including even the three domains of life) was
tree using these combined sequences showed that Alv-FOS5 not retrieved. This problem was particularly severe for the
was related to the Thermoplasmatales, whereas the ML tree phylogenetic analyses of the ribokinase-family protein
placed Alv-FOS5 as a sister branch to diverse euryarchaeotal (ORF6), the two KefB-related carriers (ORF13 and
species including the halophiles, the mesophilic Methano- ORF14), the two glycosyl transferases (ORF22 and ORF24)
sarcinales and the Thermoplasmatales (see supplementary and the two conserved hypothetical proteins encoded by
Figs S2 and S3). Thus, despite the use of a large amount of ORF15 and 29 (data not shown).
data (3502 positions in the concatenated set), the phyloge- Nevertheless, several ORFs encoded proteins with a good
netic position of Alv-FOS5 within the Euryarchaeota re- representation in databases and without apparent problems
mained unclear, probably because it defines a single-species, of hidden paralogues or parallel gene duplications and/or
long branch without close relatives in the tree, which is a losses, such that they were useful for phylogenetic recon-
difficult situation to resolve using phylogenetic analysis struction. A good example was the archaeal transcription
(Hendy & Penny, 1989). Therefore, additional 23S rRNA factor TFB (ORF9), given that its phylogenetic tree did not
gene sequences from related species will be necessary to support any clear case of HGT and was fully congruent with
resolve the unstable phylogenetic position of Alv-FOS5. the classical 16S rRNA gene archaeal trees (Woese et al.,
1990), with the exception of several independent duplica-
tions of this gene in different archaeal groups (e.g. Thermo-
Phylogenetic analysis of protein-coding genes plasmatales, Haloarchaea), which have already been reported
and detection of horizontal gene transfers in previous analyses (Archibald & Roger, 2002). In our
To clarify further the branching position of Alv-FOS5 and to Bayesian analysis (Fig. 3), the TFB sequence of Alv-FOS5
identify possible horizontal gene transfer (HGT) events, emerged without clear close relatives, further supporting the
phylogenetic analyses were carried out on the 23 predicted idea that it may belong to an independent group of
protein-coding genes of Alv-FOS5 having homologues in euryarchaeota and in agreement with the phylogeny based
databases (all trees and alignments are available upon on the 16S rRNA gene sequences (Fig. 1).
request). Unfortunately, the majority of these proteins failed The phylogenetic analysis of the predicted Sua5-related
to exhibit a clear phylogenetic profile, for several reasons. protein (ORF7) showed that all archaeal sequences clustered
Sequence conservation for a few proteins (ORF3 and the together, except that of A. fulgidus, which branched within a
dolichol kinase, ORF26) was so poor that the phylogenetic group of bacterial sequences (Fig. 4). Within the archaeal
analyses were unreliable. In other cases, these genes have sequences, two groups could be defined. The first included
multiple copies in each species (this was particularly notice- the Alv-FOS5 sequence and its homologues from the
able for those species with available complete genome Thermococcales (with a strong PP of 0.98), while the second
c
2006 Federation of European Microbiological Societies FEMS Microbiol Ecol xx (2006) 000–000
Published by Blackwell Publishing Ltd. All rights reserved
155
Etude 2
one grouped other euryarchaeotal (Thermoplasmatales and fosmid library with the DNA of the same microbial assem-
some methanogens) with the crenarchaeotal homologues. blage. We analysed the sequence of Alv-FOS5, one of the
Interestingly, the Thermotoga maritima homologue archaeal genome fragments identified in the library.
branched robustly within the archaeal sequences, which Phylogenetic analyses showed that the 16S rRNA gene
suggested that T. maritima has gained this gene from sequences of Alv-FOS5 belong to a new cluster within the
Archaea, in one of the numerous HGT events that have DHVE group II, the placement of which was strongly
occurred between the thermophilic bacteria and the Archaea influenced by the sequences used in the datasets. The
(Nelson et al., 1999). Conversely, it seems that A. fulgidus has accurate determination of the position of the large hydro-
acquired its Sua5 homologue from Bacteria, suggesting that thermal group containing Alv-FOS5 will most likely be
HGT of this gene is not infrequent. The position of Alv- possible only when conserved sequences (small- and large-
FOS5 in our tree was unexpected, as in other trees based on subunit rRNA and protein coding genes) from other species
conserved markers (see the 16S and 23S rRNA genes and the of this group become available. Regardless, it is clear that
TFB factor above) it did not emerge so close to the Alv-FOS5 and its relatives define a large, independent
Thermococcales. This result might suggest that Alv-FOS5 phylogenetic group within the Euryarchaeota. The G1C
has acquired this gene from a member of the order Thermo- content of the 16S rRNA gene sequence of Alv-FOS5 was
coccales. Interestingly, the region of this fosmid upstream to relatively high (460 mol%), a feature shared by hyperther-
this gene contained two ORFs with a G1C content higher mophilic bacteria and archaea. The presence of a gene
than the average for the rest of ORFs (41.65 mol%). These encoding a putative homologue of class II chaperonins
were ORF4 (46.81 mol%) and ORF6 (47.46 mol%). As for highly similar to that of hyperthermophilic archaea also
the Sua5-related protein, the phylogenetic analysis of ORF4, supports the hypothesis of a possible thermophilic lifestyle
encoding a chaperonin of the Hsp60 family, also supported a for Alv-FOS5.
close relationship between Alv-FOS5 and the Thermococ- Our analysis revealed a number of other genes in the
cales (data not shown), while ORF6 (encoding a sugar immediate surroundings of the 16S and 23S rRNA genes.
kinase) yielded a complex phylogeny that was difficult to They include genes essential in the transport and energy
interpret (see above). The phylogenetic signal shown by the metabolism of the archaeal organism. We identified a
ORF4 and ORF6 together with the concurrent observation potential operon probably involved in the breakdown of
of an anomalous G1C content suggested that this region of intracellular glycogen and a sugar kinase. Although the
Alv-FOS5 might have been acquired by HGT from a presence of glycogen in archaea has been demonstrated
member of the Thermococcales. (König et al., 1982), little is known about glycogen metabo-
Potential HGTs involving Bacteria were also observed. lism in this group. Because sugar catabolic pathways are
The best example concerned the predicted permease absent in nonheterotrophic archaea, except for glycogen-
(ORF2). Its BLAST hit was of a protein encoded by a debranching methanogens (Verhees et al., 2003), the finding
plasmid of Nostoc sp. (Table 2) and the phylogenetic analysis of these genes may be suggestive of a heterotrophic lifestyle.
confirmed this relationship (Fig. 5). Although the G1C To validate these predictions, it would be interesting to
content of this ORF (40.83 mol%) did not deviate signifi- express these genes and to perform a detailed biochemical
cantly from the average, the possibility of an HGT event was analyses to identify their precise functions. Additional
further supported by inspection of the alignment of ORF2 genomic sequence data could also help to gain greater
and its homologues, as only the Alv-FOS5 protein and few insight into the physiology of this organism. Better knowl-
bacterial homologues (including that of Nostoc sp.) pos- edge of the environmental distribution of Alv-FOS5 and its
sessed several distinctive deletions, as well as several shared close relatives may suggest strategies for capturing new
amino-acid sequence signatures (data not shown). The fact genomic sequences of this particular phylogenetic group
that this protein was encoded by plasmids in certain bacteria and/or direct selective isolation attempts. Our study has
was also in agreement with the possibility of its dissemina- demonstrated that mismatches in a widely used archaeal-
tion by HGT. specific 16S rRNA gene primer (21F) prevented their
molecular detection. The genes identified in Alv-FOS5
might therefore serve as templates to design specific probes
Conclusion useful to identify the ecological niches inhabited by these
We examined the diversity of the archaeal community organisms.
associated with tubes of the hydrothermal polychaete Alvi-
nella pompejana by constructing 16S rRNA gene libraries.
Almost half of the identified sequences clustered with
Acknowledgements
uncultured groups. To explore the genetic and metabolic We thank Nadine Le Bris and Françoise Gaill, chief scientist
potential of these groups, we constructed a large-insert and project leader of the Phare cruise, for inviting us on
156
Etude 2
16 H. Moussard et al.
board. We thank the captain and crew of L’Atalante and the Campbell BJ, Stein JL & Cary SC (2003) Evidence of
pilots and support crew of the ROV Victor. We greatly chemolithoautotrophy in the bacterial community associated
acknowledge Emmanuelle Morin and Patrick Durand (Ir- with Alvinella pompejana, a hydrothermal vent polychaete.
isa-Inria) for their help in the use of the Genostar platform. Appl Environ Microbiol 69: 5070–5078.
This work was financed by the CNRS programme ‘Geomex’ Cary SC, Cottrell MT, Stein JL, Camacho F & Desbruyeres D
and by the CNRS-Ministère de la Recherche programme (1997) Molecular identification and localization of
‘Séquençage à Grande Echelle’. H.M. was supported by a filamentous symbiotic bacteria associated with the
grant from the Ministère de la Recherche. hydrothermal vent annelid Alvinella pompejana. Appl Environ
Microbiol 63: 1124–1130.
Cary SC, Shank T & Stein J (1998) Worms bask in extreme
References temperatures. Nature 391: 545–546.
Chevaldonné P, Desbruyères D & Childress JJ (1992) Some like it
Alain K, Querellou J, Lesongeur F, Pignet P, Crassous P, Raguenes hot . . . and some even hotter. Nature 359: 593–594.
G, Cueff V & Cambon-Bonavita MA (2002) Caminibacter Dalgaard J & Garrett R (1993) Archaeal hyperthermophilic genes.
hydrogeniphilus gen. nov., sp. nov., a novel thermophilic, The biochemistry of Archaea (Archaebacteria), Vol. 26 (Kates M,
hydrogen-oxidizing bacterium isolated from an East Pacific Kushner DJ & Matheson AT, eds), pp. 535–563. Elsevier,
Rise hydrothermal vent. Int J Syst Evol Microbiol 52: Amsterdam, The Netherlands.
1317–1323. Desbruyères D, Gaill F, Laubier L & Fouquet Y (1985)
Altschul SF, Madden TL, Schaffer AA, Zhang J, Zhang Z, Miller W Polychaetous annelids from hydrothermal vent ecosystems: an
& Lipman DJ (1997) Gapped BLAST and PSI-BLAST: a new ecological overview. Biol Soc Wash Bull 6: 103–106.
generation of protein database search programs. Nucleic Acids Desbruyères D, Chevaldonné P, Alayse AM, et al. (1998) Biology
Res 25: 3389–3402.
and ecology of the ‘Pompei worm’ (Alvinella pompejana
Angelov A (2004) Genome sequence analysis and
Desbruyères and Laubier), a normal dweller of an extreme
characterization of recombinant enzymes from the
deep-sea environment: a synthesis of current knowledge and
thermoacidophilic archaeon Picrophilus torridus. PhD thesis,
recent developments. Deep-Sea Res II 45: 383–422.
Georg-August-Universität Göttingen (http://
Dojka MA, Hugenholtz P, Haack SK & Pace NR (1998) Microbial
webdoc.sub.gwdg.de/diss/2004/angelov/angelov.pdf).
diversity in a hydrocarbon- and chlorinated-solvent-
Archibald JM & Roger AJ (2002) Gene duplication and gene
contaminated aquifer undergoing intrinsic bioremediation.
conversion shape the evolution of archaeal chaperonins. J Mol
Appl Environ Microbiol 64: 3869–3877.
Biol 316: 1041–1050.
Erkel C, Kemnitz D, Kube M, Ricke P, Chin K-J, Dedysh S,
Archibald JM, Logsdon JM Jr & Doolittle WF (2000) Origin and
Reinhardt R, Conrad R & Liesack W (2005) Retrieval of first
evolution of eukaryotic chaperonins: phylogenetic evidence
genome data for rice cluster I methanogens by a combination
for ancient duplications in CCT genes. Mol Biol Evol 17:
of cultivation and molecular techniques. FEMS Microbiol Ecol
1456–1466.
Beja O, Aravind L, Koonin EV, Suzuki MT, Hadd A & Nguyen LP 53: 187–204.
(2000a) Bacterial rhodopsin: evidence for a new type of Gaill F, Desbruyères D & Prieur D (1987) Bacterial communities
phototrophy in the sea. Science 289: 1902–1906. associated with ‘Pompei worms’ from the East Pacific Rise
Beja O, Marcelino TS, Eugene VK, et al. (2000b) Construction hydrothermal vents: SEM, TEM observations. Microb Ecol 13:
and analysis of bacterial artificial chromosome libraries from a 129–139.
marine microbial assemblage. Environ Microbiol 2: 516–529. Galtier N, Tourasse N & Gouy M (1999) A nonhyperthermophilic
Le Bris N, Gaill F, Alain K, et al. (2002) Biogeochemical common ancestor to extant life forms. Science 283: 220–221.
interactions in extreme environmental conditions: an Haddad A, Camacho F, Durand P & Cary SC (1995) Phylogenetic
integrated study (PHARE 2002/EPR 131N). InterRidge News characterization of the epibiotic bacteria associated with the
11: 20–23. hydrothermal vent polychaete Alvinella pompejana. Appl
Le Bris N, Zbinden M & Gaill F (2005) Processes controlling the Environ Microbiol 61: 1679–1687.
physico-chemical micro-environments associated with Hallam SJ, Girguis PR, Preston CM, Richardson PM & DeLong
Pompeii worms. Deep Sea Res I 52: 1071–1083. EF (2003) Identification of methyl coenzyme M reductase A
Campbell BJ & Cary SC (2001) Characterization of a novel (mcrA) genes associated with methane-oxidizing Archaea.
spirochete associated with the hydrothermal vent polychaete Appl Environ Microbiol 69: 5483–5491.
annelid, Alvinella pompejana. Appl Environ Microbiol 67: Hallam SJ, Putnam N, Preston CM, Detter JC, Rokhsar D,
110–117. Richardson PM & DeLong EF (2004) Reverse methanogenesis:
Campbell BJ, Jeanthon C, Kostka JE, Luther GW & Cary SC testing the hypothesis with environmental genomics. Science
(2001) Growth and phylogenetic properties of novel bacteria 305: 1457–1462.
belonging to the epsilon subdivision of the Proteobacteria Harmsen H, Prieur D & Jeanthon C (1997) Distribution of
enriched from Alvinella pompejana and deep-sea microorganisms in deep-sea hydrothermal vent chimneys
hydrothermal vents. Appl Environ Microbiol 67: 4566–4572. investigated by whole-cell hybridization and enrichment
c
2006 Federation of European Microbiological Societies FEMS Microbiol Ecol xx (2006) 000–000
Published by Blackwell Publishing Ltd. All rights reserved
157
Etude 2
culture of thermophilic subpopulations. Appl Environ Nautilia lithotrophica gen. nov., sp. nov., a thermophilic sulfur-
Microbiol 63: 2876–2883. reducing epsilon proteobacterium isolated from a deep-sea
Hendy M & Penny D (1989) A framework for the quantitative hydrothermal vent. Int J Syst Evol Microbiol 52: 1299–1304.
study of evolutionary trees. Syst Zool 38: 297–309. Moreira D, Rodriguez-Valera F & Lopez-Garcia P (2004) Analysis
Hoek J, Banta A, Hubler F & Reysenbach A-L (2003) Microbial of a genome fragment of a deep-sea uncultivated Group II
diversity of a sulphide spire located in the Edmond deep-sea euryarchaeote containing 16S rDNA, a spectinomycin-like
hydrothermal vent field on the Central Indian Ridge. operon and several energy metabolism genes. Environ
Geobiology 1: 119–127. Microbiol 6: 959–969.
Hohn MJ, Hedlund BP & Huber H (2002) Detection of 16S Nelson KE, Clayton RA, Gill SR, et al. (1999) Evidence for lateral
rDNA sequences representing the novel phylum gene transfer between Archaea and bacteria from genome
‘Nanoarchaeota’: indication for a wide distribution in high sequence of Thermotoga maritima. Nature 399: 323–329.
temperature biotopes. Syst Appl Microbiol 25: 551–554. Nercessian O, Reysenbach AL, Prieur D & Jeanthon C (2003a)
Huber H & Stetter KO (2001) Desulfurococcales. Bergey’s Manual Archaeal diversity associated with in situ samplers deployed on
of Systematic Bacteriology, Vol. 1 (Boone DR, Castenholz RW & hydrothermal vents on the East Pacific Rise (13 degrees N).
Garrity G, eds), pp. 179–197. Springer-Verlag, New York. Environ Microbiol 5: 492–502.
Huber JA, Butterfield DA & Baross JA (2002a) Temporal changes Nercessian O, Reysenbach AL, Prieur D & Jeanthon C (2003b)
in archaeal diversity and chemistry in a Mid-Ocean ridge Archaeal diversity associated with in situ samplers deployed on
subseafloor habitat. Appl Environ Microbiol 68: 1585–1594. hydrothermal vents on the East Pacific Rise (13 degrees N).
Huber H, Hohn MJ, Rachel R, Fuchs T, Wimmer VC & Stetter KO Environ Microbiol 5: 492–502.
(2002b) A new phylum of Archaea represented by a nanosized Nercessian O, Prokofeva M, Lebedinski A, L’Haridon S, Cary C,
hyperthermophilic symbiont. Nature 417: 63–67. Prieur D & Jeanthon C (2004) Design of 16S rRNA-targeted
Huelsenbeck JP & Ronquist F (2001) MRBAYES: Bayesian oligonucleotide probes for detecting cultured and uncultured
inference of phylogenetic trees. Bioinformatics 17: 754–755. archaeal lineages in high-temperature environments. Environ
Hughes DS, Felbeck H & Stein JL (1997) A histidine protein Microbiol 6: 170–182.
kinase homolog from the endosymbiont of the hydrothermal Nercessian O, Bienvenu N, Moreira D, Prieur D & Jeanthon C
vent tubeworm Riftia pachyptila. Appl Environ Microbiol 63: (2005) Diversity of functional genes of methanogens,
3494–3498. methanotrophs and sulfate reducers in deep-sea hydrothermal
Jeanthon C & Prieur D (1990) Susceptibility to heavy metals and environments. Environ Microbiol 7: 118–132.
characterization of heterotrophic bacteria isolated from two Pagé A, Juniper SK, Olagnon M, Alain K, Desrosiers G, Querellou
hydrothermal vent polychaete, Alvinella pompejana and J & Cambon-Bonavita MA (2004) Microbial diversity
Alvinella caudata. Appl Environ Microbiol 56: 3308–3314. associated with a Paralvinella sulfincola tube and the adjacent
Jobb G, von Haeseler A & Strimmer K (2004) TREEFINDER: a substratum on an active deep-sea vent chimney. Geobiology 2:
powerful graphical analysis environment for molecular 225–238.
phylogenetics. BMC Evol Biol 4: 18. Philippe H (1993) MUST, a computer package of management
König H, Skorko RW, Zillig W & Reiter WD (1982) Glycogen in utilities for sequences and trees. Nucleic Acids Res 21:
thermoacidophilic archaebacteria of the genera Sulfolobus, 5264–5272.
Thermoproteus, Desulfurococcus and Thermococcus. Arch Quaiser A, Ochsenreiter T, Klenk HP, Kletzin A, Treusch AH,
Microbiol 132: 297–303. Meurer G, Eck J, Sensen CW & Schleper C (2002) First insight
Kruger M, Meyerdierks A, Glockner FO, et al. (2003) A into the genome of an uncultivated crenarchaeote from soil.
conspicuous nickel protein in microbial mats that oxidize Environ Microbiol 4: 603–611.
methane anaerobically. Nature 426: 878–881. Reysenbach AL, Longnecker K & Kirshtein J (2000) Novel
Lopez-Garcia P, Philippe H, Gail F & Moreira D (2003) bacterial and archaeal lineages from an in situ growth chamber
Autochthonous eukaryotic diversity in hydrothermal sediment deployed at a Mid-Atlantic Ridge hydrothermal vent. App
and experimental microcolonizers at the Mid-Atlantic Ridge. Environ Microbiol 66: 3798–3806.
Proc Natl Acad Sci USA 100: 697–702. Rondon MR, August PR, Bettermann AD, et al. (2000) Cloning
Lopez-Garcia P, Brochier C, Moreira D & Rodriguez-Valera F the soil metagenome: a strategy for accessing the genetic and
(2004) Comparative analysis of a genome fragment of an functional diversity of uncultured microorganisms. Appl
uncultivated mesopelagic crenarchaeote reveals multiple Environ Microbiol 66: 2541–2547.
horizontal gene transfers. Environ Microbiol 6: 19–34. Schleper C, Swanson RV, Mathur EJ & DeLong EF (1997)
Di Meo-Savoie CA, Luther GWr & Cary SC (2004) Characterization of a DNA polymerase from the uncultivated
Physicochemical characterization of the microhabitat of psychrophilic archaeon Cenarchaeum symbiosum. J Bacteriol
Alvinella pompejana, a hydrothermal vent annelid. Geochim 179: 7803–7811.
Cosmochim Acta 68: 2055–2066. Schleper C, DeLong EF, Preston CM, Feldman RA, Wu K-Y &
Miroshnichenko ML, Kostrikina NA, L’Haridon S, Jeanthon C, Swanson RV (1998) Genomic analysis reveals chromosomal
Hippe H, Stackebrandt E & Bonch-Osmolovskaya EA (2002) variation in natural populations of the uncultured
158
Etude 2
18 H. Moussard et al.
psychrophilic archaeon Cenarchaeum symbiosum. J Bacteriol Trent JD, Nimmesgern E, Wall JS, Hartl FU & Horwich AL (1991)
180: 5003–5009. A molecular chaperone from a thermophilic archaebacterium
Schrenk MO, Kelley DS, Delaney JR & Baross JA (2003) Incidence is related to the eukaryotic protein t-complex polypeptide-1.
and diversity of microorganisms within the walls of an active Nature 354: 490–493.
deep-sea sulfide chimney. Appl Environ Microbiol 69: Treusch AH, Kletzin A, Raddatz G, Ochsenreiter T, Quaiser A,
3580–3592. Meurer G, Schuster SC & Schleper C (2004) Characterization
Scott JW, Hawley SA, Green KA, Anis M, Stewart G, Scullion GA, of large-insert DNA libraries from soil for environmental
Norman DG & Hardie DG (2004) CBS domains form energy- genomic studies of Archaea. Environ Microbiol 6: 970–980.
sensing modules whose binding of adenosine ligands is Tyson GW, Chapman J, Hugenholtz P, Allen EE, Ram RJ,
disrupted by disease mutations. J Clin Invest 113: 274–284. Richardson PM, Solovyev VV, Rubin EM, Rokhsar DS &
Singleton DR, Furlong MA, Rathbun SL & Whitman WB (2001) Banfield JF (2004) Community structure and metabolism
Quantitative comparisons of 16S rRNA gene sequence libraries through reconstruction of microbial genomes from the
from environmental samples. Appl Environ Microbiol 67: environment. Nature 428: 37–43.
4374–4376. Venter JC, Remington K, Heidelberg JF, et al. (2004)
Skirnisdottir S, Hreggvidsson GO, Hjorleifsdottir S, Marteinsson Environmental genome shotgun sequencing of the Sargasso
VT, Petursdottir SK, Holst O & Kristjansson JK (2000) Sea. Science 304: 66–36.
Influence of sulfide and temperature on species composition Verhees CH, Kengen SW, Tuininga JE, Schut GJ, Adams MW,
and community structure of hot spring microbial mats. Appl De Vos WM & Van Der Oost J (2003) The unique features of
Environ Microbiol 66: 2835–2841. glycolytic pathways in Archaea. Biochem J 375: 231–246.
Stein JL, Marsh TL, Wu KY, Shizuya H & DeLong EF (1996) Werner E, Holder AA & Hoheisel JD (1997) Growth and storage
Characterization of uncultivated prokaryotes: isolation and of YAC clones in Hogness freezing medium. Nucleic Acids Res
analysis of a 40-kilobase-pair genome fragment from a 25: 1467–1468.
planktonic marine archaeon. J Bacteriol 178: 591–599. Whitman WB, Boone DR & Koga Y (2001)
Suh S-O & Blackwell M (2004) Three new beetle-associated yeast Methanocaldococcaceae. Bergey’s Manual of Systematic
species in the Pichia guilliermondii clade. FEMS Yeast Res 5: Bacteriology, Vol. 1 (Boone DR, Castenholz RW & Garrity G,
87–95. eds), pp. 242–246. Springer-Verlag, New York.
Takai K & Horikoshi K (1999) Genetic diversity of Archaea in Woese CR, Kandler O & Wheelis ML (1990) Towards a natural
deep-sea hydrothermal vent environments. Genetics 152: system of organisms: proposal for the domains Archaea,
1285–1297. Bacteria, and Eucarya. Proc Natl Acad Sci USA 87: 4576–4579.
Takai K, Komatsu T, Inagaki F & Horikoshi K (2001) Distribution Zillig W & Reysenbach AL (2001) Thermococcales. Bergey’s
of Archaea in a black smoker chimney structure. Appl Environ Manual of Systematic Bacteriology, Vol. 1 (Boone DR,
Microbiol 67: 3618–3629. Castenholz RW & Garrity G, eds), pp. 341–348. Springer-
Takai K, Inagaki F, Nakagawa S, Hirayama H, Nunoura T, Sako Y, Verlag, New York.
Nealson KH & Horikoshi K (2003) Isolation and phylogenetic
diversity of members of previously uncultivated e-
Proteobacteria in deep-sea hydrothermal fields. FEMS
Microbiol Lett 218: 167–174. Supplementary material
Tatusov RL, Natale DA, Garkavtsev IV, Tatusova TA,
The following supplementary material is available online:
Shankavaram UT, Rao BS, Kiryutin B, Galperin MY, Fedorova
ND & Koonin EV (2001) The COG database: new
Fig. S1. Maximum-likelihood (ML) phylogenetic tree
developments in phylogenetic classification of proteins from of 16S rRNA archaeal genes.
complete genomes. Nucleic Acids Res 29: 22–28. Fig. S2. Maximum-likelihood (ML) phylogenetic tree
Thompson JD, Higgins DG & Gibson TJ (1994) CLUSTAL W: of concatenated 16S and 23S rRNA archaeal genes.
improving the sensitivity of progressive multiple sequence Fig. S3. Bayesian phylogenetic tree of concatenated 16S
alignment through sequence weighting, position-specific gap and 23S rRNA archaeal genes.
penalties and weight matrix choice. Nucleic Acids Res 22: This material is available as part of the online article
4673–4680. from http://www.blackwell-synergy.com
c
2006 Federation of European Microbiological Societies FEMS Microbiol Ecol xx (2006) 000–000
Published by Blackwell Publishing Ltd. All rights reserved
159
Etude 2
DHVE group I
100
metC10 (DQ082935)
pMC2A24 (AB019736)
Thermoplasma acidophilum (M38637)
100 Ferroplasma acidiphilum (AJ224936)
79.5 97.5 Picrophilus oshimae (X84901)
G26_C56 (AF356635)
VC2.1 Arc13 (AF068820)
94.5 pSSMCA108 (AB019740)
pISA42 (AB019742)
82 FT17A03 (AY251064) DHVE2
100
pISA12 (AB019741)
met43 (DQ082955)
99 Alv-FOS1
pEPR193 (AF526965)
85 Alv-FOS2 (DQ082975)
Alv-FOS4
99 87 met24 (DQ082954)
FT17A09 (AY251065)
99.5 Alv-FOS3 (DQ082976)
95.5 met21 (DQ082953)
pMC2A211 (AB019746)
98 pMC2A5 (AB019743) DHVE3
AT4 32 (DQ114471)
CH-A3 (AY280439)
Novel DHVE
99 Alv-FOS5
100 met57 (DQ082950) lineage
85
pMC2A384 (AB019734)
96.5 metB11 (DQ082934) DHVE4
83.5 100 pISA35 (AB019748)
pISA18 (AB019749)
pISA1 (AB019751)
100 pISA38 (AB019750)
DHVE group II
Nubeena78 (AY500128)
100
ESYB68 (AB119624)
ESYB24 (AB119580)
met28 (DQ082947)
met80 (DQ082942)
78 ESYB50 (AB119606)
78 ESYB51 (AB119607)
96.5 met66 (DQ082941) DHVE5
100 met1 (DQ082939)
97.5 met36 (DQ082940)
metD12 (DQ082929)
100 90 metE6 (DQ082930)
79.5 KuA18 (AB077228)
100 met64 (DQ082944)
met87 (DQ082943)
100 ESYB25 (AB119581)
96 metA11 (DQ082931)
met60 (DQ082945)
100 met62 (DQ082946)
ACE-6 (AF142788)
pMC2A35 (AB019753)
100 met20 (DQ082949)
85 pISA3 (AB019752)
0.1 100 DHVE6
metF7 (DQ082932)
metH8 (DQ082933)
100 met23 (DQ082948)
89 pISA13 (AB019756)
pISA48 (AB019755)
Fig. S1. Maximum-likelihood (ML) phylogenetic tree of 16S rRNA archaeal genes. A total of 795 positions were
used in the phylogenetic analysis. Numbers at the nodes are ML bootstrap proportions estimated upon 200 sam-
plings (only those > 70% are indicated); the scale bar represents the estimated number of nucleotide substitutions
per site.
160
Etude 2
Pyrobaculum aerophilum
99.8 Thermofilum pendens
Aeropyrum pernix
100
93.6 Desulfurococcus mobilis Crenarchaeota
100 Acidianus infernus
100 Sulfolobus tokodaii
89.8 Sulfolobus shibatae
Methanopyrus kandleri Euryarchaeota
Pyrococcus horikoshii
100 Pyrococcus abyssi
100 Thermococcus kodakaraensis
100 Thermococcus celer
Archaeoglobus fulgidus
Methanocaldococcus jannaschii
100 100 Methanococcus maripaludis
100 Methanococcus vannielii
73 Methanothermobacter thermautotrophicus
Alv-FOS5
Picrophilus torridus
100 Thermoplasma acidophilum
84 100
Thermoplasma volcanium
Methanospirillum hungatei
100
100 Methanosarcina acetivorans
100
Methanosarcina mazei
100
Halobacterium sp. NRC-1
Halococcus morrhuae
Haloarcula marismortui
100
Halosimplex carlsbadense
0.1
Haloferax mediterranei
80 Natrinema sp. XA3-1
100 Natronobacterium magadii
Fig. S2. Maximum-likelihood (ML) phylogenetic tree of concatenated 16S and 23S rRNA archaeal genes. A total
of 3502 positions were used in the phylogenetic analysis. Numbers at the nodes are ML bootstrap proportions
estimated upon 200 samplings (only those > 70% are indicated); the scale bar represents the estimated number of
nucleotide substitutions per site.
161
Etude 2
Acidianus infernus
1 Sulfolobus tokodaii
1
Sulfolobus shibatae
1
Crenarchaeota
Aeropyrum pernix
1
1 Desulfurococcus mobilis
Pyrobaculum aerophilum
1
Thermofilum pendens
Pyrococcus abyssi
1
Pyrococcus horikoshii
1
Thermococcus kodakaraensis
1
Thermococcus celer
Archaeoglobus fulgidus
Methanospirillum hungatei
1 1 Methanosarcina acetivorans
1
Methanosarcina mazei
1 1 Haloferax mediterranei
Halosimplex carlsbadense
1
Haloarcula marismortui
Alv-FOS5
1
1 Picrophilus torridus
1 Thermoplasma volcanium
1
Thermoplasma acidophilum
Methanothermobacter thermautotrophicus
1 Methanococcus maripaludis
0.1
1
Methanococcus vannielii
Fig. S3. Bayesian phylogenetic tree of concatenated 16S and 23S rRNA archaeal genes. A total of 3502 posi-
tions were used in the phylogenetic analysis. Posterior probabilities > 0.8 are indicated at nodes; the scale bar
represents the estimated number of nucleotide substitutions per site.
162
Etude 2. Résultats complémentaires
Dans l'étude 2, la diversité de la communauté archéenne associée à des tubes d'A. pompe-
jana a été analysée à l'aide de techniques moléculaires. Pour cela, des tubes de ce polychète ont
été prélevés lors de la campagne PHARE, sur la paroi d'une cheminée hydrothermale active du
site 13o N EPR. Après extraction de l'ADN génomique issu de la communauté microbienne des
tubes d'A. pompejana, les gènes d'ARNr 16S ont été ampliés par PCR. Deux couples d'amorces
spéciques du domaine Archaea ont été utilisés pour amplier les gènes d'ARNr 16S : le couple
W36/1492R et le couple 4F/1492R. Le clonage de ces gènes d'ARNr 16S ainsi ampliés a res-
pectivement permis de construire la banque W36 contenant 83 clones et la banque 4F contenant
81 clones.
Tous les clones de ces deux banques ont été partiellement séquencés (séquences d'ADNr
16S d'environ 750 nucléotides). Quelques séquences chimériques détectées par le programme
CHECK-CHIMERA (http://rdp8.cme.msu.edu/cgis/chimera.cgi?su=SSU), ont été élimi-
nées de l'analyse (10 chimères identiées dans la banque W36 et 9 dans la banque 4F). Au
total, 73 séquences de la banque W36 et 72 séquences de la banque 4F ont été retenues pour une
analyse phylogénétique. Considérant que les séquences d'ADNr 16S qui ont plus de 97% d'iden-
tité, appartiennent à la même espèce ; les séquences partielles qui partageaient au moins 97%
d'identité ont été regroupées au sein d'un même phylotype représenté par une séquence type.
Les organismes cultivés et incultivés les plus proches de chaque phylotype ont ensuite été iden-
tiés par BLAST, dans la banque de données GenBank (http://www.ncbi.nih.gov/BLAST/).
Comme attendu, la majorité des séquences analysées avait des organismes aliés aux Archaea
comme plus proches représentants (Etude 2). Cependant, une proportion non négligeable de sé-
quences, à savoir 21.68% pour la banque W36 (soit 8 séquences) et 17.28% pour la banque 4F
(soit 14 séquences), avait pour plus proches représentants des organismes aliés au domaine des
Bacteria (Tableau 1).
163
Etude 2. Résultats complémentaires
Proteobacteria
ε−Proteobacteria met6 metE9 Clone L50-WB7 Sulfurimonas paralvinella 55,55 64,28%
(Helicobacteracea) metA2 (DQ071286) (AB252048) (98%) (10) (9)
metA8 (98%)
metH12
metC5
metF1
metB12
metB7
metB8
met37
met15
met75
met77
met5
met76
met92
metE1
met82
ε-Proteobacteria met10 - Clone a2b004 Proteobacterium BHI80-20 5,55 (1) -
(Groupe F) (AF420345) (AJ431223) (96%)
(96%)
δ-Proteobacteria metB4 metC4 Clone R4B9 Desulfacinum hydrothermale 16,66 (3) 14,28 (2)
metG7 (AF482443) (AF170417) (87%)
metF3 (87%)
met42
metG6 - Clone CS_B022 Geobacter bremensis - 7,14 (1)
(AF420354) (U96917) (89%)
(97%)
metC12 - Clone 112 Desulfuromonas thiophila 5,55 (1) -
(AY835388) (Y11560) (97%)
(98%)
CFB met33 met11 Clone P. palm Flavobacterium sp. 3034 5,55 (1) 7,14 (1)
C/A 100 (AM110988) (91%)
(AJ441216)
(98%)
met52 - Clone TANB53 Cytophaga sp. souche 5,55 (1) -
(AY667260) BHI60-95B
(95%) (AJ431254) (91%)
Affiliation met90 - Clone FW17 Pediococcus dextrinicus - 7,14 (1)
incertaine (AF524026) (D87679) (77%)
(85%)
metB6 - Clone IBC2-7 Caldothrix abyssi 5,55 (1) -
(AB175571) (AJ430587) (90%)
(98%)
A
> 97% d’identité entre les séquences d’un même groupe, sur 750 nucléotides approximativement
B
Les nombres correspondent aux pourcentages de clones bactériens détectés dans la banque.
CFB: Cytophaga-Flavobacteria-Bacteroides
Tableau 1 Aliations phylogénétiques des séquences d'ADNr 16S bactériennes de la communauté microbienne
associée aux tubes d'A. pompejana.
164
Etude 2. Résultats complémentaires
phile modérée, anaérobie et mixotrophe, qui a été isolée du site hydrothermal Logatchev de la
dorsale médio-atlantique (Miroshnichenko et al., 2003).
La deuxième séquence qui n'a pu être aliée à un groupe phylogénétique, met90, a comme
plus proche représentant la séquence environnementale FW17 (85% d'identité). Cette dernière
provient d'un échantillon de sol d'une forêt de pin (Brot et al., 2002). L'organisme cultivé le
plus proche de met90 est Pediococcus dextrinicus. Il n'y a seulement que 77% d'identité entre
met90 et P. dextrinicus.
Mis à part les deux séquences précédemment évoquées, l'analyse des séquences bactériennes
d'ADNr 16S provenant des banques W36 et 4F a révélé qu'elles étaient principalement appa-
rentées aux ε-Proteobacteria et aux δ -Proteobacteria. Quelques séquences apparentées au groupe
des Cytophaga-Flavobacterium-Bacteroides (groupe CFB) ont également été détectées dans les
banques 4F et W36.
Avec 55% des clones de la banque W36 et 64% des clones de la banque 4F, le phylotype met6
représente à lui seul, plus de la moitié des séquences des clones bactériens obtenues dans les deux
banques. Cette étude conrme de précédentes études qui ont montré que les ε-Proteobacteria
étaient largement distribuées dans les environnements hydrothermaux marins profonds (cf. étude
1).
Les deux autres séquences types apparentées aux δ -Proteobacteria, metB4 et metG6, n'ont
pas de représentant cultivé proche. MetB4 qui regroupe 16,7% de clones bactériens de la banque
W36 et 14,3% des clones bactériens de la banque 4F, ne présente que 87% d'identité avec De-
sulfacinum hydrothermale, le micro-organisme cultivé le plus proche. D. hydrothermale est une
165
Etude 2. Résultats complémentaires
bactérie thermophile sulfato-réductrice qui a été isolée de sédiments hydrothermaux près de l'ile
Milos (Grèce) (Sievert & Kuever, 2000). La séquence metG6, uniquement détectée dans la banque
4F, ne présente quant à elle que 89% d'identité avec Geobacter bremensis, l'organisme cultivé
le plus proche. G. bremensis est une bactérie anaérobie isolée de sédiments d'eau douce, qui
réduit le fer (Straub & Buchholz-Cleven, 2001). Notons cependant que la séquence metG6 est
très proche de séquences environnementales d'origine hydrothermale océanique profonde, comme
la séquence CS_B022 (97% d'identité) identiée dans la bassin de Guaymas (Teske et al., 2002).
2 Conclusion
Pour conclure, le compartiment bactérien des tubes d'A.pompejana semble également parti-
culièrement intéressant à analyser d'un point de vue métagénomique. En eet, sur les quelques
séquences d'ADNr 16S bactériennes qui ont été analysées, toutes avaient pour plus proche repré-
sentant des organismes incultivés. Certaines d'entre elles, étaient parfois même très éloignées des
organismes cultivés les plus proches. Grâce à la métagénomique, il serait donc possible d'accéder
à une partie des informations contenues dans les génomes de ces micro-organismes incultivés.
166
Étude 3
168
Etude 3. Introduction
Les inventaires moléculaires conduits depuis quelques années au niveau de l'écosystème hydro-
thermal, ont révélé la présence de plusieurs groupes phylogénétiques d'incultivés semblant être
inféodées à l'écosystème hydrothermal profond. C'est par exemple le cas du groupe DHVE2 (pour
Deep-Sea Hydrothermal Vent Euryarchaeotic) qui a été découvert sur des champs hydrothermaux
de l'arc insulaire japonais (Takai & Horikoshi, 1999). Ce groupe d'Euryarchaeota a été depuis mis
en évidence dans la plupart des sites hydrothermaux échantillonnés sur les dorsales du Pacique
oriental, du Pacique Nord et de l'Atlantique (Reysenbach et al., 2000 ; Takai et al., 2001a ;
Huber et al., 2002 ; Nercessian et al., 2003, 2004). Ces études ont montré l'ubiquité des DHVE2
dans le pôle chaud de l'écosystème hydrothermal, mais elles ont apporté peu d'informations sur
la physiologie, le mode de vie ou le rôle de ces micro-organismes dans leur écosystème. Seule
l'hypothèse selon laquelle les DHVE2 seraient des organismes thermophiles a pu être formulée
en raison du fort pourcentage en guanine et cytosine de leur ARNr 16S (Nercessian et al., 2003).
En eet, la plupart des organismes thermophiles et hyperthermophiles présentent des ARNr 16S
dont le contenu en G et C est supérieur à 60% (Dalgaard & Garrett, 1993 ; Galtier et al., 1999).
Dans l'article précédent de ce travail de thèse (article 2), nous avions construit une banque
métagénomique à partir de l'ADN extrait d'une communauté microbienne associée à des tubes
d'A. pompejana. Cette banque avait été criblée par PCR pour rechercher les clones portant des
gènes d'ADNr 16S archaéens d'intérêt phylogénétique. Un séquençage préliminaire des ADNr
16S identiés avait révélé que 4 clones positifs de la banque avaient pour plus proches voisins
des représentants du groupe incultivé DHVE2. Deux de ces clones ont été entièrement séquencés.
Cet article présente l'organisation génétique et l'annotation de ces fragments génomiques, qui
ont permis d'assigner des fonctions à la majorité des gènes prédits.
L'objet de cette étude était également de fournir des hypothèses testables expérimentalement
pour nous éclairer sur la physiologie et/ou le métabolisme des DHVE2. Des expériences de clo-
nage et d'expression d'une ADN polymérase de la famille B (ADN polB) identiée sur l'un des
deux clones, ont été ainsi réalisées. Ces expériences ont permis de conrmer l'hypothèse selon
laquelle les DHVE2 étaient des micro-organismes thermophiles.
169
Etude 3. Introduction
Cette étude présente pour la première fois des fragments génomiques d'Archaea incultivées
fréquemment détectées lors d'inventaires moléculaires dans les habitats du pôle chaud de l'éco-
système hydrothermal. L'exploitation des données génomiques issues de cette étude ont permis
de conrmer le mode de vie thermophile de ces Archaea incultivées.
170
Etude 3. Article paru dans App. Environ. Microbiol.
1
Laboratoire de Microbiologie des Environnements Extrêmes, UMR 6197, Centre National de la Recherche
Scientique, Ifremer & Université de Bretagne Occidentale, Institut Universitaire Européen de la Mer, 29280
Plouzané, France
2
Equipe Diversité et Evolution Microbiennes, Unité d'Ecologie, Systématique & Evolution, UMR 8079,
Centre National de la Recherche Scientique, Université de Paris-Sud, 91405 Orsay, France
Corresponding author. Present address : Christian Jeanthon, UMR 7144, Equipe Phy-
‡
toplancton Océanique, Station Biologique, Place Georges-Teissier, 29680 Rosco Cedex. Tel :
33 298 292 323 ; Fax : 33 298 292 324 ; E-mail : Christian.Jeanthon@sb-rosco.fr
171
Etude 3. Article paru dans App. Environ. Microbiol.
Abstract
Molecular phylogenetic surveys of 16S rRNA genes have revealed the exis-
tence of several lineages of uncultured archaea in deep-sea hydrothermal vents.
Here, we present a comparative analysis of two genome fragments (Alv-FOS1
and Alv-FOS4) from uncultured archaea retrieved from tubes of the hydrother-
mal polychaete Alvinella pompejana. Both clone inserts (∼40 kb) contained a 16S
rRNA gene separated from the 23S rRNA gene in the genome, a trait shared by
Methanopyrus kandleri, planktonic group II Euryarchaeota and Thermoplasma-
tales. The clones exhibited 98% similarity in their 16S rRNA gene sequences and
contained a co-linear region over 16.6 kb. A signicant fraction of genes encoded
proteins involved in housekeeping functions. Most phylogenetic reconstructions
with orthologs predicted on a single or both genomic fragments supported the
aliation of the DHVE2 lineage as a sister group of the Thermoplasmatales as
deduced from 16S rRNA gene sequences. Other phylogenetic analyses revealed
the existence of several likely cases of horizontal gene transfer from Thermococ-
cales. The deduced amino acid sequence of a DNA polymerase gene identied in
Alv-FOS1 shared high similarity with those of the archaeal family B DNA poly-
merases. When expressed in Escherichia coli, this protein exhibited an optimal
activity and a thermostability comparable to that of the thermophilic archaeon
Thermoplasma acidophilum, its most closely related homolog. The partial bio-
chemical characterization of this protein therefore substantiated the prediction
that organisms belonging to the DHVE2 lineage are adapted to high tempera-
tures. These results provide the rst genomic insight into the mode of life of an
uncharacterized group of archaea that may have a signicant ecological role in
hydrothermal high-temperature habitats.
172
Etude 3. Article paru dans App. Environ. Microbiol.
1 Introduction
Molecular phylogenetic surveys of microbial communities in deep-sea hydrothermal vents
have recently revealed the existence of archaeal lineages that were unanticipated from classical
microbiological methods. These organisms form several monophyletic lineages and cluster, for
most of them, within the Deep-sea Hydrothermal Vent Euryarchaeota (DHVE) groups I and II
dened by Takai and Horikoshi (56). The molecular methods based on 16S rRNA or functional
gene analyses have provided extensive information about the presence of archaeal taxa and
species in diverse habitats of this extreme environment (29, 39, 56). However, these data
(basically phylogenetic) generally provide limited information about the physiology, the mode
of life, and the role of the organisms within the communities.
Several molecular techniques have been developed in order to overcome these limitations.
Instead of cataloguing single genes, the capture of large environmental DNA fragments from
naturally occurring microbial assemblages has recently been developed to explore the physio-
logical potential of uncultured microorganisms and is now becoming a common method to
characterize microbial communities. The rst discoveries in diverse organisms and habitats
and the potential applications of microbial community genomics have been nicely covered by
recent reviews (1, 12, 14, 19, 26, 34, 52). Sequence analysis can be guided by the identica-
tion of phylogenetic relevant marker genes in order to link the genomic fragment to specic
taxa. As often nothing but the 16S rRNA gene sequences of novel lineages are known, they
have been generally used as phylogenetic anchors to identify genome fragments from complex
environmental libraries.
The analyses of large genomic fragments of uncultured microorganisms have provided the
basis for functional studies, including the monitoring of protein activities in the environment
(4, 5) and the biochemical characterization of proteins after expression in Escherichia coli (4,
53). They also have provided new insights into population ecology, evolutionary processes such
as lateral gene transfer (LGT) events, and microbial interactions (4, 6-7, 33, 36, 51, 61).
In an eort to get a more comprehensive view of uncultured archaea from deep-sea hydro-
thermal vents, we recently constructed a fosmid library from microbial assemblages associated
to the tubes of the alvinellid polychaete Alvinella pompejana (37). A. pompejana colonizes
the walls of black smokers on the East Pacic Rise and is considered to be one of the most
thermotolerant metazoans known (16). Six archaeal 16S rRNA-containing fosmid clones were
detected within the fosmid library. We have described the genomic fragment of a new lineage
related to members of DHVE group II (37). Based on the analysis of their 16S rRNA gene se-
quences, four clones shared more than 97% sequence identity and were ascribed to the DHVE2
lineage within the DHVE group I. Phylogenetic surveys indicated that members of this lineage
are widespread in submarine hydrothermal systems since they have been detected in samples
from the East Pacic Rise, the Juan de Fuca Ridge, the western Pacic, the Indian Ocean, and
173
Etude 3. Article paru dans App. Environ. Microbiol.
the Mid-Atlantic ridge (28-29, 40-41, 46, 56-57). The distribution of this lineage is restricted
to deep-sea vents and limited to the hottest parts of these habitats. No successful attempts at
cultivation and characterization of these microorganisms (41) have been reported until now.
In this study, we analyzed the sequences of two genomic fragments from representatives
of the DHVE2 lineage and compared their gene organization. These clones contained a co-
linear region over 16.6 kb and a signicant fraction of genes encoding proteins involved in
housekeeping functions. Phylogenetic analyses of individual genes suggest the existence of ho-
rizontal gene transfers between archaeal kingdoms and between both prokaryotic domains. A
DNA polymerase gene identied in one genome fragment was cloned and expressed in Esche-
richia coli. The optimal activity temperature of the DNA polymerase and its thermostability
174
Etude 3. Article paru dans App. Environ. Microbiol.
quence was 11.6X for Alv-FOS1 and 11X for Alv-FOS4, respectively.
Analysis of the Alv-FOS1 and Alv-FOS4 sequences : tRNA gene, open reading
frame search and protein identication.
The sequences of Alv-FOS1 and Alv-FOS4 were annotated using the GenoAnnot module of the
program which is integrated into the GenoAnnot module and the tRNA-scan-SE 1.21 program
out using the CDS_prediction task of the GenoAnnot module with the following Markov
model parameters : 50 amino acids for the minimum ORF length, 80 as score threshold and
the genome of T. acidophilum (NC_002578) for the codon usage matrix. Predicted proteins
were classied according to the clusters of orthologous groups of proteins (COGs) database
(59). The programs TBLASTN and BLASTP were used to look for sequence similarity with
published protein sequences (2). If putative ORFs were detected in dierent reading frames,
only those that had homologs in databases (e value < e-05) were selected. In the case of
several ORFs showed no homologs, the longest was conserved. Signal peptides were predic-
services/TMHMM). Conserved domains of the predicted protein sequences were detected using
of the predicted protein sequences were performed by RPS-BLAST, using the CDART tool
(http://www.ncbi.nlm.nih.gov/Structure/lexington/lexington.cgi?cmd=rps). Compa-
Genomap/GenomapBrowser.html).
using the program ED of the MUST package (43). After removal of gaps and unambiguously
aligned positions, a total of 947 positions were used for the phylogenetic analyses. Bayesian
Markov Chain Monte Carlo analysis was carried out with MrBayes v3.0 (30), under a general
time reversible (GTR) model assuming a gamma distribution with six rate categories and a
chains for 1,000,000 generations. Trees were sampled every 100 generations. Two thousand
175
Etude 3. Article paru dans App. Environ. Microbiol.
In the case of proteins, the sequences homologous to Alv-FOS1 and Alv-FOS4 identied by
BLAST were retrieved from GenBank and aligned using CLUSTALW (60). Amino acid align-
ments were inspected manually using the ED program of the MUST package. All ambiguously
aligned regions were excluded from phylogenetic analysis. For all alignment, phylogenetic trees
were constructed using MUST. If necessary, Bayesian analyses were carried out with MrBayes
v3.0 with a mixed model of amino acid substitution and a gamma distribution with six rate
categories plus a proportion of invariable sites. The number of generations and trees sampled
were the same than as for the 16S rDNA phylogenetic Bayesian analysis. The number of amino
acid positions considered in the Bayesian analyses corresponded to 330 (DNA polymerase B,
Alv-FOS1 ORF16), 399 (permease of the major facilitator superfamily, Alv-FOS4 ORF10),
273 (subunit A of topoisomerase VI, Alv-FOS4 ORF34), and 260 (aspartate/tyrosine/aromatic
aminotransferase Alv-FOS1 ORF35, Alv-FOS4 ORF22).
(i) Buers.
The following buers were used in the course of the Alv-FOS1 DNA polymerase purication :
Buer A : 50 mM Tris-HCl [pH 8], 2 mM β -mercaptoethanol and a complete protease
inhibitor cocktail tablet (Roche).
Buer B : 50 mM Tris-HCl [pH 8.8], 1 mM DTT.
Buer C : 50 mM Tris-HCl [pH 8.8], 1 mM DTT, 1M NaCl.
Buer D : 50 mM Tris-HCl [pH 8.8], 1 mM DTT, 0.1M NaCl.
Buer E : 50 mM Tris-HCl [pH 7.7], 1 mM DTT.
176
Etude 3. Article paru dans App. Environ. Microbiol.
177
Etude 3. Article paru dans App. Environ. Microbiol.
µM [methyl, 1',2'-3 H]-Thymidine 5'-triphosphate, ammonium salt ([3 H]-dTTP, 119 Ci/mmol,
Amersham Biosciences), 200 µM of each four deoxynucleotide triphosphate (dNTP, Q-Biogene)
and 4 µg of activated calf thymus DNA (Sigma-Aldrich). The Pyrococcus abyssi polymerase
D incubation buer containing 20 mM Bis-Tris-HCl [pH 6.5], 10 mM MgCl2 , 1 mM DTT, 0.4
mg/ml BSA was also tested as alternative incubation buer as described by Henneke et al.
(27).
The assay mixture (20 µl) was incubated at 50o C for 20 min with 1.4 pmol of Alv-FOS1 po-
lymerase and the reaction was stopped on ice. DNA products were precipitated with 10% (w/v)
TCA and insoluble radioactive material was determined by scintillation counting. Controls
were made in the absence of enzyme.
To determine its optimal temperature and thermostability, the Alv-FOS1 polymerase was
diluted ten-fold into the Isis DNA polymerase incubation buer and the reactions were per-
formed in the mixture described above. The optimal temperature was determined by carrying
out the polymerase reactions for 20 min from 40o C to 80o C. For thermostability, 1.4 pmol of
Alv-FOS1 polymerase was pre-incubated alone for 30 min at temperatures ranging from 4o C
to 90o C. The pre-incubated polymerase was added to the assay buer (20 µl) containing the
appropriated concentrations of substrates as outlined above and the reaction was carried out
for 20 min at 65o C. The thermostability of Alv-FOS1 DNA polymerase was compared to that
of the Klenow fragment of E. coli DNA polymerase I and the Taq and Isis DNA polymerases
that were assayed in their respective buers (Q-Biogene). One unit of DNA polymerase was
dened as the amount of enzyme catalysing the incorporation of 1 nmol of dNTP into acid-
insoluble product.
The sequences of fosmids Alv-FOS1 and Alv-FOS4 have been deposited at GenBank under
accession DQ118403 and DQ118404, respectively.
178
Etude 3. Article paru dans App. Environ. Microbiol.
The inserts of clones Alv-FOS1 and Alv-FOS4 comprised 40,482 bp and 41,331 bp, respectively.
In both genome fragments, neither 23S nor 5S rRNA genes but a Met-tRNA gene were present
in the immediate surroundings of the 16S rRNA gene. In archaea, rRNA genes are generally
organized in operons or at least exhibit a 16S + 23S gene arrangement. The situation found in
the DHVE2 genome fragments is not common but similar to that observed in the genomes of
Thermoplasmatales and Methanopyrus kandleri, a methanogenic hyperthermophile, and in two
179
Etude 3. Article paru dans App. Environ. Microbiol.
Euryarchaeota
1 pISA35 (AB019748)
.91 pISA18 (AB019749)
.98 pISA13 (AB019756)
pMC1A4 (AB019754)
VC2.1 Arc6 (AF068817)
pMC2A33 (AB019738)
.87 1 pMC2A203 (AB019737)
1 WCHD3-02 (AF050616)
1 vadinCA11 (U81778)
1
pMC2A24 (AB019736)
Thermoplasma acidophilum (M38637)
1 Picrophilus oshimae (X84901)
1 Ferroplasma acidiphilum (AJ224936)
1 G26_C56 (AF356635)
pISA12 (AB019741)
1
.97pISA42 (AB019742)
pSSMCA108 (AB019740)
VC2.1Arc13 (AF068820)
1
1 Alv-FOS1 (DQ118403)
pEPR193 (AF526965) DHVE2
FT17A09 (AY251065)
1 1
Alv-FOS3 (DQ082976)
1 met21 (DQ082953)
.97
Alv-FOS2 (DQ082975)
0.1 1 Alv-FOS4 (DQ118404)
1 met24 (DQ081954)
Fig 1. Baysesian phylogenetic tree of DHVE2 16S rRNA gene sequences retrieved from A. pompejana tubes. The
16S rDNA gene sequences derived from the PCR-based libraries (37) are in boldface and those identied in the
fosmid library are in boldface and shaded in grey. Accession numbers of sequences retrieved from GenBank are
given between brackets. 947 unambiguously aligned positions were used in the analysis. Posterior probabilities
> 0.8 are indicated at nodes ; the scale bar represents the estimated number of nucleotide substitutions per site.
180
Table 1. Predicted RNA and protein coding genes, and remarkable features in the euryarchaeotal fosmid Alv-FOS1. ORFs are numbered 1-41 following the sense 5' to 3' in Fig. 2. D, direction of transcription. Shaded
ORF numbers indicate the co-linear region.
ORF Nucleotide D Protein Putative function (COG accession number if Most similar homologue Comments % G+C
range size (aa) available) (BLAST e-value <e-05)
1 <1..1453 - 484 Hypothetical conserved protein Haloarcula marismortui 1 predicted transmembrane helix and 1 predicted 51.03
AAV45993 (3e-17) signal peptide
2 1450-2448 - 332 ABC transporter involved in lipoprotein release Clostridium perfringens 5 predicted transmembrane helices. Present in 42.84
(COG4591) BAB81246 (1e-10) Bacteria and in Archaea. Missing in
Thermoplasmatales. Poorly conserved,
phylogeny not resolved
3 2494-3147 + 217 ABC transporter (COG1136) Clostridium thermocellum Present in Archaea and in Bacteria. Missing in 47.09
ZP_00313596 (2e-19) Thermoplasmatales. Phylogenetic analysis
supported an archaeal affinity with a low
bootstrap proportion
4 3137-3856 + 239 Unknown None 4 predicted transmembrane helices and 1 51.09
predicted signal peptide
5 3932-7234 + 1100 Archaeal DNA polymerase II, large subunit Thermoplasma volcanium Only present in Euryarchaeota. ORF4 and ORF5 53.69
(DP2) (COG1933) NP_110554 (0.0) form an operon-like structure shared only with
Thermoplasmatales except P. torridus
Etude 3.
6 7231-7998 + 255 GTPase (COG1100) Ferroplasma acidarmanus Present in Archaea and in Eukaryota 49.87
ZP_00306591 (5e-68)
7 8000-8539 + 179 Orotate phosphoribosyltransferase (COG0461) Thermoplasma acidophilum Distributed in the three domains 48.33
NP_393535 (4e-33)
8 8556-9725 + 389 Hypothetical conserved protein Archaeoglobus fulgidus 12 predicted transmembrane helices. Present in 54.27
NP_068866 (4e-17) Archaea and in Bacteria. Protein containing a
major facilitator superfamily PFAM domain
9 9740-9955 - 71 Unknown None 1 predicted transmembrane helix 43.52
10 10165-10383 + 72 Unknown None 43.38
11 10380-10628 + 82 Unknown No ne 48.19
12 10618-11412 + 264 NH(3)-dependent NAD+ synthetase Archaeoglobus fulgidus Present in Archaea and in Bacteria. 52.7
(COG0171H) NP_069833 (6e-51)
13 11414-11698 - 94 Hypothetical conserved protein (COG2412) Pyrococcus abyssi CAB49898 Only present in Euryarchaeota and in 43.51
(6e-19) Sulfolobales. ORF12 and ORF13 form an
operon-like structure also shared with
Thermoplasmatales and Methanosarcinales
14 11712-13760 - 682 DNA replication licensing factor MCM related Ferroplasma acidarmanus Present in Archaea and in Eukaryota. 49.59
protein (COG1241) ZP_00306098 (e-148)
15 13803-14462 - 219 Unknown None 4 predicted transmembrane helices 48.33
16 14494-16839 - 781 DNA polymerase, family B (COG0417) Picrophilus torridus YP_022906 Distributed in the three domains 50.26
(0.0)
17 17032-17988 + 318 Fe-S oxydoreductase (COG0731) Pyrococcus horikoshii Only present in Euryarchaeota and in Bacteria. 53.71
NP_142898 (e-114) In Thermoplasmatales, only present in T.
acidophilum
18 18024-18392 + 122 Unknown None 2 predicted transmembrane helices 46.61
19 18423-18701 + 92 Predicted transcriptional regulator containing an Pyrococcus furiosus NP_578339 1 predicted transmembrane helix. Only present in 48.03
181
Article paru dans App. Environ. Microbiol.
HTH domain fused to a Zn ribbon (COG3357) (1e-13) Archaea. Missing in Thermoplasmatales
182
20 18885-19733 + 282 SAM-dependent methyltransferase (COG0500) Archaeoglobus fulgidus Present in Archaea and in few Bacteria 41.58
NP_069435 (2e-17)
21 19738-22305 - 855 Valyl tRNA synthetase (COG0525) Methanocaldococcus jannaschii Distributed in the three domains 51.48
Etude 3.
NP_248001 (0.0)
22 22346-23404 - 352 Geranylgeranyl pyrophosphate synthase Thermoplasma volcanium Distributed in the three domains 50.99
(COG0142) NP_110781 (7e-67)
23 23512-24675 + 387 Pantothenate metabolism flavoprotein Archaeoglobus fulgidus Present in Archaea and in Bacteria. Phylogenetic 50.43
(COG0452) NP_070473 (3e-51) affiliation within the Euryarchaeota unclear
24 24659-25474 + 271 Predicted archaeal kinase (COG1829) Methanosarcina mazei Only present in Archaea but missing in 54.17
NP_634306 (1e-23) Thermoplasmatales; no close relatives
25 25547-26596 + 349 Unknown None 1 predicted transmembrane helix and 1 predicted 47.71
signal peptide
26 26605-26982 + 125 Unknown None 4 predicted transmembrane helices 42.59
27 26992-28389 + 465 Archaeal DNA polymerase II, small subunit Ferroplasma acidarmanus Only present in Euryarchaeaota. Affiliated to the 48.43
(DP1) (COG1311) ZP_00307183 (7e-94) Thermoplasmatales
28 28386-29369 - 327 Archaeal chlorohydrolase family protein Picrophilus torridus YP_023489 Present in prokaryotes. Affiliated to the 51.73
(COG0402) (1e-48) Thermoplasmatales (low bootstrap proportion)
29 29396-29986 - 196 Uracyl DNA glycosylase (COG1573) Pyrococcus abyssi CAB49606 Present in prokaryotes. Affiliated to the 50.25
(2e-58) Thermococcales
30 30036-30659 + 207 Thiamine phosphate pyrophosphorylase Pyrococcus furiosus NP_579063 Present in Euryarchaeota, in Bacteria and in few 54.17
(COG0352) (8e-43) Eukaryota. Affiliated to the Thermococcales
31 30616-31044 - 142 Unknown None 4 predicted transmembrane helices. 52 45.92
overlapping nucleotides with ORF18
32 31041-32126 - 361 Unknown None 1 predicted transmembrane helix and 1 predicted 44.75
signal peptide
rRNA 32210-33682 16S rRNA 60.83
Article paru dans App. Environ. Microbiol.
41 39428-40474 - 348 L-alanine-DL-glutamate epimerase and related Picrophilus torridus YP_022799 Present in Archaea and Bacteria. Very poorly 49.19
enzymes of enolase superfamily (COG4948) (9e-61) conserved protein; unclear phylogeny
Etude 3.
183
Article paru dans App. Environ. Microbiol.
184
Table 2. Predicted RNA, protein coding genes, and remarkable features in the euryarchaeotal fosmid Alv-FOS4. ORFs are numbered 1-44
following the sense 5' to 3' in Fig. 2. D, direction of transcription. Shaded ORF numbers indicate the co-linear region.
Etude 3.
ORF Nucleotide range D Protein Putative function Most similar homologue (BLAST e-value <e-05) Comments % G+C
size (aa) (COG accession if available)
1 40-195 + 51 Unknown None 47.44
2 232-966 + 244 Predicted archaeal kinase (COG1608) Thermoplasma acidophilum NP_393581 (1e-37) Distributed in the three domains. Operon-like structure 50.34
formed by ORFs 2-3-4 shared with Thermoplasmatales
only.
3 963-1976 + 337 Isopentenyl-diphosphate delta-isomerase, Thermoplasma acidophilum NP_393580 (4e-73) Present in Archaea and Bacteria 54.14
FMN-dependent (COG1304)
4 1967-2584 + 205 Conserved protein containing ZPR1 zinc- Methanocaldococcus jannaschii NP_247509 (7e- Only present in Archaea and Eukaryota. Poorly 49.19
finger domain (COG1779) 41) resolved phylogeny
5 2548-3225 - 225 Sugar fermentation stimulation protein Methanococcoides burtonii ZP_00349063 (1e-48) Only present in prokaryotes 52.8
(COG1489)
6 3194-3817 - 207 Hypothetical conserved protein Thermococcus kodakaraensis BAD84931 (3e-08) 6 predicted transmembrane helices. Only present in 48.72
few archaea. No homologs within Thermoplasmatales
7 3872-6862 - 996 Hypothetical conserved protein Methanococcus maripaludis NP_987932 (2e-42) 2 predicted transmembrane helices and 1 predicted 49.08
signal peptide. Composite protein containing a
peptidase C1A papain domain (IPR000668) and a
fibronectin, type III domain (IPR003961)
8 6920-8251 - 443 Phosphoribosylamine-glycine ligase Methanothermobacter thermautotrophicus Distributed in the three domains. ORF8 and ORF9 are 53.98
(COG0151) AAB85920 (e-117) arranged in tandem. This organization is only present
in Thermoplasmatales. Affiliated to the
Thermoplasmatales
9 8244-8753 - 169 Predicted transcriptional regulator Archaeoglobus fulgidus NP_070409 (6e-32) Present in Archaea and Bacteria 50.78
containing the HTH domain (COG1386)
10 8860-10314 + 484 Permeases of the major facilitator Pyrobaculum aerophilum NP_560682 (e-114) 14 predicted transmembrane helices. Present in 53.81
superfamily (COG0477) Archaea and Bacteria
11 10373-11530 + 385 Pantothenate metabolism flavoprotein Methanocaldococcus jannaschii NP_247908 (7e- Present in Archaea and Bacteria. Phylogenetic 51.9
(COG0452) 62) affiliation within the Euryarchaeota unclear
12 11514-12329 + 271 Predicted archaeal kinase (COG1829) Methanosarcina acetivorans NP_616218 (4e-21) Only present in Archaea but missing in 53.8
Article paru dans App. Environ. Microbiol.
16 15244-16230 - 328 Archaeal chlorohydrolase family protein Picrophilus torridus YP_023489 (8e-46) Present in Archaea and Bacteria. Affiliated to the 53.5
(COG0402) Thermoplasmatales (low bootstrap proportion)
17 16257-16847 - 196 Uracyl-DNA glycosylase (COG1573) Thermococcus kodakaraensis BAD86332 (e-59) Present in Archaea and Bacteria. Affiliated to the 51.95
Thermococcales
18 16896-17522 + 208 Thiamine phosphate pyrophosphorylase Pyrococcus furiosus NP_579063 (5e-48) Present in Euryarchaeota, in Bacteria, and in few 54.23
(COG0352) Eukaryota. Affiliated to the Thermococcales
19 17470-17898 - 142 Unknown None 4 predicted transmembrane helices. 52 overlapping 46.39
nucleotides with ORF18
20 17895-18980 - 361 Unknown None 1 predicted transmembrane helix (a signal peptide was 37.75
predicted in its homologue in FOS1)
rRNA 19062-20535 16S rRNA 60.79
21 20591-20818 - 75 Unknown None 44.3
22 20819-22009 + 396 Aspartate/tyrosine/aromatic Pyrococcus abyssi CAB49738 (e-113) Distributed in the three domains. Affiliated to the 49.45
aminotransferase (COG0436) Thermococcales
23 22044-22721 + 225 SSU ribosomal protein S3AE (COG1890) Thermococcus kodakaraensis BAD85443 (1-e44) Only present in Archaea and Eukaryota. Affiliated to 44.69
the Thermoplasmatales
tRNA 22736-22846 tRNAMet anticodon CAT 60.36
24 22847-23497 - 216 Uracyl phosphoribosyltransferase Pyrococcus furiosus NP_578970 (2e-72) Distributed in the three domains. Affiliated to the 50.08
(COG0035) Thermococcales; missing in Thermoplasmatales
25 23494-23892 - 132 Hypothetical conserved protein Methanothermobacter thermautotrophicus Present in Archaea and Bacteria. Missing in 48.37
(COG1833) AAB85146 (4e-17) Thermoplasmatales. Phylogeny not resolved
26 23967-25268 + 433 Metal-dependent phosphohydrolase, HD Thermococcus kodakaraensis BAD84729 (1e-83) Distributed in the three domains. Phylogenetic position 50.61
superfamily (COG1078) within the Euryarchaeaota not resolved
27 25272-26021 + 249 Hypothetical conserved protein Methanococcoides burtonii ZP_00349116 (7e-37) 2 predicted transmembrane helices. Only present in 42.93
few methanogens. Few bacterial and eukaryal
homologues. Phylogeny not resolved.
Etude 3.
28 26018-27058 - 346 L-alanine-DL-glutamate epimerase and Picrophilus torridus YP_022799 (2e-59) Only present in Archaea and Bacteria. Very poorly 52.74
related enzymes of enolase superfamily conserved protein, phylogeny unclear
(COG4948)
29 27260-27529 + 89 Unknown None 1 predicted transmembrane helix 50.74
30 27584-28564 + 326 Diphthamide synthase subunit DPH2 Methanococcoides burtonii ZP_00148013 (7e-66) Present in Archaea and Eukaryota. 50.97
(COG1736)
31 28603-30312 + 569 Unknown None 2 predicted transmembrane helices and 1 predicted 40.35
signal peptide
32 30286-31440 - 384 Aspartate aminotransferase (COG0436) Thermoplasma volcanium NP_111524 (2e-94) Distributed in the three domains 44.24
33 31738-32007 + 89 Nucleoid DNA binding protein Thermoplasma acidophilum NP_393571 (4e-21) Present in various Bacteria. Exclusively present in 49.26
(COG0776) Thermoplasmatales within the Archaea
34 32016-33104 - 362 DNA topoisomerase VI, subunit A Archaeoglobus fulgidus NP_069773 (e-125) Present in various Archaea and Eukaryota, but absent 47.66
(COG1697) in Thermoplasmatales
35 33094-34989 - 631 DNA topoisomerase VI, subunit B Methanococcoides burtonii ZP_00148378 (e-162) Present in various Archaea and Eukaryota, but absent 52.06
(COG1839) in Thermoplasmatales
36 35185-35892 + 235 Hypothetical conserved protein Thermoplasma volcanium NP_111729 (7e-20) Only present in Euryarchaeota 44.77
37 35882-36208 + 108 Unknown None 37.31
38 36205-37248 + 347 Deacetylase (COG0123) Archaeoglobus fulgidus NP_068969 (2e-41) Present in various Archaea, Eukaryota and Bacteria, 43.77
but absent in Thermoplasmatales
39 37255-37551 + 98 Unknown None 37.04
40 37562-37996 + 144 Hypothetical conserved protein Geobacter metallireducens ZP_00300493 (8e-05) Very poorly conserved protein, only one bacterial 36.32
homolog with e-value<8e-05
41 38122-38409 + 95 Unknown None 39.58
42 38394-39227 + 277 Unknown None 38.13
43 39217-40098 + 293 ATPase RecA-superfamily (COG0467) Archaeoglobus fulgidus NP_069609 (8e-30) Present in Archaea and Bacteria 43.54
44 40100-40885 261 Unknown None 40.46
185
Article paru dans App. Environ. Microbiol.
Etude 3. Article paru dans App. Environ. Microbiol.
Alv-FOS1
Alv-FOS4
Fig 2. Schematic representation of the euryarchaeal clones Alv-FOS1 and Alv-FOS4. Open reading frames
(ORFs) categorized in proteins with assigned functions (COGs), conserved hypothetical proteins, unknown
proteins and rRNAs are dierentiated as indicated in the inset. The tRNA genes are indicated by black bars.
ORF numbers of the FOS1 and FOS4 fragments refer to Tables 1 and 2, respectively. Shading between the
clones indicates homologous regions with the percentage of identities of deduced amino acid sequences.
A signicant number of ORFs (17) were predicted to represent core components of in-
formation processing systems, e.g., involved in DNA replication/conformation/repair and in
translation/transcription (47). The predicted genes belonging to this class encoded a MCM
homolog (Alv-FOS1 ORF14), a DNA polymerase of the family B (DNA polB) (Alv-FOS1
ORF16), a small (DP1) (Alv-FOS1 ORF27 and Alv-FOS4 ORF 15) and large (DP2) (Alv-
FOS1 ORF5) subunits of a DNA polymerase II (DNA pol II or family D DNA polymerase).
The putative family B DNA polymerase exhibited the six conserved motifs indicative of the
family B DNA polymerases and the tree motifs 3'-5' exonuclease motifs, suggesting that the
protein exhibits both activities (62). All putative DNA polymerases predicted in both fos-
mids had Thermoplasmatales homologs as closest relatives (Table 1 and Table 2). Whereas
all Archaea studied to date contain one or more DNA polymerases B (10), DNA polymerases
belonging to the family D were only found to exist in Euryarchaeota (24, 58). Interestingly,
the genes that were predicted to encode the small and large subunits of the family D DNA
polymerase were separated. This situation is similar in all euryarchaeotal genomes sequenced
to date, except in that of Thermococcales and of Haloferax volcanii, where the two genes were
contiguous (38, 54). A GTPase (ORF6) adjacent to the DP2 subunit was predicted in Alv-
FOS1. Comparative genome analyses revealed that this gene tandem arrangement was only
encountered in the genomes of Thermoplasmatales except P. torridus. Similarly, the gene asso-
186
Etude 3. Article paru dans App. Environ. Microbiol.
ciation formed by a hypothetical conserved protein and the MCM homolog (Alv-FOS1 ORFs
12-13) was specic to Thermoplasmatales and Methanosarcinales. Other gene clusters (ORFs
2-3-4 and ORFs 8-9) specic to Thermoplasmatales and the DHVE2 lineage were identied in
Alv-FOS4 (Table 2).
The predicted proteins involved in the DNA conformation were all identied in Alv-FOS4.
They consisted in a histone-like DNA binding protein (ORF33), two subunits of a DNA
topoisomerase VI (ORF34 and ORF35) and a histone-deacetylase (ORF38). Interestingly,
DNA topoisomerases VI are present in all archaea whose genomes have been sequenced except
in Thermoplasmatales (21).
The predicted proteins involved in the transcription or the translation included protein
S3AE which is a constituent protein of the small ribosomal subunit (Alv-FOS1 ORF36, Alv-
FOS4 ORF23), the valyl-tRNA synthetase (Alv-FOS1 ORF21), the subunit DPH2 of the
diphtamide synthase (Alv-FOS4 ORF30), and two distinct putative transcriptional regulators
containing the helix-turn-helix (HTH) domain (Alv-FOS1 ORF19 and Alv-FOS4 ORF9). The
diphtamide synthase enzyme catalyses the synthesis of the diphtamide, a posttranslationally
modied histidine residue present in the translation elongation factor 2 (35). The two putative
transcriptional regulators have no apparent sequence similarity to each other ; but both dis-
played a helix-turn-helix (HTH) domain which is a common denominator in basal and specic
transcription factors for the three domains of life (3).
A large co-linear region (∼16.6 kb) between Alv-FOS1 and Alv-FOS4 contained 18 ORFs,
the 16S rRNA- and the Met-tRNA-encoding genes (Fig. 2). The only dierence between both
gene clusters corresponded to a small protein of unknown function (ORF34 of Alv-FOS1) ab-
sent in Alv-FOS4. Five other proteins of unknown functions were also encoded by the syntenic
region. Most of them contained strong predicted transmembrane helices, suggesting that their
products were membrane-anchored. The co-linear section included genes encoding putative
proteins involved in the metabolism of coenzymes and cofactors (Alv-FOS1 ORF23 and Alv-
FOS4 ORF11 ; Alv-FOS1 ORF30 and Alv-FOS4 ORF18), nucleotides (Alv-FOS1 ORF37 and
Alv-FOS4 ORF23), amino acids (Alv-FOS1 ORF35 and Alv-FOS4 ORF 22) and nucleic acids
(Alv-FOS1 ORF39 and Alv-FOS4 ORF28) (Table 1 and Table 2). The syntenic portion also
contained an uracyl DNA glycosylase, an enzyme involved in DNA repair (50). The similari-
ties of the predicted protein sequences within the co-linear region ranged from 58% (unknown
protein encoded by Alv-FOS1 ORF26 and Alv-FOS4 ORF14) to 96% (metal-dependent phos-
phohydrolase). No synteny identical to that observed between Alv-FOS1 and Alv-FOS4 could
be identied in other genomes.
187
Etude 3. Article paru dans App. Environ. Microbiol.
transfers.
Until now, the sisterhood of the DHVE2 lineage with the Thermoplasmatales was only inferred
from phylogenetic analyses based on the 16S rRNA genes. To clarify the branching position
of the lineage and to identify possible horizontal gene transfer (HGT) events, phylogenetic
analyses were carried out using a set of well-conserved protein-coding genes predicted in Alv-
FOS1 and/or Alv-FOS4.
The putative family B DNA polymerase identied in Alv-FOS1 exhibited the highest si-
milarities with homologs from Thermoplasmatales (51-53% identity). This was conrmed by
the Bayesian phylogenetic analysis of these sequences, which showed the emergence of the
Alv-FOS1 DNA polymerase in a very well supported group (PP=1) with homologs from the
Thermoplasmatales (Fig. 3A). Within this group, the Alv-FOS1 DNA polymerase branched
with those of Thermoplasma spp. with a relative low posterior probability (PP=0.67). These
results supported the sisterhood of Alv-FOS1 with the Thermoplasmatales deduced from the
16S rRNA data. It is interesting to note that this Bayesian phylogenetic tree of family B
DNA polymerases failed to retrieve a clear division between the Crenarchaeota and the Eu-
ryarchaeota. This atypical phylogeny has been previously reported and explained by ancient
DNA topoisomerases VI were present in the last common ancestor of all archaea (21). If the
DHVE2 lineage shared a common origin with the Thermoplasmatales (as supported by above
phylogenetic analyses), this could suggest that the Thermoplasmatales have lost the genes en-
188
Etude 3. Article paru dans App. Environ. Microbiol.
A B
C D
Aeropyrum pernix (BAA81260) Streptomyces coelicolor (NP_630064)
Pyrobaculum aerophilum (AAL64061)
Methanococcoides burtonii (ZP_00148681) .93 Streptomyces cattleya (CAD18978)
1 Thermoplasma acidophilum (CAC11898)
1 Thermoplasma volcanium (BAB60004) .87 Thermobifida fusca (ZP_00292331)
Methanocaldococcus jannaschii (Q58874) 1
1 Methanococcus maripaludis (CAF30952) Thermobifida fusca (ZP_00292764)
1 1
Methanococcus voltae (AAQ91885) Nocardia farcinica (BAD58190)
1 Alv-FOS4 ORF22
1 Alv-FOS1 ORF35 Streptomyces avermitilis (NP_822553) Bacteria
.73 Thermococcus kodakaraensis (YP_183507)
1 Pyrococcus horikoshii (BAA30428) Nocardia farcinica (BAD56101)
.97 Pyrococcus furiosus (AAF65616)
Pyrococcus abyssi (NP_126507) Streptomyces avermitilis (NP_827042)
.92 Thermococcus sp. (AAG00592) 1
.89 1
Methanocaldococcus jannaschii (D64385) Streptomyces coelicolor (NP_733567)
1 Methanosarcina barkeri (ZP_00297284)
.85 Streptomyces coelicolor (NP_631400)
1 Methanosarcina mazei (AAM31498)
.91 Methanosarcina acetivorans (AAM04078)
Methanothermobacter thermautotrophicus (AAB86354) 1 .87 Corynebacterium glutamicum (BAC00327)
Methanococcoides burtonii (ZP_00148497) 1
Nocardia farcinica (BAD57841)
1 Methanosarcina barkeri (ZP_00296290)
.99
1 Methanosarcina acetivorans (AAM04801) Streptomyces avermitilis (NP_822308)
1 .98 Methanosarcina mazei (AAM32064)
Haloarcula marismortui (YP_138095) Thermobifida fusca (ZP_00293103)
.99
1 Haloarcula marismortui (YP_137873) Euryarchaeota
1 Halobacterium salinarum (AAG19034) Sulfolobus tokodaii (BAB66030)
Methanocaldococcus jannaschii (Q60317)
1 1 Methanococcus maripaludis (CAF30628) 1 Sulfolobus solfataricus (AAK42101)
.81
Archaeoglobus fulgidus (AAB89620) 1
1 Methanococcoides burtonii (ZP_00147791) Sulfolobus solfataricus (AAK42233)
1 Methanosarcina acetivorans (AAM04358)
1 Methanosarcina barkeri (ZP_00295914) .87
Ferroplasma acidarmanus (ZP_00307039)
Methanosarcina mazei (AAM31737)
Pyrococcus horikoshii (O58489)
1 Ferroplasma acidarmanus (ZP_00306890)
1
Pyrococcus abyssi (NP_126966)
1 Picrophilus torridus (AAT43944)
Pyrococcus furiosus (AAL80646) 1
.91 Thermococcus kodakaraensis (YP_184681)
.89
Thermoplasma volcanium (BAB59659)
Pyrococcus horikoshii (BAA30477)
.92 Pyrococcus abyssi (Q9V0L2) 1
Thermoplasma acidophilum (CAC12190)
1 Pyrococcus furiosus (AAL81377)
Thermococcus kodakaraensis (YP_182961) Picrophilus torridus (AAT42747)
Methanococcoides burtonii (ZP_00149400)
1 Methanosarcina barkeri (ZP_00296070) .93 Sulfolobus solfataricus (AAK43230)
1 Methanosarcina acetivorans (AAM05225)
1 .98 Methanosarcina mazei (AAM29939) .80 Sulfolobus solfataricus (AAK41756)
Archaeoglobus fulgidus (AAB89121) 1
.98 Halobacterium salinarum (AAG19132) Sulfolobus tokodaii (BAB67717)
1
1 Haloarcula marismortui (YP_136067)
Ferroplasma acidarmanus (ZP_00306002) Aeropyrum pernix (BAA78940)
1 Picrophilus torridus (AAT43694)
1 Pyrobaculum aerophilum (AAL64864)
Thermoplasma acidophilum (NP_394004)
.99 Thermoplasma volcanium (BAB60176) 1
Alv-FOS4 ORF10
Sulfolobus solfataricus (P14909)
0.1 1 0.1 1
Sulfolobus tokodaii (BA+B66267) Thermococcus kodakaraensis (BAD85201 BAD85200)
Crenarchaeota Euryarchaeota
Crenarchaeota
Fig 3. Phylogenetic trees of the (A) DNA polymerases B (330 amino acids), (B) subunits A of DNA topoiso-
merases VI (273 amino acids), (C) aspartate/tyrosine/aromatic aminotransferases (260 amino acids), and (D)
permeases of the major facilitator superfamily (399 amino acids). Posterior probabilities > 0.8 are indicated189
at
nodes ; the scale bar represents the estimated number of amino acid substitutions per site.
Etude 3. Article paru dans App. Environ. Microbiol.
coding DNA topoisomerases VI after their divergence from the DHVE2 lineage. Interestingly,
our Bayesian phylogenetic analysis conrmed the position of the hyperthermophilic archaeal
symbiont Nanoarchaeum equitans as sister group of Thermococcales within the Euryarchaeota
(9) with a strong support (PP=1).
Unexpected branching positions were obtained for the uracyl DNA glycosylases, uracyl
phosphoribosyltransferases, thiamine phosphate pyrophosphorylases and
aspartate/tyrosine/aromatic aminotransferases predicted in both fragments. On the basis of
BLAST and neighbor-joining analyses, these four genes were most closely related to their Ther-
mococcales homologs. Bayesian phylogenetic analyses performed on the latter gene supported
the proximity to the Thermococcales but failed to retrieve an unambiguous phylogenetic pro-
le (Fig. 3C). This was probably due to the existence of many paralogues of this gene in most
euryarchaeotal species. However, although supported by a relatively low posterior probability
(PP=0.73), the branching position of Alv-FOS1 and Alv-FOS4 close to the Thermococcales
remained consistent with the BLAST and neighbor-joining analysis. Our results suggest that
the four genes have been likely acquired from Thermococcales by HGT events. An additional
case of HGT from Thermococcales concerned the predicted permease of the major facilitator
(FOS4 ORF10). This protein is present in genomes of most crenarchaeotal species sequen-
ced to date and has only a few homologs within the Euryarchaeota (only predicted in the
Thermoplasmatales and in T. kodakaraensis ). Bayesian phylogenetic analysis supported with
high posterior probabilities the grouping of Thermoplasmatales homologs with that of Sulfo-
lobales (Fig. 3D), conrming other likely cases of HGT between the Thermoplasmatales and
the Crenarchaeota (48, 61). Our phylogenetic analysis showed that the FOS4 permease gene
clustered with that of T. kodakaraensis. As this gene is absent in other Thermococcales, this
could suggest a recent case of HGT between Alv-FOS4 and T. kodakaraensis.
To determine some biochemical properties if the Alv-FOS1 family B DNA polymerase (ORF16),
the gene was amplied by PCR and cloned into the prokaryotic expression vector pAHRS.
The DNA polymerase was produced in recombinant form in E. coli cells after IPTG induction.
The protein was puried to near homogeneity and the SDS/PAGE analysis revealed a single
band of ∼90 kDa (data not shown). This value was in accordance with the molecular mass
of 92.8 kDa derived from the amino acid sequence. The Alv-FOS1 DNA polymerase activity
was tested in the incubation buers designed for DNA polymerases B and D puried from P.
abyssi (17, 24). The incubation buer of DNA polymerase B [commercialized as Isis DNA po-
lymerase (Q-biogene)] displayed an alkaline pH and a low Mg2+ concentration. The incubation
buer of the DNA polymerase D (27) was more acidic and had a high Mg2+ concentration.
The DNA polymerase activity of the Alv-FOS1 DNA polymerase was detectable in both in-
190
Etude 3. Article paru dans App. Environ. Microbiol.
100
90
Relative activity (%)
80
70
60
50
40
30
20
10
0
0 10 20 30 40 50 60 70 80 90
Tem perature (°C)
Fig 4. Eect of the temperature on Alv-FOS1 DNA polymerase activity. FOS1 DNA polymerase (1.4 pmol)
was assayed under standard conditions for 20 min at the indicated temperature. DNA polymerase activity was
determined by measuring the incorporation of [3 H]dTTP into activated calf thymus DNA.
cubation buers (data not shown) but was higher in that supplied with Isis DNA polymerase.
Under these conditions, the DNA polymerase activity was found to be 0.3 U/ml.
The optimal temperature for the activity of Alv-FOS1 DNA polymerase and its thermostability
were compared with those of representative DNA polymerases (Klenow fragment of E. coli
DNA polymerase I, Taq and Isis DNA polymerases). The eect of elevated temperatures onto
incorporation of nucleotides was limited by the thermal stability of the calf thymus DNA. The
Alv-FOS1 DNA polymerase activity was optimal at 70o C (Fig. 4). At lower temperatures,
incorporation of nucleotides decreased slowly and 30% of the optimal activity was observed
at 40o C. At temperatures higher than 70o C, dNTP incorporation rapidly decreased, with
approximately 50% of residual activity at 80o C. The behaviour of Alv-FOS1 DNA polymerase
activity towards temperature exhibited nearly similar trends to that of several thermophiles
and hyperthermophiles (42). However, the optimal temperature of Alv-FOS1 DNA polymerase
could not be accurately determined since activated DNA was not stable above 75o C. To better
evaluate its ability to resist to elevated temperatures, we compared its thermal stability with
that of DNA polymerases from microorganisms of dierent thermal classes.
To test their thermostability, the Klenow fragment of E. coli DNA polymerase I, the
Alv-FOS1, Taq and Isis DNA polymerases B were pre-incubated for 30 min at temperatures
ranging from 4o C to 90o C and their ability to incorporate dNTPs into the DNA substrate was
tested at 65o C for 20 min. The Alv-FOS1 DNA polymerase was found to be resistant (for 30
min) to pre-incubation temperatures up to 60o C (Fig. 5). Its thermostability decreased dra-
matically at higher temperatures and the residual activities, after pre-incubation at 70o C and
191
Etude 3. Article paru dans App. Environ. Microbiol.
100
90
80
Residual activity (%)
70
60
50
40 FOS1 polB
30 Taq
20 Isis
Klenow
10
0
0 10 20 30 40 50 60 70 80 90 100
Preincubation temperature (°C)
Fig 5. Thermostability of Alv-FOS1 DNA polymerase compared with that of T. aquaticus and P. abyssi and
the Klenow fragment of E. coli DNA polymerase I. The residual DNA polymerase activity was measured for 20
80o C, were about 58% and 3%, respectively. The Alv-FOS1 DNA polymerase was much more
thermostable than that of E. coli for which no residual activity was observed after a 30-min
pre-incubation at 60o C. However, contrary to DNA polymerases puried from P. abyssi and
T. aquaticus, Alv-FOS1 DNA polymerase was almost completely inactivated after a 30-min
4 CONCLUSIONS
With molecular ecological studies that rely on the use of primers specic for the archaeal
16S rRNA gene or specic probes, the diversity and abundance of DHVE2 members have been
well documented (28-29, 40-41, 46, 56). Based on their phylogenetic diversity and ecological
distribution, members of DHVE2 lineage can be considered as likely candidates to represent
a group having a signicant impact in high-temperature hydrothermal habitats. Since they
escaped cultivation despite valuable eorts (41), their phenotypic and metabolic features were
unknown.
We initiated this study in order to provide access to genomic information for this group
192
Etude 3. Article paru dans App. Environ. Microbiol.
of archaea. Some general properties can be deduced from the genomic fragments : (i) the
separation of the 16S rRNA gene from 23S and 5S rRNA genes, (ii) a compact organization
with short intergenic sequences, (iii) a G+C content of the rRNA and tRNA genes signicantly
higher than that of the genome fragment as a whole, and (iv) phylogenetic analyses with
deduced protein sequences generally conrmed the aliation of DHVE2 members with the
Thermoplasmatales as predicted by 16S rRNA phylogeny. The identication of individual
genes and gene clusters specic to both lineages provides further insight into the relationship
of the DHVE2 lineage to the Thermoplasmatales. In contrast with these ndings, the genome
fragments analysed here also encoded proteins that have not been predicted in genomes of
Thermoplasmatales, suggesting that this group has lost genes after their divergence from the
DHVE2 lineage (e.g. the topoisomerase VI subunits). Based on 16S rRNA sequences, the two
genomic fragments were closely related with only 2% sequence divergence. Although a co-
linear region was identied, the genome fragments were not fully syntenic. The DNA regions
upstream this common section were dierent, indicating genome rearrangements. Several other
environmental genomic studies have revealed widespread microheterogeneity at the species
level (6, 51), emphasizing the possible impact of these genomic variations on the functional
diversity within very closely related organisms.
The G+C content of the rRNA and tRNA genes of both genome fragments was signicantly
higher than that of the genome fragment as a whole. This feature is common to all thermophiles
and hyperthermophiles sequenced so far. On the basis of the high G+C content of their 16S
rRNA genes, a thermophilic lifestyle had been speculated for members of the DHVE2 lineage.
The biochemical characterization of the DNA polymerase encoded by Alv-FOS1 demonstrated
that this protein has temperature requirements similar to that of its thermophilic homologs.
Therefore, our expression study substantiated the prediction that Alv-FOS1 (and most likely
its relatives of the DHVE2 lineage) are thermophiles.
By providing new insight into the evolution, mode of life and diversity of members of the
DHVE2 lineage, our study illustrates the potential of the metagenomic approach. Our analysis
identied several genes indicative of metabolic pathways. Unfortunately, these informations
were not sucient to predict precise metabolic traits that could suggest useful strategies to
elaborate culture media. Better knowledge of the environmental distribution and abundance
of DHVE2 members could provide strategies for capturing new genomic sequences of this
particular phylogenetic group and/or direct selective isolation attempts.
Acknowledgment
We are grateful to Nadine Le Bris and Françoise Gaill, chief scientist and project lea-
der of the Phare cruise for having inviting us on board. Didier Flament and Gaël Erauso
193
Etude 3. Article paru dans App. Environ. Microbiol.
are gratefully acknowledged for valuable discussions and advices. We thank the captain and
crews of `L'Atalante' and the pilots and support crew of the ROV `Victor'. We greatly ack-
nowledge Emmanuelle Morin and Patrick Durand (Irisa-Inria, Rennes) for their help in the
use of the Genostar platform. This work was nanced by the CNRS program Geomex" and
194
Etude 3. Article paru dans App. Environ. Microbiol.
Bibliographie
[1] Allen, E. E., and J. F. Baneld. 2005. Community [10] Cann, I. K., and Y. Ishino. 1999. Archaeal DNA
genomics in microbial ecology and evolution. Nature replication : identifying the pieces to solve a puzzle.
Rev. Microbiol. 3 : 489-498. Genetics 152 : 1249-1267.
[2] Altschul, S., T. Madden, A. Schaer, J. Zhang, [11] Dalgaard, J., and R. Garrett. 1993. Archaeal hy-
Z. Zhang, W. Miller, and D. Lipman. 1997. Gap- perthermophilic genes, p. 535-563. In M. Kates, D. J.
ped BLAST and PSI-BLAST : a new generation of Kushner, and A. T. Matheson (ed.), The biochemistry
protein database search programs. Nucl. Acids Res. of Archaea (Archaebacteria ). Elsevier, vol 26, Amster-
25 : 3389-3402. dam, The Netherlands.
[3] Aravind, L., V. Anantharaman, S. Balaji, M. [12] Daniel, R. 2005. The metagenomics of soil. Nature
M. Babu, and L. M. Iyer. 2005. The many faces of Rev. Microbiol. 3 : 470-478.
the helix-turn-helix domain : transcription regulation
[13] Darland, G., T. D. Brock, W. Samsono, and
and beyond. FEMS Microbiol. Rev. 29 : 231-262.
S. F. Conti. 1970. A thermophilic, acidophilic myco-
[4] Béjà, O., L. Aravind, E. V. Koonin, M. T. Su- plasma isolated from a refuse pile. Science 170 : 1416-
zuki, A. Hadd, L. P. Nguyen, S. B. Jovanovich, 1418.
C. M. Gates, R. A. Feldman, J. L. Spudich, E.
N. Spudich, and E. F. DeLong. 2000. Bacterial [14] DeLong, E. F. 2005. Microbial community genomics
rhodopsin : evidence for a new type of phototrophy in in the ocean. Nature Rev. 3 : 459-469.
the sea. Science 289 : 1902-1906. [15] De Moerlooze, L., I. Struman, A. Renard, and
[5] Béjà, O., E. N. Spudich, J. L. Spudich, M. Le- J. A. Martial. 1992. Stabilization of T7-promoter-
clerc, and E. F. DeLong. 2001. Proteorhodopsin based pARHS expression vectors using the parB locus.
phototrophy in the ocean. Nature 411 : 786-789. Gene 119 : 91-93.
[6] Béjà, O., E. V. Koonin, L. Aravind, L. T. Tay- [16] Desbruyères, D., P. Chevaldonné, A. M.
lor, H. Seitz, J. L. Stein, D. C. Bensen, R. A. Alayse, D. Jollivet, F. H. Lallier, J.-T. C., F.
Feldman, R. V. Swanson, and E. F. DeLong. Zal, P. M. Sarradin, R. Cosson, J. C. Caprais,
2002a. Comparative genomic analysis of archaeal ge- C. Arndt, J. O'Brien, J. Guezennec, S. Hour-
notypic variants in a single population and in two dez, R. Riso, F. Gaill, L. Laubier, and A. Toul-
dierent oceanic provinces. Appl. Environ. Microbiol. mond. 1998. Biology and ecology of the "Pompei
68 : 335-345. worm" (Alvinella pompejana Desbruyères and Lau-
bier), a normal dweller of an extreme deep-sea envi-
[7] Béjà, O., M. T. Suzuki, J. F. Heidelberg, W.C. ronment : a synthesis of current knowledge and recent
Nelson, C. M. Preston, T. Hamada, J. A. Ei- developments. Deep-Sea Res. II 45 : 383-422.
sen, C. M. Fraser, and E. F. DeLong. 2002b. Un-
suspected diversity among marine aerobic anoxygenic [17] Dietrich, J., P. Schmitt, M. Zieger, B. Preve,
phototrophs. Nature 415 : 630-633. J. L. Rolland, H. Chaabihi, and Y. Gueguen.
2002. PCR performance of the highly thermostable
[8] Bradford, M. M. 1976. A rapid and sensitive me-
proof-reading B-type DNA polymerase from Pyrococ-
thod for the quantitation of microgram quantities of
cus abyssi. FEMS Microbiol. Lett. 217 : 89-94.
protein utilizing the principle of protein-dye binding.
Anal. Biochem. 72 : 248-254. [18] Edgell, D. R., S-B. Malik, and W. F. Doolit-
[9] Brochier, C., S. Gribaldo, Y. Zivanovic, F. tle. 1998. Evidence of independent gene duplications
Confalonieri, and P. Forterre. 2005. Nanoar- during the evolution of archaeal and eukaryotic family
chaeota : representatives of a novel archaeal phylum
B DNA polymerases. Mol. Biol. Evol. 15 : 1207-1217.
or a fast-evolving euryarchaeal lineage related to Ther- [19] Edwards, R. A., and F. Rohwer. 2005. Viral me-
mococcales. Genome Biol. 6 : R42. tagenomics. Nature Rev. Microbiol. 3 : 504-509.
195
Etude 3. Article paru dans App. Environ. Microbiol.
[20] Futterer, O., A. Angelov, H. Liesegang, G. [31] Koski, L. B., and G. B. Golding. 2001. The closest
Gottschalk, C. Schleper, B. Schepers, C. Dock, BLAST hit is often not the nearest neighbor. J. Mol.
G. Antranikian, and W. Liebl. 2004. Genome se- Evol. 52 : 540-542.
quence of Picrophilus torridus and its implications for [32] Laemmli, U. K. 1970. Cleavage of structural pro-
life around pH 0. Proc. Natl. Acad. Sci. USA 101 : teins during the assembly of the head of bacteriophage
9091-9096. T4. Nature 227 : 680-685.
[21] Gadelle, D., J. Filee, C. Buhler, and P. For-
[33] López-García, P., C. Brochier, D. Moreira, and
terre. 2003. Phylogenomics of type II DNA topoiso-
F. Rodriguez-Valera. 2004. Comparative analysis of
merases. Bioessays 25 : 232-242.
a genome fragment of an uncultivated mesopelagic cre-
[22] Galtier, N., N. Tourasse, and M. Gouy. 1999. A narchaeote reveals multiple horizontal gene transfers.
nonhyperthermophilic common ancestor to extant life Environ. Microbiol. 6 : 19-34.
forms. Science 283 : 220-221.
[34] Lorenz, P., and J. Eck. 2005. Metagenomics and
[23] Golyshina, O. V., T. A. Piparova, G. I. Kara- industrial applications. nature Rev. Microbiol. 3 : 510-
vaiko, T. F. Kondrat'eva, E. R. B. Moore, W. 516.
R. Abraham, H. Lünsdorf, K. N. Timmis, M.
M. Yakimov, and P. N. Golyshin. 2000. Ferro- [35] Moehring, J. M., and T. J. Moehring. 1988. The
plasma acidiphilum gen. nov., sp. nov., an acidophilic, post-translational trimethylation of diphthamide stu-
autotrophic, ferrous-oxidizing, cell-wall-lacking, meso- died in vitro. J. Biol. Chem. 263 : 3840-3844.
philic member of the Ferroplasmaceae fam. nov., com- [36] Moreira, D., F. Rodriguez-Valera, and P.
prising a distinct lineage of the Archaea. Int. J. Syst. López-García. 2004. Analysis of a genome fragment
Evol. Microbiol. 50 : 997-1006. of a deep-sea uncultivated Group II euryarchaeote
[24] Gueguen, Y., J. L. Rolland, O. Lecompte, P. containing 16S rDNA, a spectinomycin-like operon
Azam, G. Le Romancer, D. Flament, J. P. and several energy metabolism genes. Environ. Micro-
Ran, and J. Dietrich. 2001. Characterization of biol. 6 : 959-969.
two DNA polymerases from the hyperthermophilic eu- [37] Moussard, H., D. Moreira, M. A. Cambon-
ryarchaeon Pyrococcus abyssi. Eur. J. Biochem. 268 : Bonavita, P. López-García, and C. Jeanthon.
5961-5969. Uncultured Archaea in a hydrothermal microbial as-
[25] Hamal, A., P. Forterre, and C. Elie. 1990. Pu- semblage : Phylogenetic diversity and characterization
rication and characterization of a DNA polymerase of a genome fragment from an euryarchaeote. FEMS
from the archaebacterium Thermoplasma acidophi- Microbiol. Ecol. 57 : 452-469.
lum. Eur. J. Biochem. 190 : 517-521. [38] Myllykallio, H., P. Lopez, P. López-García, R.
[26] Handelsman, J. 2004. Metagenomics : application Heilig, W. Saurin, Y. Zivanovic, H. Philippe,
of genomics to uncultured microorganisms. Microbiol. and P. Forterre. 2000. Bacterial mode of replication
Mol. Biol. Rev. 68 : 669-685. with eukaryotic-like machinery in a hyperthermophilic
[27] Henneke, G., D. Flament, U. Hübscher, J. archaeon. Science 288 : 2212-2215.
Quérellou, and J. P. Ran. 2005. The hyperther- [39] Nercessian, O., N. Bienvenu, D. Moreira, D.
mophilic Euryarchaeota Pyrococcus abyssi likely re- Prieur, and C. Jeanthon. 2005. Diversity of func-
quires the two DNA polymerases D and B for DNA tional genes of methanogens, methanotrophs, and sul-
replication. J. Mol. Biol. 350 : 53-64. fate reducers in deep-sea hydrothermal environments.
[28] Hoek, J., A. Banta, F. Hubler, and A.-L. Rey- Environ. Microbiol. 5 : 118-132.
senbach. 2003. Microbial diversity of a sulphide spire [40] Nercessian, O., M. Prokof'eva, A. Lebedinski,
located in the Edmond deep-sea hydrothermal vent S. L'Haridon, C. Cary, D. Prieur, and C. Jean-
eld on the Central Indian Ridge. Geobiology 1 : 119- thon. 2004. Design of 16S rRNA-targeted oligonucleo-
127. tide probes for detecting cultured and uncultured ar-
[29] Huber, J. A., D. A. Buttereld, and J. A. Ba- chaeal lineages in high-temperature environments. En-
ross. 2002. Temporal changes in archaeal diversity and viron. Microbiol. 6 : 170-182.
chemistry in a mid-ocean ridge subseaoor habitat. [41] Nercessian, O., A. L. Reysenbach, D. Prieur,
Appl. Environ. Microbiol. 68 : 1585-1594. and C. Jeanthon. 2003. Archaeal diversity associa-
[30] Huelsenbeck, J. P., and F. Ronquist. 2001. Mr- ted with in situ samplers deployed on hydrothermal
Bayes : Bayesian inference of phylogenetic trees. Bio- vents on the East Pacic Rise (13 degrees N). Envi-
informatics 17 : 754-755. ron. Microbiol. 5 : 492-502.
196
Etude 3. Article paru dans App. Environ. Microbiol.
[42] Perler, F. B., S. Kumar, and H. Kong. 1996. [54] Shen, Y., X.-F. Tang, and I. Matsui. 2003. Subu-
Thermostable DNA polymerases. Adv. Protein Chem. nit interaction and regulation of activity through ter-
48 : 377-435. minal domains of the family D DNA polymerase from
[43] Philippe, H. 1993. MUST, a computer package of Pyrococcus horikoshii. J. Biol. Chem. 278 : 21247-
[44] Ree, H. K., and R. A. Zimmermann. 1990. Or- rova, N. N. polushin, O. V. Shscherbinina, V.
ganization and expression of the 16S, 23S and 5S ri- V. Shakhova, G. I. Belova, L. Aravind, D. A.
bosomal RNA genes from the archaebacterium Ther- Natale, I. B. Rogozin, R. L. Tatusov, Y. I. Wolf,
moplasma acidophilum. Nucleic Acids Res. 18 : 4471- K. O. Stetter, A. G.Malykh, E. V.Koonin, and
197
Etude 3. Article paru dans App. Environ. Microbiol.
198
Etude 3. Résultats complémentaires
Nous disposons de résultats complémentaires pour cette étude. Ces résultats complémentaires
sont présentés dans les paragraphes suivants.
Tableau 1 Nombre de gènes prédits chez Alv-FOS1 et Alv-FOS4 par les diérents programmes utilisés.
Nous avons préféré poursuivre l'étude en utilisant les résultats du programme qui prédisait
le plus grand nombre de gènes, à savoir le programme proposé par Genostar.
An de préciser les positions des sites bordant les CDS (positions prédites par Genostar),
ce qui revient entre autre à identier le vrai codon d'initiation, nous avons fait une recherche
manuelle des signaux de régulation de l'expression des gènes, à savoir ceux de la région promotrice
de la transcription, ainsi que les sites de xation du ribosome (RBS).
199
Etude 3. Résultats complémentaires
Pourcentage de boîtes TATA (%)
35
30
25
20
15 Alv-Fos1
10 Alv-Fos4
5
0
22
24
26
28
30
32
34
36
38
40
42
Distance entre les boîtesTATA et les codons
d'initiation prédits (en nucléotides)
Fig. 1 Distribution des distances entre les boîtes TATA et les codons d'initiation de la traduction prédits.
Les plus proches représentants cultivés de Alv-FOS1 et Alv-FOS4 sont aliés aux Euryar-
chaeota. D'après la gure 7 du chapitre 1 de l'introduction de ce manuscrit de thèse, la séquence
consensus de la boîte TATA des Euryarchaeota (consensus des halophiles, méthanogènes et Py-
rococcus ) est la suivante : YTWWWW où Y=(C ou T) et W=(A ou T). Cette séquence est
généralement localisée de -25 à -32 nucléotides en amont du +1 de la transcription.
La recherche manuelle de la boîte TATA a été eectuée sur l'ensemble des gènes prédits par
Genostar. Environ la moitié des boîtes TATA identiées chez Alv-FOS1 et Alv-FOS4, correspon-
dait à la séquence consensus recherchée. La plupart des autres boîtes TATA ne s'éloignait de la
séquence consensus que d'un seul nucléotide (T du consensus remplacé par un A). Une certaine
exibilité de la distance entre la boîte TATA et le codon initiateur présumé de la traduction a
été observée (Fig. 1). Cependant la majorité des boites TATA était localisée entre les positions
-25 et -32. Une étude récente portant sur l'étude de la position des motifs nucléiques conservés
de T. acidophilum et T. volcanium, a montré que pour ces génomes, les boîtes TATA étaient
centrées aux positions -26 / -27 (Torarinsson et al., 2005).
Des séquences riches en A et G pouvant correspondre au BRE ont été identiées en amont
(-3 à -6 nucléotides) de la plupart des boîtes TATA identiées (voir 5.2.1 du chapitre 1 de
l'introduction).
200
Etude 3. Résultats complémentaires
L'algorithme de RBSnder utilise cette propriété essentielle des gènes pour localiser le RBS.
Le programme travaille sur les 50 nucléotides précédant le codon initiateur de la traduction
par recherche du consensus du RBS (AGGAGG). Les RBS correspondant au consensus étaient
souvent prédits à plus de 20 nucléotides en amont du codon initiateur. Comme les RBS de M.
jannaschii, l'organisme cultivé le plus proche de Alv-Fos 1 et Alv-Fos4 sur la base de l'ARNr
16S, sont localisés pour la plupart aux positions -3 à -7 du codon d'initiation de la traduction
(Hayes & Borodovsky, 1998), nous avons préféré rechercher manuellement les RBS. Pour cela,
nous avons utilisé le consensus du RBS de M. jannaschii DRDGD (D = A ou G ou T et R = A
ou G).
La plupart des RBS identiés étaient localisés conformément aux résultats de Hayes & Bo-
rodovsky (1998).
201
Etude 3. Résultats complémentaires
quence.
D'une manière générale, les motifs polymérases et exonucléases des ADN polB d'Archaea sont
très bien conservés, tandis que les régions séparant ces motifs le sont beaucoup moins (Schleper
et al., 1997b). Il est de ce fait important de noter, que l'ADN polB d'Alv-FOS1 s'alignait très bien
avec ses homologues Thermoplasmatales, sans l'introduction d'importants gaps ou insertions.
202
Etude 3. Résultats complémentaires
Alv-FOS1 129 140 150 160 170 180 190 200 210 220 230 240 256
DFDLGSSVRFEGDYIPPEK--YHVDIAMNLKNIRTISDFKPPLKILSFDIENSITDG------TLFTIGYAVWDGTTTRTGH--------ITGEEREMLEEFVSLIIREDPDVLTGYNIDGYDLEVLS
P. torridus DFDLGSSLEIEGDELDDERINYSTDHVIKIKNIKNTEAFNPDLKILSFDVENSIKTK------EIYVIGYAIYFNNKIETGS--------ITGTEHEILKKFNELIINNDPDIITGYNIDGYDLPLIE
T. acidophilum DLDLGSCVKIIGENISDRETSFTTDIVIRADRIENVNDFNPNLKVLSFDVENEINRENVEDYGKILVIGYSVSFQGKTVTGS--------LSGEEQDILRSFVDLIRAEDPDVITGYNIDGYDIPVIK
T. volcanium DFDLGACVRITGEDISGTEGNFTTDLVLKIDKIENIPDFNVNLKVLSFDVENEINRENVEDYGKILVIGYSIMFGDIQKKGE--------IHGDEKEILYRFIDLIRAEDPDVITGYNIDGYDMLVIQ
F. acidarmanus DFDLGSTVEIEGEPAEGEKGNYTTDLVIKINTVKKTDDFNPQLKIFSFDIENSISTR------EIFVIGYSVFFNGEITEGA--------LTGTEPEMLEDFNKLVQREDPDIITGYNIDGYDMPLLE
P. furiosus DKGL---IPMEGE------------------E---------ELKILAFDIETLYHEGEEFGKGPIIMISYADENEAKVITWKNIDLPYVEVVSSEREMIKRFLRIIREKDPDIIVTYNGDSFDFPYLA
Exo III
Alv-FOS1 257 270 280 290 300 310 320 330 340 350 360 370 384
KKYAEHNIEFRIGRDGGKP---QRIGGQFWRVHGRVIEDAWWAVKKELRPKQETLEAVAQQLLGEGKMGVNSQKIDEEWKKDR--ENVIKYCIKDAELALRILIKIGIVDKYLDLAIVTRFPLDDVIH
P. torridus ERMKYNNIKFGIGRDHLPP---KRILDQYWRLHGRVVSDAWWAVKKVVKPKHETLNYVARLLLNDEKENIDRINIESEWEAKK--EDVIKYCIKDAYLALEIYRKIRILDMNLYLSAVSKLPLDDVAN
T. acidophilum KRMDRYGIKLEIGRDGSIP---RRIMNQFWRVHGRLISDTWWSVKRILHPKHESLDYVANMLLGEGKDNIDRLHIEDEWKKRR--EEVIAYCIKDADLTLRIFEKLMVMNRLMYMSSVTKLPLDDVAN
T. volcanium RRMEQYGIHLNLGRDGSVP---RRIMDQFWRVHGRLISDTWWNVKKILHPKHESLDYIAMKLLGEGKDSIDRLNIEAEWQKRQ--DEVISYCIKDADLTLRIFEKLRVLERLMFMSTVTKLPLDDVAN
F. acidarmanus ERMKFNKVRFSIGRDYISP---RRIMDQYWRLHGRVIDDTWWEVRKVLHPKHETLNYVSNMLLNEGKEDVNRLDIENEWKNRR--DDVIKYCIKDARLALLIYRKIRILDRNLYLSTVSMLPLDDVTN
P. furiosus KRAEKLGIKLTIGRDGSEPKMQRIGDMTAVEVKGRIHFDLYHVITRTINLPTYTLEAVYEAIFGKPKEKVYADEIAKAWESGENLERVAKYSMEDAKATYELGKEF--LPMEIQLSRLVGQPLWDVSR
K
Pol II Pol VI
Alv-FOS1 385 390 400 410 420 430 440 450 460 470 480 490 500 512
SGTSTWVDSLLIREADRRGIGVPLQGQE-----RKRGKIVGGYVHTLEPGLYHWICVLDFKSMYPSIIIKYNICFTTLTDEG----GFESPIGVHFMRPEQREGIIPKILRELMEKRDALKKKMRTAK
P. torridus GGTSTYVDSILIREADKQNIAVPMSAHD-----FKEESFEGGYVHSIGAGLYDMVIVLDFKSMYPSMIIKYNICFTTLNRNG----TIVAPNGARFLSPDIKKGLIPSMLESLMKDRDNIKKQMKSSS
T. acidophilum VGTSNYVDSILIRAADRENIGVPMNQHE-----IKTEEIQGGYVHSIGAGLYSNVIVLDFKSMYPSMIIKYNVCFTTLDPNG----EILSPNGVRFLSPEKKKGLIPRILQELMADRDEVKRRMKAAK
T. volcanium AGTSNYVDSILIRAADRENIGVPMNAHN-----LKEDEIQGGYVHTIGAGLYSNVIVLDFKSMYPSMIIKYNVCFTTLDPKG----EIVSPTGIRFLSPEKKKGLIPRILQELMADRDDVKKRMKEAK
F. acidarmanus GGTSTYVDSLLIRRADRENIGVPMSSSK-----FSNDTYAGGYVHTMDPGLYDMIVVLDFKSMYPSMIIKYNICFTTLSPEG----TIVAPNGARFLDPGVKKGIIPDLLEQLMKNRDEVKKQMKEDK
P. furiosus SSTGNLVEWFLLRKAYERNEVAPNKPSEEEYQRRLRESYTGGFVKEPEKGLWENIVYLDFRALYPSIIITHNVSPDTLNLEGCKNYDIAPQVGHKFCKDIP--GFIPSLLGHLLEERQKIKTKMKETQ
Alv-FOS1 513 520 530 540 550 560 570 580 590 600 610 620 630 640
TEEERNYYDGLQKAVKILMNTFYGVLASSFYRFTDPRIGASITAFARETIKKIIGMIESRD-LKVVYGDTDSIFFESPYHELDKTVKFGTEIATEISKKEQLVLEFEKVLEPFFSHGAKKRYVGKIVW
P. torridus GEE-KEYLNGLQNAIKVLMNTFYGVLGASFYRFTNPEIGGAITSLGRVTIKNIIDKLESSG-HRVIYGDTDSIFIESGKKTKEDAIKFGNELSDRISKEENLVLEFEKIMDPLFSHGAKKRYAGKVIY
T. acidophilum TKDEREFYDGIQNAIKVLMNTFYGVLASSFYRFTDHKIGSAITAFARETIKGIISTLESAH-YRVIYGDTDSVFVESGAGSAEDAIKRGKDLSERLSREQGLTLDFQMVLDPFFSHGAKKRYAGRCVY
T. volcanium SEDERLFYDGIQNAIKVLMNTFYGVLASSFYRFTDPKIGSAITAFARETIKHIIDVLESSG-HRVIYGDTDSVFVESGDVRQEDAIKTGKELSQKLSEEEGLTLDFQMVLDPFFSHGAKKRYAGKCVY
F. acidarmanus SN--HDYLDGLQAAIKVLMNTFYGVLGTSFYRFTNREISSAITAYARNTITSIIADLDKSG-NKVIYGDTDSIFIESGKKTLDEAIEYGNRLSSDISRKENLVLEFEKIMDPLFSHGAKKRYAGKIVY
P. furiosus DPIEKILLDYRQKAIKLLANSFYGYYGYAKARWYCKECAESVTAWGRKYIELVWKELEEKFGFKVLYIDTDGLYATIPGGESEEIKKKALEFVKYIN--SKLPGLLELEYEGFYKRGFFVTKKRYAVI
Pol V
Alv-FOS1 641 650 660 670 680 690 700 710 720 730 740 750 768
PDESRGKMIIRGYEIRRTDSFDLQSESQLMVFEKIMDG-DIQGAIETAKEIVEKIKRG--DVPIDKLVISRTVRDFKRYKN-PDSMANVQAARKLMARGERVFPGMKVSWIVVNARG--SRQEVEPYI
P. torridus PDSMAGEILVRGYETRRTDSFDLQSEALSKVFEYILNR-DVDGAKRYADELVTKLKNGDNSIPIEKLVISRTVKNFKSYKN-ADSMANVAAARKLIAMGETFIPGMKVSWIVTNANK--TPQEVEPYI
T. acidophilum PDDMKGEIVIKGYEVRRTDSFDLQSQALSKVIDFILNR-DIDGAIKYADDLIKKVRAGDPSIDIDSLVISRTVKDFQSYRANQESLANIRAAKKLIDMGETFVPGMKVSWIVTNGKR--TPQEVEPYI
T. volcanium PEDMKGEIIIKGYEVRRTDSFDLQSTALSKVIDFILDR-DVQGAINYADDLVKKVRNGDPSIDIESLVISRTVKDFSSYKANTDSLANIRAARKLIERGETFVPGMKVSWIVTNGKK--TPQEVEPYI
F. acidarmanus PPSSAGEILVRGYETRRTDSFDLQSEALSTVFDLILSR-DVEGAKQYAEDLVKEVATG--KIDTSKLVISRSVKNFSTYKN-AGSMANVNAAKKLIDAGETFIPGMKVSWIVTDAGK--TPQAVEPFI
P. furiosus DEE--GKVITRGLEIVRRDWSEIAKETQARVLETILKHGDVEEAVRIVKEVIQKLANY--EIPPEKLAIYEQITRPLHEYK--AIGPHVAVAKKLAAKGVKIKPGMVIGYIVLRGDGPISNRAILAEE
Fig. 2 Alignement de séquences d'ADN polB de diérentes Euryarchaeota. Les séquences ont été alignées avec
ClustalW. Les régions Pol I à Pol VI représentent les six domaines polymérases conservées des ADN polymérases
de la famille B. Les trois domaines exonucléases ( 3'-5' exonucléase) sont notés Exo I à III. Les écritures blanches
sur fond noir représentent des blocs d'acides aminés identiques. Les écritures noires sur fond gris représentent
des blocs d'acides aminés similaires. Les écritures noires sur fond blanc représentent les acides aminés qui ne
sont pas conservés.
203
Etude 3. Résultats complémentaires
204
Discussion générale
205
Discussion générale
206
Discussion générale
Au sein de l'écosystème hydrothermal marin profond se développe une faune riche et abon-
dante. Cet environnement est particulièrement dynamique. Il se caractérise par une variabilité
spatiale et temporelle très importante, qui est la conséquence du mélange du uide hydrothermal
avec l'eau de mer environnante. Ce mélange entre l'eau de mer et le uide hydrothermal crée
d'abrupts gradients physico-chimiques qui dénissent une multitude de micro-niches propices au
développement de communautés microbiennes très diversiées.
Les méthodes d'écologie microbienne, dépendantes ou non de la mise en culture des orga-
nismes, ont révélé une extraordinaire diversité microbienne au sein de cet écosystème. Cette
diversité s'exprime tant au point de vue morphologique que physiologique, génétique et métabo-
lique. La détection de nouvelles lignées génétiques pour lesquelles aucun représentant n'est cultivé
à ce jour, est courante. Le but de ce travail de thèse était de rechercher des informations sur
les micro-organismes incultivés de l'écosystème hydrothermal. Les communautés microbiennes
occupant les habitats exposés aux uides hydrothermaux étaient plus particulièrement visées.
Pour répondre à cet objectif, notre choix s'est porté sur l'utilisation de deux approches mo-
léculaires indépendantes de la mise en culture des organismes. La première, décrite dans l'étude
1, a consisté à inventorier la diversité à l'aide d'un marqueur moléculaire phylogénétique (le gène
codant pour l'ARNr 16S) et d'un marqueur fonctionnel (gène aclB ). Cette étude avait pour but
d'identier d'abord les membres de la communauté microbienne d'un biolm prélevé en milieu
hydrothermal puis d'étudier leur mode de xation du carbone. La deuxième (études 2 et 3) a
quant à elle consisté à analyser des fragments de génomes de micro-organismes incultivés par
l'approche métagénomique.
Les expériences conduites au cours de ce travail de recherche ont permis de dégager plusieurs
points qui sont discutés dans les paragraphes suivants.
207
Discussion générale
liés aux ε-Proteobacteria. Cette étude ainsi que bons nombres d'inventaires moléculaires réalisés
cette dernière décennie (Campbell et al., 2006, pour revue), ont révélé l'omniprésence, l'abon-
dance et la diversité phylogénétique des ε-Proteobacteria au sein de l'écosystème hydrothermal
marin profond. Des séquences environnementales d'ARNr 16S aliées aux ε-Proteobacteria ont
en eet été détectées dans toutes les niches écologiques proposées par Karl (1995). Elles ont ainsi
été identiées dans des tapis microbiens prélevés sur divers substrats exposés au uide hydro-
thermal (roches, cheminées, sédiments, surface d'animaux, modules de colonisation), mais ont
été également détectées parmi la microore présente sous forme libre ou associée aux particules
entraînées par le uide hydrothermal et dans la microore symbiotique des invertébrés hydro-
thermaux (Campbell et al., 2006, pour revue).
Dans ces inventaires moléculaires, on a constaté que les séquences environnementales a-
liées aux ε-Proteobacteria étaient souvent les séquences les plus représentées dans les banques de
clones d'ADNr 16S. L'hypothèse selon laquelle les ε-Proteobacteria étaient des micro-organismes
largement distribués et avaient une fonction écologique de première importance dans l'environne-
ment hydrothermal marin profond a donc été émise. Cette hypothèse n'était toutefois soutenue
que par des résultats d'expériences basées sur l'amplication par PCR. An de nous aranchir
des biais liés à l'utilisation de cette technique et de révéler l'abondance réelle de ces organismes
dans l'environnement, nous avons choisi d'utiliser la technique d'hybridation in situ. Ces dix
dernières années, des sondes nucléiques pour hybridation in situ avaient été dessinées an de
cibler spéciquement les divers groupes incultivés d'ε-Proteobacteria identiés dans des inven-
taires moléculaires réalisés sur des échantillons hydrothermaux ou non (Polz & Cavanaugh, 1995 ;
Cary et al., 1997 ; Snaidr et al., 1997 ; Longnecker & Reysenbachach, 2001 ; Engel et al., 2003).
Cependant ces sondes avaient une spécicité très étroite : elles ne couvraient que les groupes
d'ε-Proteobacteria incultivées qui avaient été détectés dans les études que nous venons de citer.
Nous avons donc mis au point une sonde nucléique pour hybridation in situ (sonde EPSI682), ci-
blant plus largement les ε-Proteobacteria. Cette sonde couplée à l'utilisation de la sonde EUB338
spécique des Bacteria nous a permis de conrmer dans notre échantillon de biolm, la pré-
dominance des ε-Proteobacteria. Elle pourra être dorénavant utilisée pour quantier et estimer
l'importance écologique des ε-Proteobacteria dans l'écosystème hydrothermal, mais également
dans d'autres environnements où elles sont également fréquemment détectées, comme les sources
d'eau riches en sulfures, les gisements de pétrole, les eaux souterraines contaminées ou non par
des hydrocarbures et les grottes calcaires (Campbell et al., 2006, pour revue).
Seules les techniques moléculaires indépendantes des méthodes de culture ont pendant long-
temps permis de mettre en évidence les ε-Proteobacteria dans l'écosystème hydrothermal marin
profond. Ce n'est que récemment, que les premières espèces d'ε-Proteobacteria provenant de cet
environnement, ont pu être isolées et caractérisées (Fig. 1). Ces souches ont été isolées et carac-
208
Discussion générale
Isolat/association Lieu d’isolement Température Métabolisme Donneur Accepteur Réduction nitrate Ref.
phylogénétique de croissance du carbone d’électron d’électron ou soufre en:
Ordre Nautiliales, Famille Nautiliaceae
Nautilia lithotrophica Tube d’Alvinella 53°C Mixotrophe H2 , formate Sulphite, H2S Miroshnichenko et al., 2002
pompejana, 13˚N EPR soufre élémentaire
Nautilia sp. str. Am-H Tube d’Alvinella 45°C Mixotrophe H2 , formate Soufre élémentaire H 2S Campbell et al., 2001
pompejana, 13˚N EPR
Caminibacter Tube d’Alvinella 60°C Mixotrophe H2 ,composés Nitrate,soufre H2S/ NH 3 Alain et al., 2002
hydrogeniphilus pompejana, 13˚N EPR organiques élémentaire
complexes
Caminibacter Vent cap, Rainbow 55 ˚C Autotrophe H2 Nitrate, oxygène H2S/ NH 3 Miroshnichenko et al., 2004
profundus Field, MAR (microaérobiose)
soufre élémentaire
Caminibacter Cheminée, Rainbow 55 ˚C Autotrophe H2 Nitrate, soufre H2S/ NH 3 Voordeckers et al., 2005
mediatlanticus Field, MAR élémentaire
Lebetimonas acidiphila Colonisatteur in situ 50 ˚C Autotrophe H2 Soufre élémentaire H 2S Takai et al., 2005
TOTO, MA
Ordre incertain, Famille Hydrogenimonaceae
Hydrogenimonas Cheminée, Kairei 55 ˚C Autotrophe H2 Nitrate, oxygène H2S/ NH 3 Takai et al., 2004
thermophila Field, CIR (microaérobiose),
soufre élémentaire
Ordre incertain, Famille Nitratiruptoraceae
Nitratiruptor tergarcus Cheminée, Iheya 55 ˚C Autotrophe H2 Nitrate, oxygène H2S /N 2 Nakagawa et al., 2005
North Field, OT (microaérobiose),
soufre élémentaire
Ordre incertain, Famille Thioreductoraceae
Thioreductor Sédiment, Iheya 32 ˚C Autotrophe H2 Nitrate, soufre H2S/ NH 3 Nakagawa et al., 2005
micantisoli North Field, OT élémentaire
Ordre Campylobacterales, Famille Campylobacteraceae
Sulfurospirillum sp. str. Alvinella 41 ˚C Hétérotrophe Formate, fumarate Soufre élémentaire H 2S Campbell et al., 2001
Am-N pompejana, 13˚N
EPR
Arcobacter sp. str. Eau de production, 30 ˚C Autotrophe H2 , formate Nitrate, oxygène H2S/NO 2– Gevertz et al., 2000
FWKO B Coleville oil field sulfure (microaérobiose),
soufre élémentaire
Ordre incertain, Famille Thiovulgaceae
Sulfurovum Sédiment, Iheya 30 ˚C Autotrophe Soufre élémentaire Nitrate, oxygène N2 Inagaki et al., 2003
lithotrophicum North Field, OT thiosulphate (microaérobiose)
Nitratifractor salsuginis Ceminée, Iheya 37 ˚C Autotrophe H2 Nitrate, oxygène N2 Nakagawa et al., 2005
North Field, OT (microaérobiose)
Sulfurimonas Sédiment, Hatoma 25˚C Autotrophe Soufre élémentaire Oxygène Inagaki et al., 2003
autotrophica Knoll, OT thiosulphate (microaérobiose)
Sulfuricurvum kujiense Eau souterraine, 25˚C Autotrophe H2 , sulfures Nitrate, oxygène NO 2– Kodama et al., 2004
Japan oil storage thiosulphate, (microaérobiose)
cavity soufre élémentaire
Thiomicrospira sp. str. Eau de production, 30 ˚C Mixotrophe Sulfures Oxygène N2, N2O Gevertz et al., 2000
CVO Coleville oil field soufre élémentaire (microaérobiose),
nitrate, nitrite
Abréivations des lieux: CIR, Central Indian Ridge; EPR, East Pacific Rise; MA, Mariana Volcanic Arc; MAR, Mid-Atlantic Ridge; OT, Okinawa Trough; TOTO, TOTO
caldera deep-sea hydrothermal field. Abréviations chimiques: H2S, hydrogen sulphide; NH3, ammonia; N2O, nitrous oxide; NO 2–, nitric oxide.
Fig. 1 Caractéristiques physiologiques des ε-Proteobacteria isolées d'habitats hydrothermaux marins profonds
et de quelques autres environnements sélectionnés (d'après Campbell et al., 2006).
térisées pendant que j'eectuais ce travail de thèse. Les espèces cultivées incluent des membres
de la famille des Nautiliaceae, des Hydrogenimonaceae , des Nitratiruptoraceae , des Thiore-
ductoraceae , des Campylobacteraceae, et des Thiovulgaceae . Les ε-Proteobacteria demeurent
cependant encore très peu représentées dans les collections de culture. Il n'y a pas de diculté
technique pour cultiver ces ε-Proteobacteria. Leur découverte si tardive peut venir du fait que
peu de gens s'étaient interessés à la culture des communautés microbiennes mésophiles et ther-
mophiles modérées avant Takai et ses collaborateurs (2003). Un eort de culture reste donc à
produire. On peut notamment optimiser des stratégie de culture reproduisant les conditions in
situ rencontrées par ces organismes, comme cela a été fait avec la mise au point d'un réacteur
spécique pour la culture de la souche Candidatus Arcobacter suldicus (Taylor et al., 1999).
209
Discussion générale
L'ensemble de ces données ajoutées à celles issues de ce travail de thèse, nous permettent de
dire que l'écosystème hydrothermal marin profond peut être considéré comme l'un des plus grands
réservoirs d'ε-Proteobacteria connu sur Terre. Au sein de cet écosystème, les ε-Proteobacteria sont
considérées comme des colonisateurs primaires et des producteurs primaires de premier ordre.
Ces deux derniers points seront discutés dans les paragraphes qui suivent.
Des mesures physico-chimiques réalisées à l'endroit où notre colonisateur in situ a été déposé
(mesures réalisées quelques jours avant notre expérience de colonisation par Alain et collabora-
teurs (2004)) ont indiqué que cette zone était caractérisée par une très forte instabilité (variations
de pH, de température et de concentration en H2 S). Ces conditions environnementales instables
sont typiques des zones de mélange se trouvant à l'interface oxique-anoxique, entre le uide hydro-
thermal et l'eau de mer. Ces habitats très instables pourraient paraître hostiles à l'établissement
de communautés microbiennes. Les conditions in situ extrêmes comme des concentrations en sul-
fure d'hydrogène qui peuvent être très élevées, doivent certainement contribuer à une sélection
drastique des micro-organismes pouvant s'y développer.
Plusieurs auteurs ont mis en avant la exibilité nutritionnelle des ε-Proteobacteria pour expli-
quer leur facilité d'adaptation aux conditions physico-chimiques uctuantes de l'environnement
hydrothermal (Nakagawa et al., 2005b ; Campbell et al., 2006). Cette versatilité nutritionnelle des
ε-Proteobacteria leur permettrait ainsi de coloniser plus facilement que d'autres micro-organismes
cet environnement très instable. Les premières souches d'ε-Proteobacteria qui ont été récem-
210
Discussion générale
ment isolées d'environnements hydrothermaux, ont en eet montré qu'elles pouvaient utiliser
une gamme très variée de donneurs d'électrons (l'hydrogène, le formate, le fumarate, les sul-
fures...) et d'accepteurs d'électrons (les sulfures, les sultes, le soufre élémentaire, les nitrates...).
De plus, la gamme de température dans laquelle ces souches sont capables de se développer
(si l'on considère les ε-Proteobacteria mésophiles et les thermophiles modérées) est relativement
large, allant de 20o C à 60o C, ce qui leur procure un avantage supplémentaire pour s'adapter à
cet environnement instable.
Il est probable que le type d'expérience que nous avons mené ne mette en évidence que les
micro-organismes capables d'attachement et de colonisation rapide. Les ε-Proteobacteria identi-
ées dans notre expérience de colonisation ont la capacité de produire rapidement de la biomasse
(dès le 3me jour de l'expérience, le biolm était déjà bien épais). Le temps de génération de
ces ε-Proteobacteria est certainement très rapide dans les conditions in situ auxquelles ont été
réalisées l'expérience, c'est-à-dire au niveau d'une interface oxique-anoxique, à des températures
modérées allant de 11C à 45C et où de fortes concentrations en H2 S sont disponibles. L'apti-
tude des ε-Proteobacteria à adhérer à un support vierge via la formation d'un biolm (étude 1,
Alain et al., 2004) procure certainement à ces organismes un avantage pour la colonisation de cet
environnement dynamique et extrême. Il a en eet été suggéré que la formation de biolm pou-
vait être un avantage pour certains micro-organismes : ces derniers pourraient être protégés de
conditions environnementales non favorables, et facilement bénécier d'échanges de nutriments
et de matériels génétiques (La Paglia & Hartzell, 1997 ; Davey & O'Toole, 2000).
Il est intéressant de noter que lors d'une expérience de colonisation menée par Alain et
ses collaborateurs (2004), expérience réalisée quelques jours avant la notre et sur le même site
hydrothermal, les micro-organismes identiés dans cette étude n'étaient pas les mêmes que ceux
que nous avons identiés dans la notre. L'originalité des séquences d'ε-Proteobacteria que nous
avons obtenues dans notre étude est discutée dans la paragraphe suivant.
211
Discussion générale
(groupe qui inclut deux souches caractérisées : Sulfurovum lithotrophicum et Nitratifractor salsu-
ginis ) et du groupe B (incluant les souches du genre Sulfurimonas ) représentaient les phylotypes
les plus fréquemment détectés dans les banques de clones d'ADNr 16S.
Les micro-organismes du genre Arcobacter gurent parmi les principaux groupes de bacté-
ries responsables d'entérites, de mammites et de bactériémies chez les humains et les animaux
(http://www.bacterio.cict.fr/bacdico/aa/arcobacter.html). Les espèces animales, notam-
ment les volailles, ainsi que l'eau, seraient les principales sources de contamination. Outre les es-
pèces d'Arcobacter isolées du milieu médical, quelques séquences environnementales Arcobacter
ont également été mises en évidence, notamment dans de l'eau de mer, des boues activées, de
l'eau d'égouts, de l'eau de rivière et dans de l'eau de boisson non chlorée.
Malgré les attentions portées envers les souches pathogènes, les Arcobacter ont été peu ca-
ractérisés, tant au niveau de leur métabolisme, que de leur taxonomie et de leur écologie. Leur
mode de vie et le type d'habitat que ces bactéries peuvent coloniser n'ont pas été étudiés en
détail (Campbell et al., 2006). C'est d'ailleurs essentiellement dans le cadre d'études médicales,
et à l'aide de tests bactériologiques, que ces bactéries du genre Arcobacter ont été identiées.
Les espèces qui ont été caractérisées ont des optima de croissance à température ambiante et
semblent préférer des conditions de microaérophilie pour se développer. Au sein de l'écosystème
hydrothermal marin profond, aucune souche du genre Arcobacter n'a été à notre connaissance
isolée et caractérisée à ce jour. De plus, très peu d'inventaires moléculaires réalisés dans cet éco-
système, relatent la présence de séquences environnementales aliées à ce genre.
Parmi les souches du genre Arcobacter à avoir été caractérisées, la souche Candidatus Arco-
bacter suldicus (Wirsen et al., 2002) requiert notre attention. Cette souche marine n'a pas été
isolée de l'environnement hydrothermal marin profond. Cependant, sa morphologie ainsi que les
laments de soufre qu'elle excrète, sont identiques à ceux de micro-organismes hydrothermaux
qui ont été observés dans des oculats (Taylor & Wirsen, 1997 ; Taylor et al., 1999). La souche
Candidatus Arcobacter suldicus est une bactérie mobile, chimiolithoautotrophe, mésophile.
C'est une bactérie sulfo-oxydante, microaérophile obligatoire (Wirsen et al., 2002). Dicile à
cultiver, elle nécessite une interface géochimique bien dénie entre des concentrations en oxygène
dissous et en H2 S. Un réacteur spécique qui délivre un gradient opposé en concentrations d'O2
et en H2 S, a d'ailleurs été spécialement mis au point pour sa culture (Wirsen et al., 2002). La
particularité de cette souche vis-à-vis des autres bactéries sulfo-oxydantes connues ce jour, vient
du fait qu'elle est capable de supporter des concentrations en H2 S bien plus élevées (1 à 2 mM)
que ces dernières. De plus, elle est peut se développer à des concentrations en O2 très basses (1
à 10 µM).
Lorsque les conditions environnementales lui conviennent, la souche Candidatus Arcobacter
212
Discussion générale
suldicus excrète des laments de soufre (0.5-2.0 x 20-500 µm) (Wirsen et al., 2002). La for-
mation de ces laments de soufre semble être un mécanisme d'adaptation conçu pour coloniser
ecacement des surfaces qui sont caractérisées par des concentrations très élevées en H2 S et qui
sont exposées aux ux de uides puissants (Taylor & Wirsen, 1997 ; Sievert et al., 1999 ; Taylor
et al., 1999 ; Wirsen et al., 2002). Le processus de formation de ces laments de soufre vient
d'être étudié (Sievert et al., 2006). Les hypothèses suivantes portant sur l'intérêt écologique de
ce mécanisme d'adaptation, ont été émises suite à cette étude :
la formation des laments de soufre permettrait de convertir rapidement l'H2 S en soufre
élémentaire, fonctionnant ainsi comme un mécanisme de détoxication du milieu qui permet
aux bactéries de supporter des concentrations très élevées en H2 S ;
les laments de soufre permettraient aux organismes qui les excrètent, de se maintenir
dans des micro-niches qui conviennent à leur survie et à leur développement, notamment
au sein d'une interface en oxygène/H2 S qui leur est optimale. Si on se place à l'échelle d'une
population de Candidatus Arcobacter suldicus, la structure physique fabriquée par ces
micro-organismes à partir d'un produit de dégradation de leur métabolisme (le soufre),
leur permettrait d'adhérer et de coloniser ecacement toute surface qui leur conviendrait.
Dans les environnements dynamiques sans cesse perturbés par des mouvements de uides,
ces micro-organismes capables de former des laments de soufre seraient ainsi plus adaptés
que d'autres bactéries sulfo-oxydantes incapables de former ces structures, faisant d'eux
des colonisateurs primaires.
Les diérences observées dans notre expérience et dans celle menée par Alain et ses collabora-
teurs (2004), sont certainement dues au fait que la paroi de la cheminée hydrothermale sur laquelle
a été déposé notre colonisateur in situ, a été fragilisée par le bras télé-opéré du robot Victor 6000
(voir le matériel et méthode de l'étude 1). De ce fait, les uides hydrothermaux s'échappant
de la paroi étaient plus intenses dans notre expérience, ce qui a favorisé un enrichissement de
l'habitat en sulfures. Seuls des micro-organismes capables de supporter des concentrations très
élevées en H2 S mais également capables de se développer dans un environnement dynamique
perturbé par le ux des uides (via la formation d'un biolm), pouvaient dans un premier temps
coloniser notre support. Les conditions in situ dans lesquelles notre biolm s'est formé, ainsi
que la présence de particules de soufre dans le biolm, suggèrent que les Arcobacter détectées
dans nos expériences, ont très probablement un métabolisme proche de la souche Candidatus
Arcobacter suldicus, c'est-à-dire un métabolisme lié à l'oxydation des composés soufrés réduits.
Les conditions in situ qui prévalent dans l'écosystème hydrothermal, notamment au niveau
de la zone de mélange entre le uide hydrothermal et l'eau de mer, ont sélectionné de manière très
drastique les micro-organismes susceptibles de coloniser notre support vierge. La communauté
microbienne du biolm était en eet très peu diversiée. On peut supposer que cette communauté
microbienne aurait pu évoluer en se diversiant, si l'expérience avait duré plus longtemps. La
213
Discussion générale
création de micro-niches anaérobies au sein du biolm, aurait en eet pu convenir par la suite à la
colonisation de nouveaux micro-organismes réduisant par exemple le soufre élémentaire détecté
dans le biolm, bouclant ainsi le cycle du soufre.
Après avoir identié les micro-organismes du biolm, nous avons utilisé une approche fonc-
tionnelle pour tenter d'obtenir des réponses concernant l'écophysiologie de ces micro-organismes.
Cette approche est décrite dans la partie suivante.
Les résultats de ces recherches nous ont permis de mettre en évidence la présence de gènes
aclB dans le biolm. Cependant, aucun produit d'amplication du gène oorA n'a pu être obtenu
à partir de l'ADN extrait du biolm. L'analyse de la diversité des gènes aclB a révélé que toutes
les séquences étaient aliées à des ε-Proteobacteria. Étonnamment, aucune de ces séquences
n'était apparentée aux Arcobacter. Ces micro-organismes étaient pourtant dominants dans notre
expérience de quantication par hybridation in situ. Tous les gènes aclB étaient en fait aliés
aux Nautiliaceae. Aucune séquence aliée aux Nautiliaceae n'avait pourtant pu être mise en
évidence dans les banques de clones d'ADNr 16S.
Les deux approches moléculaires qui ont été utilisées pour étudier la diversité et la fonction
des micro-organismes présents dans le biolm, ont fourni des résultats contradictoires mais des
informations complémentaires. En eet, si les Nautiliaceae n'ont pas été détectées dans les inven-
taires d'ARNr 16S, c'est probablement parce que ces micro-organismes sont minoritaires au sein
de la communauté microbienne du biolm. De plus, comme nous l'avons évoqué dans l'étude 1,
214
Discussion générale
tout fait penser que les couples d'amorces que nous avons utilisés pour amplier les gènes aclB
et oorA ne couvraient pas l'ensemble des ε-Proteobacteria. Cela expliquerait donc pourquoi nous
n'avons pas détecté de gènes aclB et oorA aliés aux Arcobacter. L'accumulation progressive
de nouvelles séquences de gènes clés intervenant dans le cycle rTCA (via le biais d'études méta-
génomiques, par exemple) permettra à l'avenir de redessiner de nouvelles amorces à couverture
plus large.
Le métabolisme du carbone et celui lié à l'utilisation de sources d'énergies, ont été récem-
ment testés chez plusieurs isolats d'ε-Proteobacteria provenant de l'environnement hydrothermal
marin profond (Takai et al., 2005a). Des tests enzymatiques (portant sur des enzymes du cycle
de Calvin, du cycle rTCA, et des enzymes intervenant dans l'utilisation de l'hydrogène et des
sultes comme source d'énergie) réalisés en parallèle avec des tests génétiques (via l'utilisation
de marqueurs fonctionnels ciblant les cycles du carbone, mais aussi d'un marqueur fonctionnel
ciblant l'opéron hyn qui intervient dans l'utilisation de l'hydrogène comme source d'énergie) ont
permis d'aller plus loin dans la caractérisation fonctionnelle des ε-Proteobacteria. Cette étude
montre l'utilité d'utiliser des outils moléculaires pour élucider la fonction et le rôle écophysiolo-
gique des ε-Proteobacteria hydrothermales. Notons, qu'à l'heure actuelle, deux ε-Proteobacteria
isolées en milieu hydrothermal marin profond, ont été sélectionnées pour un séquençage complet
de leur génome. Les souches choisies sont Caminibacter mediatlanticus et Nautilia sp AmH. La
souche Candidatus Arcobacter suldicus a elle aussi été sélectionnée pour séquençage de son
génome (source http://www.genomesonline.org/). L'accès à ces génomes ouvrira certainement
de nouvelles portes pour la compréhension des ε-Proteobacteria
Pour aller plus loin dans l'étude des micro-organismes incultivés de l'écosystème hydrother-
mal, nous avons opté pour une autre approche qui n'avait jamais été expérimentée dans le
laboratoire où j'ai eectué ma thèse. Cette approche nous a permis d'accéder à des fragments de
génomes appartenant à des micro-organismes incultivés, et ce, sans avoir à les cultiver.
215
Discussion générale
216
Discussion générale
L'inventaire moléculaire que nous avons réalisé sur l'ADN extrait de la communauté micro-
bienne associée à ces tubes, a révélé plus de la moitié des séquences d'Archaea étaient aliées à
des lignées incultivées (étude 2). Cet ADN a donc été préférentiellement utilisé pour une analyse
visant à étudier l'information génomique des organismes incultivés. Plus de 5000 clones ayant
des inserts d'environ 40 kpb ont été obtenus dans la banque métagénomique construite à partir
de cet ADN. Cette banque a été criblée par PCR an d'identier les clones porteurs de séquences
d'ARNr 16S et 18S. Les articles 2 et 3 de ce manuscrit de thèse exposent l'analyse de la séquence
génomique de trois clones (Alv-FOS1, Alv-FOS4 et Alv-FOS5) porteurs de séquences d'ARNr
16S d'Archaea aliés aux DHVE.
217
Discussion générale
mésappariements - cinq - avec l'une des deux amorces spéciques du domaine des Archaea que
nous avions utilisées. Nous avons eu la chance de découvrir, avec des amorces spéciques des
Eucarya, cette nouvelle lignée phylogénétique au sein des DHVE. Cependant, nous aurions pu
potentiellement détecter ce nouvel organisme par un séquençage total ou partiel de notre banque
métagénomique. Etant donné qu'a priori, tout fragment d'ADN génomique d'un métagénome
donné peut être cloné puis séquencé, les données issues de la métagénomique laissent présager
la détection de nouvelles séquences qui, s'ajoutant à celles déjà répertoriées, vont permettre
d'aner la spécicité et la couverture phylogénétique des sondes et des amorces PCR.
2.5 Proposition du mode de vie thermophile pour les membres d'une lignée
d'organismes incultivés endémiques des sources hydrothermales marines
profondes
L'étude 3 a été l'occasion par le biais de l'approche métagénomique, de nous fournir une
hypothèse testable expérimentalement pour nous éclairer sur la physiologie d'une lignée d'or-
ganismes incultivés fréquemment identiée dans l'écosystème hydrothermal. Le criblage de la
banque métagénomique construite dans le cadre de cette thèse à révélé que quatre fosmides
contenaient une séquence d'ARNr 16S aliés aux DHVE2, deux d'entre eux ont été entière-
ment séquencés, les fosmides Alv-FOS1 et Alv-FOS4. La lignée des DHVE2 a été identiée la
première fois par Takai et Horikoshi (1999). Depuis, des micro-organismes incultivés aliés aux
DHVE2 ont été identiés dans tous les système hydrothermaux marins profonds étudiés à ce
jour (voir par exemple, Takai & Horikoshi, 1999 ; Reysenbach et al., 2000 ; Nercessian et al.,
2003 ; Hoek et al., 2003 ; Nakagawa et al., 2006 ; Takai et al., 2001a). Ils sont d'ailleurs abondam-
ment représentés dans les banques de clones réalisées sur les échantillons hydrothermaux (Fig. 2).
Le pourcentage en guanine et cytosine contenu dans leurs ARNr 16S (> 60%, valeur propre
aux micro-organismes thermophiles), ainsi que leur identication dans des échantillons conte-
nant également des hyperthermophiles de l'ordre des Thermococcales, laissaient présager que les
DHVE2 étaient des organismes thermophiles, certainement hétérotrophes, ayant une croissance
stimulée par le soufre (Reysenbach & Shock, 2002 ; Takai et al., 2001a). Cependant, malgré
de nombreux eorts entrepris pour cultiver ces micro-organismes, leur présence n'a pas été dé-
tectée dans les cultures d'enrichissement réalisées à 70 o C, 80 o C et 90 o C (Nercessian et al., 2003).
A l'instar de toutes les séquences aliées aux DHVE2 répertoriées dans les banques de don-
nées, le contenu en G+C des séquences d'ARNr 16S contenues dans les fosmides Alv-FOS1 et
Alv-FOS4, était supérieur à > 60%. L'ADN polymérase recombinante issue du clonage d'un
gène présent dans l'un de ces fosmides, a conrmé de part ses propriétés de thermostabilité et
d'optimum d'activité, que les DHVE2 présentaient un mode de vie thermophile proche de ce-
lui de Thermoplasma acidophila. Les micro-organismes de l'ordre des Thermoplasmatales sont
218
Discussion générale
Axial Volcano (Juan de 46°N, 6.7 33-P127A99 AF355837 fluide Huber et al., 2002
Fuca Ridge), North 130° W hydrothermal
Pacific Ocean
Axial Volcano (Juan de 46° N, 6.1 33-P23A98 AF355840 fluide Huber et al., 2002
Fuca Ridge), North 1300 W hydrothermal
Pacific Ocean
Guaymas Basin (Sea of 27° N, 4.9 G26_C73 AF356637 cheminée Longnecker, 2001
Cortez), Pacific Ocean 1100 W hydrothermale
East Pacific Rise 9°N 9°50’N, 1.5 clone CH8_7a AY672495 cheminée Kormas et al., 2006
104°18’N hydrothermale
East Pacific Rise 13°N, 12°48’N, ND* pEPR122 AF526963 échantillon Nercessian et al., 2003
Pacific Ocean 104°W hydrothermal Nercessian et al., 2004
Myojin Knoll (Izu- 32°06’N, 33.0 pMC2A24 AB019736 cheminée Takai et Horikoshi, 1999
Ogasawara Arc), North 139°52’E hydrothermale
western Pacific Ocean
Myojin Knoll (Izu- 28°34’N, 4.8 pSSMCA108 AB019740 cheminée Takai et Horikoshi, 1999
Ogasawara Arc), North 140°38’E hydrothermale
western Pacific Ocean
Iheya Basin (Middle 27°32’.N, 29.8 pISA12 AB019741 sédiments Takai et Horikoshi, 1999
Okinawa Trough), 126°58’E hyrothermaux
Northwestern Pacific
Ocean
Pacmanus (Manus 03°43’S, 6.8-22.9 pPACMA-M AB052983 cheminée Takai et al., 2001
Basin), Western Pacific 151°40’E hydrothermale
Ocean
Snake Pit (Mid-Atlantic 23°22’ N, 4.0 VC2.1 Arc6 AF068817 échantillon Reysenbach et al., 2000
Ridge), Atlantic Ocean 44°57’W hydrothermal
Edmond Vent Field 23°S, 93.0 FT17A03 AY251064 cheminée Hoek et al., 2003
(Central Indian Ridge), 69°E hydrothermale
Indian Ocean
TOTO caldera (Mariana 12°42’N, 35.7 TOTO-A6-12 AB167486 cheminée Nagakawa et al., 2006
Volcanic Arc), Western 143°32’E hydrothermale
Pacific Ocean
Cascadia Margin-eastern 44°34’N, ND* ODP1251A15.2 AB177273 sédiments Inagaki et al., 2006
Pacific-Deep Marine 125°04’ 4 marins
Sediments, Eastern W profonds
Pacific Ocean (123-304 mbsf)
* non déterminé
Fig. 2 Etudes publiées relatant la présence de DHVE2 dans les banques de clones d'Archaea. (D'après
Reysenbach et al., 2006.)
219
Discussion générale
Etant donné que les inventaires moléculaires avaient montré que les DHVE2 étaient pré-
sentes et abondamment distribuées dans l'écosystème hydrothermal marin profond, on pouvait
envisager de les cultiver à partir d'échantillons hydrothermaux. Très récemment, le premier re-
présentant cultivé de la lignée des DHVE2 a été cultivé à partir d'un milieu permettant d'enrichir
les organismes thermoacidophiles hétérotrophes (Reysenbach et al., 2006) (Fig. 3). Cette souche
appelée Aciduliprofundum boonei est une Euryarchaeota anaérobie hétérotrophe, thermoacido-
phile, réduisant le soufre ou le fer. Ce membre de la lignée des DHVE2 peut se développer dans
une gamme de température allant de 55 o C à 75 o C, et une gamme de pH allant de 3.3 à 5.8.
Son optimum de croissance est observé à 70 o C, dans des pH allant de 4.2 à 4.8. Elle a été isolée
sur le site hydrothermal Mariner, du Bassin de Lau.
T
'Aciduliprofundum boonei' strain T469
pPACMA-Q (Manus Basin)
pSSMCA 108 (Suiyo seamount, Izu-Ogasawara arc)
VC2.1 Arc13 (Snake-Pit, Mid-Atlantic Ridge)
33-P120A99 (Juan de Fuca Ridge)
Alv-FOS4 (East Pacific Rise)
FT17A09 (Edmond, Central Indian Ridge) DHVE2
FT17A03 (Edmond, Central Indian Ridge)
pISA42 (Middle Okinawa Trough)
ODP1251A15.24 (Cascadia Margin sediments)
pMC2A10 (Myojin Knoll, Izu-Ogasawara arc)
TOTO_ISCS_A45 (TOTO caldera, Mariana Trough)
G26_C56 (Guaymas Basin)
pEPR719 (13°N-East Pacific Rise)
archaeap1 (Rotorua, Kuirau Park, New Zealand)
OPPD010 (Obsidian Pool, Yellowstone)
A10 (Norris Basin, Yellowstone)
LART667E06 (Mariner, ELSC)
AS4 (Iron mountain mine)
ARCP1-27 (coal pile)
ant b7 (Rio Tinto) Thermoplasmales
Picrophilus oshima
Ferroplasma acidophilum
Thermoplasma volcanium
Thermoplasma acidophilum
Halobacterium salinarum
Methanosarcina barkeri
Methanocaldococcus jannaschii
Methanococcus vannielii
Thermococcus hydrothermalis
Pyrococcus furiosus
Staphylothermus marinus
Fig. 3 Relations phylogénétiques entre les séquences d'ARNr 16S de la souche T469, de représentants des
DHVE2 dont Alv-FOS4 et d'Euryarchaeota. (D'après Reysenbach et al., 2006) (voir cette référence pour les
détails de la méthode phylogénétique utilisée)
220
Conclusion et perspectives
221
Conclusion et perspectives
222
Conclusion et perspectives
La démarche de cette thèse était d'étudier la diversité des micro-organismes rencontrés dans
l'écosystème hydrothermal marin profond. Les techniques moléculaires qui ont été employées
pour ce travail de thèse, ont contribué à étudier ces micro-organismes sans le biais de sélection
lié à leur mise en culture. La première partie de cette thèse a permis d'étendre nos connaissances
actuelles sur la diversité et l'abondance des ε-Proteobacteria au sein de cet écosystème. La détec-
tion de bactéries aliées à des Arcobacter incultivés et phylogénétiquement éloignés de la souche
Candidatus Arcobacter suldicus a révélé qu'un nouveau groupe d'ε-Proteobacteria pouvait
être impliqué dans la formation de biolms composés principalement de laments de soufre que
ces micro-organismes sécréteraient. Cette étude participe à démontrer qu'il reste encore de nom-
breux clades qui n'ont pas de représentants cultivés parmi les ε-Proteobacteria détectées dans
l'écosystème hydrothermal marin profond.
223
Conclusion et perspectives
L'étude d'une communauté microbienne associées à des tubes d'Alvinellideae nous a permis
d'approfondir nos connaissances sur le compartiment microbien du pôle chaud de l'écoystème
hydrothermal. Les compartiments plus froids de cet écosytème mériteraient également d'être
soumis à des études de ce genre. L'étude métagénomique de la communauté microbienne associée
à des tubes du ver Riftia pachyptila permettrait par exemple d'accéder à un compartiment
plus froid. Tout comme les tubes d'A. pompejana, ces tubes forment un support idéal pour
la colonisation de communautés microbiennes très diversiées (Lopez-Garcia et al., 2002). La
communauté microbienne associée à ces tubes dière signicativement de celle observée sur les
tubes d'A. pompejana. Cela tient en partie à l'environnement physico-chimique des tubes d'R.
pachyptila : ces tubes sont exposés à des températures plus froides et à un environnement moins
réduit que ceux d'A. pompejana qui sont d'avantage exposés aux uides hydrothermaux (Lopez-
Garcia et al., 2002).
Les tapis microbiens recouvrant les roches, les cheminées, les sédiments ou les surfaces des
animaux (Karl, 1995) pourraient également constituer un échantillon de choix pour une nouvelle
étude métagénomique. D'un point de vue méthodologique, les biolms orent une biomasse
microbienne importante, permettant d'extraire de l'ADN génomique en quantité susante pour
pouvoir construire une banque métagénomique. D'autre part, les biolms semblent être un mode
de vie favoris des micro-organismes des systèmes hydrothermaux (Huber et al., 2002, 2003).
224
Annexes
225
226
Annexe A
228
Annexe A. Banques de données de séquences nucléiques et protéiques
229
Annexe A. Banques de données de séquences nucléiques et protéiques
230
Annexe B
Concentration et origine des composés chimiques identiés dans les environnements hydro-
thermaux marins profonds (d'après Kelley et al., 2002)
Annexe B. Composés chimiques des environnements hydrothermaux marins profonds
232
Annexe B. Composés chimiques des environnements hydrothermaux marins profonds
CO2 3.9–215 mmol 2.3 mmol Magma degassing, Carbon source for
water/rock reactions, chemoautotrophs and
fermentation methanogens
CH4 0.05–4.5 mmol 0.3 nmol Magma degassing, Aerobic and anaerobic
reduction of CO2, microbial oxidation
methanogenesis
H2 0.1–50 mmol 0.3 nmol Magma degassing, Methanogenesis; aerobic and
water/rock reactions, anaerobic oxidation by
microbial fermentation microorganisms
S (as H2S) 3–110 mmol Not detected Water/rock reactions, H2S is the primary energy
28 mmol chemical reduction to source for aerobic
2−
(as SO4 ) anhydrate, microbial chemoautotrophs including
reduction of SO2−
4 symbionts; oxidized sulfur
species reduced by high
diversity of microorganisms;
present in some amino acids
and Fe-S clusters as protein
cores
N (as NH3 or < 0.01–1 mmola < 0.01 mmol Organic-N in buried A source of nitrogen for
NH+4 ) 30 µ mol sediments, possibly subsurface microorganisms;
(as NO−3 ) N2-fixation by oxidation to NO−3 or NO−2
microorganisms and/ by nitrifying bacteria
or chemical reduction
of Nb2
P (as PO2−
4 ) 0.5 µ mol 2.5 µ mol Water/rock reactions All organisms require P for
(P2O5 in basalts), nucleic acids, energy reactions
SW PO2−4 and fatty acids; animals
and aerobic microbes use
SW-PO2− 4 and/or detrital
organic PO2−4 compounds
Fe 0.009–18 mmol < 1 nmol Water/rock reactions Energy source for Fe(II)
as Fe(II) (12% iron in crust), oxidizing bacteria. Fe(III) as
major component of electron acceptor for specific
sulfides as pyrite groups of vent microbes.
Trace element required by
all organisms
Mn 0.1–4.5 mmol < 1 nmol Water/rock reactions Energy source for Mn(III)
as Mn(III) oxidizing bacteria. Trace
element required by all
organisms
Si 2.7–23 mmol 0.16 mmol Water/rock reactions, Some evidence for
SW entrainment, microbially mediated Si
major component of precipitation in sulfides
outer layers of sulfide
deposits
233
(Continued)
Annexe B. Composés chimiques des environnements hydrothermaux marins profonds
Zn 2–100 µ mol 0.01 µ mol Water/rock reactions, Trace element required for key
major component of enzymes including alkaline
sulfides as pyrite phosphatase and RNA
polymerase
Cu 0.02–44 µ mol 0.007 µ mol Water/rock reactions, Trace element required for
major component of enzymes including oxidative
sulfides as chalopyrite enzymes involved in electron
transfer; component of
haemocyanin in arthropods;
toxic in µ mol concentrations
Co 20–200 nmol 0.03 nmol Water/rock reactions Trace element required by all
organisms usually involving
enzymes requiring B12
coenzymes (contain Co)
Cd 1–180 nmol < 1 nmol Water/rock reactions Toxic to all organisms in nmol
levels; binds to S, N centers
of proteins and DNA
Pb 9–359 nmol 0.01 nmol Water/rock reactions Toxic to all organisms in nmol
levels
Mo 1–33 nmol < 1 nmol Water/rock reactions Trace element required for
specific enzymes including
nitrogenase
Wc < 0.01–2.1 µ mol < 1 nmol Water/rock reactions Trace element required for
specific enzymes by
hyperthermophilic archaea
Nic < 0.01–53 µ mol < 1 nmol Water/rock reactions Important component in
coenzymes (F-430) of
methanogens and enzymes of
hyperthermophilic archaea
a
Chemical data from Butterfield et al. 1995; Elderfield & Schultz 1996; Lilley et al. 1993; Von Damm 1990, 1995.
b
There are experimental data for the reduction of N2 to NH3 under hydrothermal vent conditions (Brandes et al. 1998).
c
Data from high temperature fluids from nine different sites at Endeavour on the Juan de Fuca Ridge (Baross & Adams,
unpublished).
234
Annexe C
Publication de l'article :
Thermodesulfatator indicus gen.
nov., sp. nov., a novel thermophilic
chemolithoautotrophic
sulfate-reducing bacterium
isolated from the Central Indian
Ridge
Article publié en 2004, dans International Journal of Systematic and Evolutionary Microbiology
Publication de l'article : Thermodesulfatator indicus
236
Publication de l'article : Thermodesulfatator indicus
International Journal of Systematic and Evolutionary Microbiology (2004), 54, 227–233 DOI 10.1099/ijs.0.02669-0
In the latest edition of Bergey’s Manual of Systematic Commission of the International Committee on System-
Bacteriology, the class Thermodesulfobacteria (Garrity & atics of Prokaryotes, 2003). In the past few years, two novel
Holt, 2001) contained two species: Thermodesulfobacterium species of the genus Thermodesulfobacterium, Thermodesulfo-
commune and Thermodesulfobacterium mobile (recently bacterium hveragerdense (Sonne-Hansen & Ahring, 1999)
renamed Thermodesulfobacterium thermophilum) (Judicial and Thermodesulfobacterium hydrogeniphilum (Jeanthon
et al., 2002), have been described and classified in this
genus. All Thermodesulfobacterium species are anaerobic,
Published online ahead of print on 1 August 2003 as DOI 10.1099/ thermophilic, non-spore-forming, deeply branching, sulfate-
ijs.0.02669-0. reducing bacteria. With the exception of the marine
The GenBank accession number for the 16S rRNA gene sequence of chemolithoautotrophic organism T. hydrogeniphilum, all
Thermodesulfatator indicus CIR29812T is AF393376. Thermodesulfobacterium spp. are chemo-organotrophs
Details for the fatty acids of strain CIR29812T are available in IJSEM that thrive in terrestrial and subterrestrial environments
Online. (Zeikus et al., 1983; Rozanova & Khudyakova, 1974;
237
Publication de l'article : Thermodesulfatator indicus
Sonne-Hansen & Ahring, 1999). Recently, a new strictly diameter were transferred into SRB medium and checked
chemolithoautotrophic, iron-reducing species, ‘Geothermo- for purity microscopically. Furthermore, the purity of the
bacterium ferrireducens’, was isolated from hot springs at isolate was checked at 55 and 70 uC. SRB medium supple-
Yellowstone National Park (USA). This organism represents mented with 2 g Difco yeast extract l21, 2 g tryptone l21
the only member of the family Thermodesulfobacteriaceae and 10 mM glucose with air in the headspace was used
that is unable to reduce sulfate (Kashefi et al., 2002). to check for aerobic contaminants. The latter medium
prepared anaerobically with N2 (100 %; 200 kPa) or H2
We describe here the isolation and characterization of (100 %; 100 kPa) as the gas phase was used to detect
another novel thermophilic, strictly chemolithoautotrophic, anaerobic contaminants. The presence of possible auto-
sulfate-reducing bacterium. The new isolate was obtained trophic contaminants was checked in SRB medium where
from a sample of an active black smoker collected at a sulfate was omitted but where 2 g Difco yeast extract l21
depth of 2420 m at the Kairei vent field (25u199 S, 70u 029 E) and 2 mM acetate were added. Stock cultures of strain
on the Central Indian Ridge (Van Dover et al., 2001) in CIR29812T were stored in SRB medium at 4 uC. However,
April 2001. The chimney fragment was collected by the frequent transfers (twice per month) with 10 % (v/v) of
ROV Jason and was placed in an isolated container for the inoculum in freshly prepared culture medium were found
trip to the surface. Subsamples of the chimney fragment optimal to ensure re-growth. Alternatively, the isolate was
were ground in a mortar and the slurry was stored under an stored in liquid nitrogen in the same medium containing
atmosphere of nitrogen at 4 uC until used as an inoculum. 5 % (w/v) DMSO.
Initial enrichments were done using the following medium Cells of strain CIR29812T were small rods, approximately
that contained (l21 distilled water): 29 g NaCl; 7 g 0?8–1 mm in length and 0?4–0?5 mm in width, with a single
MgSO4.7H2O; 4 g NaOH; 0?5 g KCl; 2 g Na2S2O3.5H2O; polar flagellum (Fig. 1a, b). Cells occurred singly, in pairs
1?66 g MgCl2.6H2O; 0?4 g CaCl2.2H2O; 0?2 g NH4Cl; or in chains of three cells, and elongated during the
0?3 g K2HPO4.3H2O; and 10 ml of a trace element stationary phase of growth. Occasionally, visible creamy
stock solution according to Boone et al. (1989) (http:// aggregates that corresponded to large clumps of cells
methanogens.pdx.edu/OCM_media.html). The medium could be observed in the liquid medium. No spores were
was prepared with anoxic water and, prior to autoclaving, produced.
the pH was adjusted to pH 6 at room temperature with
sulfuric acid. The medium was dispensed under a CO2 Unless otherwise stated, growth experiments were per-
atmosphere into Bellco tubes and capped with butyl- formed in duplicate in SRB medium supplemented with
rubber stoppers. After inoculation with the sulfide slurry
[10 % (v/v) inoculum], the tubes were pressurized with H2
(100 %; 138 kPa) and incubated at 70 uC without shaking.
238
Publication de l'article : Thermodesulfatator indicus
0?5 g tryptone l21 and 2 mM acetate. Growth was DSM 3604T (Ollivier et al., 1988), strain CIR29812T did not
monitored by measuring the increase in optical density contain desulfoviridin (Postgate, 1959).
at 600 nm with a Spectronic 401 spectrophotometer
(Bioblock). The temperature range for growth was deter- Sensitivity to antibiotics (at 25, 50, 100 and 200 mg ml21)
mined without agitation with 20 g NaCl l21 at pH 6?5. The was tested at 70 uC. Strain CIR29812T was resistant to
NaCl range was obtained at 70 uC and pH 6?5 under penicillin and kanamycin (200 mg ml21) and strepto-
agitation (150 r.p.m.). To determine the pH range for mycin (100 mg ml21), but was inhibited by tetracycline
growth, SRB medium was buffered with 20 mM MES (50 mg ml21), ampicillin, chloramphenicol and rifampicin
(pH adjusted to 6) or 20 mM PIPES (pH adjusted to 6?7 (all at 25 mg ml21).
and 7?2). After autoclaving, these pH values decreased to Respiratory lipoquinones and polar lipids were extracted
pH 5?9 (with MES as buffer), pH 6?5 and pH 7 (with PIPES from 100 mg of freeze-dried cell material using the two-
as buffer). The pH ranges from 5?9 to 6?75 (with MES) stage method described by Tindall (1990a, b). Respiratory
and 6 to 7 (with PIPES) were obtained by the addition of quinones were extracted using methanol/hexane (Tindall,
varying concentrations of NaHCO3. The pH of the media 1990a, b) and the polar lipids were extracted by adjusting
was checked at room temperature after overnight incuba- the remaining methanol/0?3 % aqueous NaCl phase (con-
tion of uninoculated tubes under H2/CO2 at 70 uC. taining the cell debris) to give a choroform/methanol/0?3 %
Under these conditions, strain CIR29812T grew between aqueous NaCl mixture (1 : 2 : 0?8, by vol.). The extraction
55 and 80 uC, with an optimum at 70 uC. No growth was solvent was stirred overnight and the cell debris pelleted
observed at 50 or 82 uC. Growth occurred between 10 and by centrifugation. Respiratory lipoquinones were separated
into their different classes (menaquinones and ubiquinones)
35 g NaCl l21, with a growth optimum at 25 g NaCl l21. No
by TLC on silica gel (Macherey-Nagel art. no. 805 023),
growth was detected after 96 h in media containing 5 and
using hexane/tert-butylmethylether (9 : 1, v/v) as solvent.
40 g NaCl l21. Growth occurred between pH 6 and 6?7
UV-absorbing bands corresponding to menaquinones or
in PIPES buffered medium, with an optimum at approxi-
ubiquinones were removed from the plate and further
mately pH 6?25. Growth occurred in MES buffered
analysed by HPLC. This step was carried out on an LDC
medium from pH 6 to 6?25. Under optimal growth
Analytical (Thermo Separation Products) HPLC apparatus
conditions with shaking (150 r.p.m.), the doubling time
fitted with a reverse phase column (2 mm6125 mm, 3 mm,
of strain CIR29812T was around 2 h (maximal OD640 0?11).
RP18; Macherey-Nagel) using methanol/heptane as the
The new isolate was a strict anaerobe and was transferred eluant. Respiratory lipoquinones were detected at 269 nm.
at least six times under strict chemolithoautotrophic con-
Examination of the respiratory lipoquinone composition
ditions, using H2 as the electron donor and sulfate as the
of strain CIR29812T indicated that menaquinones were the
electron acceptor. Hydrogen sulfide was produced during
sole respiratory quinones present. The major component
growth. Elemental sulfur (1 %), thiosulfate (10 mM), cys-
was a menaquinone with seven isoprenologues, i.e.
tine (1 %), nitrate (5 mM), fumarate (10 mM) and sulfite
menaquinone 7 (MK-7). MK-7 had also been identified as
(2 mM) were not used as electron acceptors. CO2 was
the major menaquinone in T. commune and T. thermo-
the sole carbon source used by strain CIR29812T. In the
philum (Collins & Widdel, 1986).
presence of H2/CO2 and sulfate, growth was stimulated
by acetate (2 mM), methanol (0?5 %), monomethylamine Polar lipids were recovered into the chloroform phase by
(0?2 %), glutamate (5 mM), peptone (0?1 %), fumarate adjusting the chloroform/methanol/0?3 % aqueous NaCl
(15 mM), tryptone (0?1 %), isobutyrate (5 mM), 3-CH3 mixture to a ratio of 1 : 1 : 0?9 (by vol.). They were separated
butyrate (5 mM), ethanol (10 mM) and propanol (5 mM). by two-dimensional silica-gel TLC (Macherey-Nagel art. no.
In the presence of H2/CO2 and sulfate, growth was not 818 135). The first direction was developed in chloroform/
affected by isovalerate (5 mM), glucose (5 mM), fructose methanol/water (65 : 25 : 4, by vol.) and the second was
(5 mM) or succinate (10 mM), whereas acetate (15 mM), developed in chloroform/methanol/acetic acid/water
propionate (10 mM), butyrate (10 mM), 2-CH3 butyrate (80 : 12 : 15 : 4, by vol.). Total lipid material and specific
(5 mM) and yeast extract (0?2 %) were slightly inhibitory. functional groups were detected using dodecamolybdo-
Growth was completely inhibited by lactate (15 mM), phosphoric acid (total lipids), Zinzadze reagent (phosphate),
caprylate (2?5 mM), caproate (5 mM), caprate (2?5 mM), ninhydrin (free amino groups), periodate-Schiff (a-glycols),
formate (15 mM), malate (10 mM), valerate (5 mM), Dragendorff (quaternary nitrogen) and anisaldehyde-
pyruvate (10 mM) and heptanoate (5 mM). In sulfate- sulfuric acid (glycolipids).
free medium, no fermentative growth was observed with
malate, pyruvate or lactate. The strain preferentially used The polar lipids of strain CIR29812T were predominantly
ammonium (5 mM) as the nitrogen source but peptone phospholipids (Fig. 2). The two major lipids were identified
(0?5 %), nitrate (5 mM) and tryptone (0?1 %) also initially on the basis of their RF values and staining beha-
supported growth. viour as phosphatidylinositol and phosphatidylethanol-
amine. In addition, one of the minor phospholipids was
Unlike the control culture of Desulfovibrio fructosovorans identified as phosphatidylglycerol. Additional phospholipids
http://ijs.sgmjournals.org 229
239
Publication de l'article : Thermodesulfatator indicus
240
Publication de l'article : Thermodesulfatator indicus
reconfirmed using the Thermo Sequenase TM Primer Cycle Thermodesulfobacteriaceae. They were more similar to the
Sequencing Kit (Amersham) and the reactions were run fatty acid patterns reported for members of the Aquifex–
on a LI-COR automatic sequencer (model 4200) using the Hydrogenobacter group (Stöhr et al., 2001), although the
LI-COR BASE IMAGEIR software (Science Tec) for analysis. longer-chain components found in the latter group were not
found in strain CIR29812T.
Distance and maximum-likelihood analyses (De Soete
1983; Olsen et al., 1994) (1301 nt were used) revealed that Based on a combination of 16S rRNA, chemotaxonomic
strain CIR29812T clustered with all other members of and physiological data, we propose that strain CIR29812T
the family Thermodesulfobacteriaceae and was most closely be placed into a new genus within the family Thermo-
related to T. hydrogeniphilum (10?3 % distant) (Fig. 3). desulfobacteriaceae, for which we propose the name
Thermodesulfatator, as a new species, Thermodesulfatator
The metabolic and physiological properties of strain indicus, which is the sole and type species of this genus.
CIR29812T are very similar to those of T. hydrogeniphilum
SL6T. Contrary to other members of the family Thermo-
desulfobacteriaceae, both organisms are thermophilic, Description of Thermodesulfatator gen. nov.
chemolithoautotrophic, sulfate-reducing bacteria, which
Thermodesulfatator (Ther.mo.de.sul.fa.ta9tor. Gr. masc. n.
are non-fermenting, unable to reduce thiosulfate or sulfite,
thermos heat; N.L. n. desulfatator sulfate-reducer; N.L. masc.
and require NaCl for growth (Table 1). However, their
n. Thermodesulfatator thermophilic sulfate-reducer).
optimal temperature and NaCl range for growth and their
resistance to streptomycin and penicillin represent pheno- Thermophilic. Strictly anaerobic. Marine. Cells are Gram-
typic characteristics that distinguish these sulfate-reducing negative, rod-shaped (0?8–1 mm long and 0?4–0?5 mm
chemolithoautotrophs from one another. In addition, wide) and motile by means of a single polar flagellum.
the 16S rRNA gene sequences of strain CIR29812T and They occur singly, in pairs, in chains of three cells and may
T. hydrogeniphilum SL6T are very different (10?3 % dis- form cell aggregates in stationary-phase cultures. Do not
tance). Moreover, when analysed using the same method form spores. Chemolithoautotrophs growing exclusively
(HPLC), a 15 % difference discriminates the G+C content with hydrogen as the sole electron donor and sulfate as
of their DNA. Lastly, the major fatty acids present in the sole electron acceptor. 16S rRNA gene sequence com-
strain CIR29812T differed from those of T. commune, parison differentiates Thermodesulfatator from the other
the type species of the type genus of the family genera of the family Thermodesulfobacteriaceae.
Characteristic 1 2 3 4
http://ijs.sgmjournals.org 231
241
Publication de l'article : Thermodesulfatator indicus
The type species is Thermodesulfatator indicus. Collins, M. D. & Widdel, F. (1986). Respiratory quinones of sulfate-
reducing and sulphur-reducing bacteria: a systematic investigation.
Description of Thermodesulfatator indicus Syst Appl Microbiol 8, 8–18.
sp. nov. DeSoete, G. (1983). A least squares algorithm for fitting additive
trees to proximity data. Psychometrika 48, 621–626.
Thermodesulfatator indicus (in.di9cus. L. adj. indicus Ferrante, G., Ekiel, I. & Sprott, G. D. (1987). Structures of diether
referring to the Indian Ocean, from where the strain was lipids of Methanospirillum hungatei containing novel head groups
isolated). N,N-dimethylamino- and N,N,N-trimethylaminopentanetetrol.
Biochim Biophys Acta 921, 281–291.
Gram-negative rods (0?8–1 mm long by 0?4–0?5 mm wide), Ferrante, G., Ekiel, I., Patel, G. B. & Sprott, D. (1988). Structure of
motile by means of a single polar flagellum. Cells occur the major polar lipids isolated from the aceticlastic methanogen,
singly, in pairs or in chains of three cells in early cultures. Methanothrix concilii GP6. Biochim Biophys Acta 963, 162–172.
Growth occurs between 55 and 80 uC (optimum 70 uC), Garrity, G. M. & Holt, J. G. (2001). Phylum BIII. Thermodesulfo-
pH 6 and 6?7 (optimum at about pH 6?25) and in the bacteria phy. nov. In Bergey’s Manual of Systematic Bacteriology, 2nd
presence of 10 and 35 g NaCl l21 (optimum 25 g l21). edn, vol. 1, pp. 389–393. Edited by D. R. Boone, R. W. Castenholz &
Anaerobic. Strictly chemolithoautotrophic using sulfate as G. M. Garrity. New York: Springer.
electron acceptor and H2 as electron donor. No fermenta- Götz, D., Banta, A., Beveridge, T. J., Rushdi, A. I., Simoneit, B. R. T.
tive metabolism. With H2/CO2 and sulfate, growth is & Reysenbach, A.-L. (2002). Persephonella marina gen. nov., sp. nov.
stimulated by methanol, monomethylamine, glutamate, and Persephonella guaymasensis sp. nov., two novel, thermophilic,
peptone, fumarate, tryptone, isobutyrate, 3-CH3 butyrate, hydrogen-oxidizing microaerophiles from deep-sea hydrothermal
vents. Int J Syst Evol Microbiol 52, 1349–1359.
ethanol, propanol and low amounts of acetate. Unable to
use sulfur, cystine, thiosulfate, sulfite, fumarate and nitrate Henry, E. A., Devereux, R., Maki, J. S., Gilmour, C. C., Woese, C. R.,
Mandelco, L., Schauder, R., Remsen, C. C. & Mitchell, R. (1994).
as electron acceptor. Ammonium is the preferred nitrogen
Characterization of a new thermophilic sulfate-reducing bacterium
source. Sensitive to ampicillin, chloramphenicol and rifam- Thermodesulfovibrio yellowstonii, gen. nov. and sp. nov.: its
picin (25 mg ml21). Resistant to tetracycline and streptomycin phylogenetic relationship to Thermodesulfobacterium commune and
(100 mg ml21), penicillin and kanamycin (200 mg ml21). their origins deep within the bacterial domain. Arch Microbiol 161,
The major lipoquinone is MK-7. Predominant polar lipids 62–69.
are phosphatidylethanolamine and phosphatidylinositol. Hugenholtz, P., Pitulle, C., Herschberger, K. L. & Pace, N. R. (1998).
Small amounts of phosphatidylglycerol and three unknown Novel division level bacterial diversity in a Yellowstone hot spring.
phospholipids (PL1, PL2, PL3) are detected. Fatty acid J Bacteriol 180, 366–376.
profile is mainly composed of C18 : 0 and C18 : 1. Jeanthon, C., L’Haridon, S., Cueff, V., Banta, A., Reysenbach, A.-L. &
T T T Prieur, D. (2002). Thermodesulfobacterium hydrogeniphilum sp. nov.,
The type strain (CIR29812 =DSM 15286 =JCM 11887 ) a thermophilic, chemolithoautotrophic, sulfate-reducing bacterium
was isolated from an active hydrothermal sulfide chimney isolated from a deep-sea hydrothermal vent at Guaymas Basin, and
deposit at the Kairei vent field on the Central Indian Ridge. emendation of the genus Thermodesulfobacterium. Int J Syst Evol
The G+C content of its DNA is 46?0 mol%. Microbiol 52, 765–772.
Judicial Commission of the International Committee on
Systematics of Prokaryotes (2003). Valid publication of the
Acknowledgements genus name Thermodesulfobacterium and the species names
We are grateful to Bernard Ollivier (IRD, Marseille) for the gift of Thermodesulfobacterium commune (Zeikus et al. 1983) and
Desulfovibrio fructosovorans DSM 3604T. Our thanks go also to Thermodesulfobacterium thermophilum (ex Desulfovibrio thermophilus
Manfred Nimtz and Andrea Abrahamik (GBF, Braunschweig) for Rozanova and Khudyakova 1974). Opinion 71. Int J Syst Evol
running and help in the interpretation of the preliminary ESI-MS/MS Microbiol 53, 927.
experiments. We also acknowledge Adelaide Nieguitsila for her help Kashefi, K., Holmes, D. E., Reysenbach, A. L. & Lovley, D. R.
with phenotypic characterization. The work performed at Braunschweig (2002). Use of Fe(III) as an electron acceptor to recover previously
and Plouzané was supported by an INTAS grant (99-1250). The work uncultured hyperthermophiles: isolation and characterization of
performed at Plouzané was also supported by a CNRS/Rhône-Poulenc Geothermobacterium ferrireducens gen. nov., sp. nov. Appl Environ
grant, a PRIR (THERMOSHP) and the programme ‘Souchotèque de Microbiol 68, 1735–1742.
Bretagne’ from the Conseil Régional de Bretagne. H. M. was supported
by a grant from the Ministère de la Recherche. The work was also Langworthy, T. A., Hölzer, G., Zeikus, J. G. & Tornabene, T. G.
supported by grants from the National Science Foundation (NSF- (1983). Iso- and anteiso-branched glycerol diethers of the
OCE9712358 and NSF-OCE0083134). thermophilic anaerobe Thermodesulfotobacterium commune. Syst
Appl Microbiol 4, 3–17.
Maidak, B. L., Cole, J. R., Lilburn, T. G. & 7 other authors (2001).
References The RDP-II (Ribosomal Database Project). Nucleic Acids Res 29,
Boone, D. R., Johnson, R. L. & Lui, Y. (1989). Diffusion of the 173–174.
interspecies electron carriers H2 and formate in methanogenic Mesbah, M., Premachandran, U. & Whitman, W. B. (1989). Precise
ecosystems and its implications in the measurement of Km for H2 or measurement of the G+C content of deoxyribonucleic acid by high-
formate uptake. Appl Environ Microbiol 55, 1735–1741. performance liquid chromatography. Int J Syst Bacteriol 39, 159–167.
Cashion, P., Holder-Franklin, M. A., McCully, J. & Franklin, M. Ollivier, B., Cord-Ruwisch, R., Hatchikian, E. C. & Garcia, J. L.
(1977). A rapid method for the base ratio determination of bacterial (1988). Characterization of Desulfovibrio fructosovorans sp. nov. Arch
DNA. Anal Biochem 81, 461–466. Microbiol 149, 447–450.
242
Publication de l'article : Thermodesulfatator indicus
Olsen, G. J., Matsuda, H., Hagstrom, R. & Overbeek, R. (1994). Hydrogenobaculum acidophilum gen. nov., comb. nov., in the phylum
FASTDNAML: a tool for construction of phylogenetic trees of DNA ‘Hydrogenobacter/Aquifex’. Int J Syst Evol Microbiol 51, 1853–1862.
sequences using maximum likelihood. Comput Appl Biosci 10, 41–48. Tamaoka, J. & Komagata, K. (1984). Determination of DNA base
Postgate, J. (1959). A diagnostic reaction of Desulphovibrio composition by reverse-phase high-performance liquid chromato-
desulphuricans. Nature 14, 481–482. graphy. FEMS Microbiol Lett 25, 125–128.
Rozanova, E. P. & Khudyakova, A. I. (1974). A new non-spore- Tindall, B. J. (1990a). A comparative study of the lipid composition
forming thermophilic sulfate-reducing organism, Desulfovibrio thermo- of Halobacterium saccharovorum from various sources. Syst Appl
philus nov. sp. Microbiology (English translation of Mikrobiologiya) 43, Microbiol 13, 128–130.
908–912. Tindall, B. J. (1990b). Lipid composition of Halobacterium
Rozanova, E. P. & Pivovarova, T. A. (1988). Reclassification lacusprofundi. FEMS Microbiol Lett 66, 199–202.
of Desulfovibrio thermophilus (Rozanova & Khudyakova 1974). Van Dover, C. L., Humphris, S. E., Fornari, D. & 24 other authors
Microbiology (English translation of Mikrobiologiya) 57, 102–106. (2001). Biogeography and ecological setting of Indian Ocean
Skirnisdottir, S., Hreggvidsson, G. O., Hjorleifsdottir, S., hydrothermal vents. Science 294, 818–823.
Marteinsson, V. T., Petursdottir, S. K., Holst, O. & Kristjansson, Widdel, F. & Bak, F. (1992). Gram-negative mesophilic sulfate-
J. K. (2000). Influence of sulfide and temperature on species reducing bacteria. In The Prokaryotes, 2nd edn, pp. 3352–3378.
composition and community structure of hot spring microbial Edited by A. Balows, H. G. Trüper, M. Dworkin, W. Harder & K. H.
mats. Appl Environ Microbiol 66, 2835–2841. Schleifer. New York: Springer.
Sonne-Hansen, J. & Ahring, B. K. (1999). Thermodesulfobacterium Yoshino, J., Sugiyama, Y., Sakuda, S., Kodama, T., Nagasawa, H.,
hveragerdense sp. nov., and Thermodesulfovibrio islandicus sp. nov., Ishii, M. & Igarashi, Y. (2001). Chemical structure of a novel
two thermophilic sulfate reducing bacteria isolated from a Icelandic aminophospholipid from Hydrogenobacter thermophilus strain TK-6.
hot spring. Syst Appl Microbiol 22, 559–564. J Bacteriol 183, 6302–6304.
Stöhr, R., Waberski, A., Völker, H., Tindall, B. J. & Thomm, M. (2001). Zeikus, J. G., Dawson, M. A., Thompson, T. E., Ingvorsen, K.
Hydrogenothermus marinus gen. nov., sp. nov., a novel thermophilic & Hatchikian, E. C. (1983). Microbial ecology of volcanic
hydrogen-oxidizing bacterium, recognition of Calderobacterium sulphidogenesis: isolation and characterization of Thermodesulfo-
hydrogenophilum as a member of the genus Hydrogenobacter and bacterium commune gen. nov. and sp. nov. J Gen Microbiol 129,
proposal of the reclassification of Hydrogenobacter acidophilus as 1159–1169.
http://ijs.sgmjournals.org 233
243
Publication de l'article : Thermodesulfatator indicus
244
Bibliographie
Alain K. (2003) Approches culturales et moléculaires des microbial cells without cultivation. Microbiol Rev 59 : 143
assemblages microbiens associés aux polychètes hydrother- 169
maux de la famille Alvinellidae. Thèse de l'Université de
Bretagne Occidentale Arp A.J. & Childress J.J. (1983) Sulde binding by the
blood of the hydrothermal vent tubeworm Riftia pachyptila.
Alain K., Olagnon M., Desbruyères D., Pagé A., Bar- Science 219 : 295297
bier G., Juniper S.K. et al. (2002a) Phylogenetic charac-
terization of the bacterial assemblage associated with mucous Arrigo K.R. (2005) Marine microorganisms and global nu-
secretions of the hydrothermal vent polychaete Paralvinella trient cycles. Nature 437 : 34955
palmiformis. FEMS Microbiol Ecol 42 : 463476
Baker B.J. & Baneld J.F. (2003) Microbial communities
Alain K., Querellou J., Lesongeur F., Pignet P., in acid mine drainage. FEMS Microbiol Ecol 44 : 139152
Crassous P., Raguenes G. et al. (2002b) Caminibac-
ter hydrogeniphilus gen. nov., sp. nov., a novel thermophilic, Béjà O. (2004) To BAC or not to BAC : marine ecogeno-
hydrogen-oxidizing bacterium isolated from an East Pacic mics. Curr Opin Biotechnol 15 : 187190
Rise hydrothermal vent. Int J Syst Evol Microbiol 52 : 1317
1323 Béjà O., Aravind L., Koonin E.V., Suzuki M.T., Hadd
A. & Nguyen L.P. (2000a) Bacterial rhodopsin : evidence
Alain K., Zbinden M., Le Bris N., Lesongeur F., Que- for a new type of phototrophy in the sea. Science 289 :
rellou J., Gaill F. et al. (2004) Early steps in microbial 19021906
colonization processes at deep-sea hydrothermal vents. En-
viron Microbiol 6 : 227241 Béjà O., Koonin E.V., Aravind L., Taylor L.T., Seitz
H., Stein J.L. et al. (2002a) Comparative genomic analysis
Alayse-Danet A.M., Desbruyères D. & Gaill F. (1987) of archaeal genotypic variants in a single population and in
The possible nutritional or detoxication role of the epibio- two dierent oceanic provinces. Appl Environ Microbiol 68 :
tic bacteria of Alvinellid polychaetes : review of the current 335345
data. Symbiosis 4 : 5162
Béjà O., Marcelino T.S., Eugene V.K., Aravind L.,
Allen E.E. & Baneld J.F. (2005) Community genomics
Hadd A., Nguyen L.P. et al. (2000b) Construction and
in microbial ecology and evolution. Nat Rev Microbiol 3 :
analysis of bacterial articial chromosome libraries from a
489498
marine microbial assemblage. Environ Microbiol 2 : 516
Altschul S.F., Gish W., Miller W., Myers E.W. & Lip- 529
man D.J. (1990) Basic local alignment search tool. J Mol
Biol 215 : 403410
Béjà O., Spudich E.N., Spudich J.L., Leclerc M. &
DeLong E.F. (2001) Proteorhodopsin phototrophy in the
Altschul S.F. & Lipman D.J. (1990) Protein database ocean. Nature 411 : 786789
searches for multiple alignments. Proc Natl Acad Sci USA
87 : 55095513 Béjà O., Suzuki M.T., Heidelberg J.F., Nelson W.C.,
Preston C.M., Hamada T. et al. (2002b) Unsuspected
Amann R.I., Ludwig W. & Schleifer K.H. (1995) Phy- diversity among marine aerobic anoxygenic phototrophs. Na-
logenetic identication and in situ detection of individual ture 415 : 630633
Bibliographie
Bell P.J., Sunna A., Gibbs M.D., Curach N.C., Neva- Brot J.E., McArthur J.V. & Shimkets L.J. (2002)
lainen H. & Bergquist P.L. (2002) Prospecting for novel Recovery of novel bacterial diversity from a forested wetland
lipase genes using PCR. Microbiology 148 : 22832291 impacted by reject coal. Environ Microbiol 4 : 7649
Bell S.D. & Jackson S.P. (1998) Transcription and trans- Bruns A., Nubel U., Cypionka H. & Overmann J.
lation in Archaea : a mosaic of eukaryal and bacterial fea- (2003) Eect of signal compounds and incubation conditions
tures. Trends Microbiol 6 : 2228 on the culturability of freshwater bacterioplankton. Appl
Environ Microbiol 69 : 19801989
Bintrim S.B., Donohue T.J., Handelsman J., Roberts
G.P. & Goodman R.M. (1997) Molecular phylogeny of Buckley D.H., Graber J.R. & Schmidt T.M. (1998)
Phylogenetic analysis of nonthermophilic members of the
Archaea from soil. Proc Natl Acad Sci USA 94 : 27782
kingdom Crenarchaeota and their diversity and abundance
Bock E. & Wagner M. (2001) Oxidation of inorga- in soils. Appl Environ Microbiol 64 : 43334339
nic nitrogen compounds as an energy source. In Pro-
Bult C.J., White O., Olsen G.J., Zhou L., Fleisch-
karyotes - an evolving electronic resource for the mi-
mann R.D., Sutton G.G. et al. (1996) Complete genome
crobiological community, Dworkin M., Falkow S., Ro-
sequence of the methanogenic archaeon, Methanococcus jan-
senberg E., Schleifer K.-H. & Stackebrandt E. (eds).
naschii. Science 273 : 10581073
(http ://link.springerlink-ny.com/link/service/books/10125)
release3.7, 3rd ed. Springer-Verlag, New York Burggraf S., Huber H. & Stetter K.O. (1997) Reclassi-
cation of the crenarchael orders and families in accordance
Boetius A., Ravenschlag K., Schubert C.J., Rickert with 16S rRNA sequence data. Int J Syst Bacteriol 47 :
D., Widdel F., Gieseke A. et al. (2000) A marine micro- 65760
bial consortium apparently mediating anaerobic oxidation of
methane. Nature 407 : 623626 Button D.K., Schut F., Quang P., Martin R. & Ro-
bertson B.R. (1993) Viability and isolation of marine bac-
Boetius A. & Suess E. (2004) Hydrate ridge : a natural teria by dilution culture : theory, procedures, and initial re-
laboratory for the study of microbial life fuelled by methane sults. Appl Environ Microbiol 59 : 881891
from near-surface gas hydrates. Source Chem Geol 205 :
291310 Byrd J.J., Xu H.S. & Colwell R.R. (1991) Viable but
non culturable bacteria in drinking water. Appl Environ Mi-
Bond P.L., Smriga S.P. & Baneld J.F. (2000) Phylo- crobiol 57 : 875878
geny of microorganisms populating a thick, subaerial, predo-
minantly lithotrophic biolm at an extreme acid mine drai-
Campbell B.J. & Cary S.C. (2001) Characterization of a
novel spirochete associated with the hydrothermal vent poly-
nage site. Appl Environ Microbiol 66 : 38423849
chaete annelid, Alvinella pompejana. Appl Environ Microbiol
Brady S.F., Chao C.J. & Clardy J. (2004) Long-chain 67 : 110117
n-acyltyrosine synthases from environmental DNA. Appl En-
Campbell B.J. & Cary S.C. (2004) Abundance of reverse
viron Microbiol 70 : 68656870
tricarboxylic acid cycle genes in free-living microorganisms
at deep-sea hydrothermal vents. Appl Environ Microbiol 70 :
Braithwaite D.K. & Ito J. (1993) Compilation, alignment,
62826289
and phylogenetic relationships of DNA polymerases. Nucleic
Acids Res 21 : 787802 Campbell B.J., Engel A.S., Porter M.L. & Takai K.
(2006) The versatile ε-Proteobacteria : key players in sulphi-
Breitbart M., Hewson I., Felts B., Mahay J.M., Nul- dic habitats. Nat Rev Microbiol 4 : 45868
ton J., Salamon P. et al. (2003) Metagenomic analyses of
an uncultured viral community from human feces. J Bacte- Campbell B.J., Jeanthon C., Kostka J.E., Luther
riol 185 : 62206223 G. W. r. & Cary S.C. (2001) Growth and phylogenetic
properties of novel bacteria belonging to the epsilon subdivi-
Breitbart M., Salamon P., Andresen B., Mahay sion of the Proteobacteria enriched from Alvinella pompejana
J.M., Segall A.M., Mead D. et al. (2002) Genomic ana- and deep-sea hydrothermal vents. Appl Environ Microbiol
lysis of uncultured marine viral communities. Proc Natl Acad 67 : 45664572
Sci USA 99 : 1425014255
Campbell B.J., Stein J.L. & Cary S.C. (2003) Evidence
Brinkmann A. (2002) Regulation of transcription in hyper- of chemolithoautotrophy in the bacterial community asso-
thermophilic Archaea. Ph.D. thesis, Wageningen University, ciated with Alvinella pompejana, a hydrothermal vent poly-
the Netherlands chaete. Appl Environ Microbiol 69 : 50705078
246
Bibliographie
Cane D.E., Walsh C.T. & Khosla C. (1998) Biochemis- Corre E. (2000) Approches moléculaires de la diversité mi-
try - harnessing the biosynthetic code : combinations, per- crobienne de deux environnements extrêmes : les sources hy-
mutations, and mutations. Science 282 : 6368 drothermales profondes et les réservoirs pétroliers. Thèse de
l'Université de Bretagne Occidentale
Cary S.C., Cottrell M.T., Stein J.L., Camacho F. &
Desbruyeres D. (1997) Molecular identication and locali- Corre E., Reysenbach A.L. & Prieur D. (2001) ε-
zation of lamentous symbiotic bacteria associated with the Proteobacteria l diversity from a deep-sea hydrothermal vent
hydrothermal vent annelid Alvinella pompejana. Appl Envi- on the Mid-Atlantic Ridge. FEMS Microbiol Lett 205 : 329
ron Microbiol 63 : 11241130 335
Cary S.C., Shank T. & Stein J. (1998) Worms bask in Cottrell M.T., Moore J.A. & Kirchman D.L. (1999)
extreme temperatures. Nature 391 : 545546 Chitinases from uncultured marine microorganisms. Appl
Environ Microbiol 65 : 25532557
Cary S.C., Warren W., Anderson E. & Giovannoni
Courtois S., Cappellano C.M., Ball M., Francou F.X.,
S.J. (1993) Identication and localization of bacterial en-
Normand P., Helynck G. et al. (2003) Recombinant en-
dosymbionts in hydrothermal vent taxa with species-specic
vironmental libraries provide access to microbial diversity for
PCR amplication and in situ hybridization techniques. Mar
drug discovery from natural products. Appl Environ Micro-
Mol Biol Biotechnol 2 : 5162
biol 69 : 4955
Cavanaugh C. (1983) Symbiotic chemoautotrophic bacte- Courtois S., Frostegard A., Goransson P., Depret G.,
ria in marine invertebrates from sulphide-rich habitats. Na- Jeannin P. & Simonet P. (2001) Quantication of bacte-
ture 302 : 5861 rial subgroups in soil : comparison of DNA extracted directly
from soil or from cells previously released by density gradient
Cavanaugh C.M., Jones M.L., Jannasch H.W. & Wa-
centrifugation. Environ Microbiol 3 : 431439
terbury J.B. (1981) Prokaryotic cells in the hydrothermal
vent tube worm Riftia pachyptila : possible chemoautotro- Curtis T.P., Sloan W.T. & Scannell J.W. (2002) Esti-
phic symbionts. Science 213 : 340342 mating prokaryotic diversity and its limits. Proc Natl Acad
Sci USA 99 : 1049410499
Charlou J.L., Donval J.P., Fouquet Y., Jean-Baptiste
P. & Holm N. (2002) Geochemistry of high H2 and CH4 Dalgaard J. & Garrett R. (1993) Archaeal hyperthermo-
vent uids issuing from ultramac rocks at the Rainbow hy- philic genes. In The biochemistry of Archaea (Archaebacte-
drothermal eld (36o 14'N, MAR). Chem Geol 191 : 345359 ria), Kates M., Kushner D.J. & Matheson A.T. (eds). Am-
sterdam, The Netherlands : Elsevier vol.26 pp. 535-563. el-
Chevaldonné P., Desbruyères D. & Childress J.J. sevier, amsterdam, the netherlands
(1992) Some like it hot... and some even hotter. Nature 359 :
593594 Damm K.L.V., Oosting S.E., Kozlowski R., Butter-
more L.G., Colodner D.C., Edmonds H.N. et al.
Collins J. & Hohn B. (1978) Cosmids : a type of plasmid (1995) Evolution of East Pacic Rise hydrothermal vent
gene-cloning vector that is packageable in vitro in bacterio- uids following a volcanic eruption. Nature 375 : 4750
phage lambda heads. Proc Natl Acad Sci USA 75 : 4242
4246 Daniel R. (2004) The soil metagenome a rich resource for
the discovery of novel natural products. Curr Opin Biotech-
Colwell R.R. (2000) Viable but non culturable bacteria : a nol 15 : 199204
survival strategy. J Infect Chemother 6 : 121125
Daniel R. (2005) The metagenomics of soil. Nat Rev Mi-
crobiol 3 : 470478
Conte M.H. (1998) The oceanic ux program : twenty years
of particle ux measurements in the deep Sargasso Sea. Ocea- Dauga C., Dore J. & Sghir A. (2005) Expanding the
nus 40 : 1519 known diversity and environmental distribution of cultured
and uncultured Bacteria. Med Sci (Paris) 21 : 290296
Corliss J.B. & Ballard R.D. (1977) Oasis of life in the
cold abyss. Natl Geogr 152 : 441453 Davey M.E. & O'Toole G.A. (2000) Microbial biolms :
from ecology to molecular genetics. Microbiol Mol Biol Rev
Corliss J.B., Dymond J., Gordon L.I., Edmond J.M., 64 : 847867
Von Herzen R.P., Ballard R.D. et al. (1979) Submarine
thermal springs on the Galapagos rift. Science 203 : 1073 Dayho M.O. (1965) Computer aids to protein sequence
1083 determination. J Theor Biol 8 : 97112
247
Bibliographie
de la Torre J.R., Christianson L.M., Béjà O., Suzuki Dopson M., Baker-Austin C., Hind A., Bowman J.P.
M.T., Karl D.M., Heidelberg J. et al. (2003) Proteorho- & Bond P.L. (2004) Characterization of Ferroplasma iso-
dopsin genes are distributed among divergent marine bacte- lates and Ferroplasma acidarmanus sp. nov., extreme aci-
rial taxa. Proc Natl Acad Sci USA 100 : 1283012835 dophiles from acid mine drainage and industrial bioleaching
environments. Appl Environ Microbiol 70 : 20792088
DeLong E.F. (1992) Archaea in coastal marine environ-
ments. Proc Natl Acad Sci USA 89 : 56855689 Dumont M.G. & Murrell J.C. (2005) Stable isotope pro-
bing - linking microbial identity to function. Nat Rev Micro-
DeLong E.F. (2005) Microbial community genomics in the
biol 3 : 499504
ocean. Nat Rev Microbiol 6 : 159169
DeLong E.F., Wickham G.S. & Pace N.R. (1989) Phy- Edmonds H.N., Michael P.J., Baker E.T., Connelly
logenetic stains : ribosomal RNA-based probes for the iden- D.P., Snow J.E., Langmuir C.H. et al. (2003) Disco-
tication of single cells. Science 243 : 13601363 very of abundant hydrothermal venting on the ultraslow-
spreading Gakkel Ridge in the Arctic Ocean. Nature 421 :
Desbruyeres D., Biscoito M., Caprais J.C., Colaco 252256
A., Comtet T., Crassous P. et al. (2001) Variations
in deep-sea hydrothermal vent communities on the Mid- Eilers H., Pernthaler J., Gloeckner F.O. & Amann
Atlantic Ridge near the Azores plateau. Deep-Sea Res 48 : R. (2000) Culturability and in situ abundance of pelagic
13251346 bacteria from the North sea. Appl Environ Microbiol 66 :
30443051
Desbruyères D., Chevaldonné P., Alayse A.M., Jolli-
vet D., Lallier F.H., C J.T. et al. (1998) Biology and eco- Engel A.S., Lee N., Porter M.L., Stern L.A., Bennett
logy of the pompei worm" (Alvinella pompejana desbruyères P.C. & Wagner M. (2003) Filamentous epsilonproteobac-
and laubier), a normal dweller of an extreme deep-sea envi- teria" dominate microbial mats from suldic cave springs.
ronment : a synthesis of current knowledge and recent deve- Appl Environ Microbiol 69 : 55035511
lopments. Deep-Sea Res II 45 : 383422
Desbruyères D., Gaill F., Laubier L. & Fouquet Y. Entcheva P., Liebl W., Johann A., Hartsch T. & Streit
(1985) Polychaetous annelids from hydrothermal vent eco-
W. (2001) Direct cloning from enrichment cultures, a reliable
strategy for isolation of complete operons and genes from
systems : an ecological overview. Biol Soc Wash Bull 6 :
microbial consortia. Appl Environ Microbiol 77 : 8999
103106
Desbruyères D., Gaill F., Laubrier L., Prieur D. & Erkel C., Kemnitz D., Kube M., Ricke P., Chin K.J.,
Rau G. (1983) Unusual nutrition of the "pompeii worm" Dedysh S. et al. (2005) Retrieval of rst genome data for
Alvinella pompejana (polychaetous annelid) from a hydro- rice cluster I methanogens by a combination of cultivation
thermal vent environment : SEM, TEM, super(13)C, and and molecular techniques. FEMS Microbiol Ecol 53 : 187
super(15)N evidence. Mar Biol 75 : 201205 204
Di Meo-Savoie C.A., Luther G. W. r. & Cary S.C. Ermler U., Grabarse W., Shima S., Goubeaud M. &
(2004) Physicochemical characterization of the microhabitat Thauer R.K. (1997) Crystal structure of methyl-coenzyme
of Alvinella pompejana, a hydrothermal vent annelid. Geo- M reductase : the key enzyme of biological methane forma-
chim Cosmochim Acta 68 : 20552066 tion. Science 278 : 14571462
Ding M. & Yelton D.B. (1993) Cloning and analysis of Felbeck H., Childress J.J. & Somero G.N. (1981)
the leuB gene of Leptospira interrogans serovar pomona. J Calvin-Benson cycle and sulde oxydation enzymes in ani-
Gen Microbiol 139 : 10931103 mals from sulde rich habitats. Nature 293 : 291293
Distel D.L., Lane D.J., Olsen G.J., Giovannoni S.J., Felbeck H. & Jarchow J. (1998) Carbon release from pu-
Pace B., Pace N.R. et al. (1988) Sulfur-oxidizing bacterial ried chemoautotrophic bacterial symbionts of the hydro-
endosymbionts : analysis of phylogeny and specicity by 16S thermal vent tubeworm Riftia pachyptila. Physiol Zool 71 :
rRNA sequences. J Bacteriol 170 : 25062510 294302
248
Bibliographie
Ferreyra R.G., Soncini F.C. & Viale A.M. (1993) Clo- Galperin M.Y. (2004) Metagenomics : from acid mine to
ning, characterization, and functional expression in Esche- shining sea. Environ Microbiol 6 : 543545
richia coli of chaperonin (groESL) genes from the photo-
trophic sulfur bacterium Chromatium vinosum. J Bacteriol Galperin M.Y. (2005) The molecular biology database col-
175 : 15141523 lection : 2005 update. Nucleic Acids Res 33 : D5D24
Finster K., Coates J.D., Liesack W. & Pfennig N. Galtier N. & Lobry J.R. (1997) Relationships between
(1997) Desulfuromonas thiophila sp. nov., a new obligately genomic G+C content, RNA secondary structures, and op-
sulfur-reducing bacterium from anoxic freshwater sediment. timal growth temperature in prokaryotes. J Mol Evol 44 :
Int J Syst Bacteriol 47 : 7548 6326
Fisher C.R., Childress J.J. & Sanders N.K. (1988) The Galtier N., Tourasse N. & Gouy M. (1999) A nonhyper-
role of vestimentiferan hemoglobin in providing an environ- thermophilic common ancestor to extant life forms. Science
ment suitable for chemoautotrophic sulde-oxidizing endo- 283 : 220221
symbionts. Symbiosis 5 : 229246
Garrity G.M. & Holt J.G. (2001) The road map to
Fleischmann R.D., Adams M.D., White O., Clay- the manual. In Bergey's manual of systematic bacteriology,
ton R.A., Kirkness E.F., Kerlavage A.R. et al. (1995) Boone D.R., Castenholz R.W., & Garrity G.M. (eds). New-
Whole-genome random sequencing and assembly of Haemo- Ork : Springer-Verlag. 2nd edn, vol. 1, pp. 119-166
philus inuenzae Rd. Science 269 : 496512
Gebruck A.V., Southward E.C., Kennedy H. & Sou-
Flores J.F., Fisher C.R., Carney S.L., Green B.N., thward A.J. (2000) Food source behaviour and distribu-
Freytag J.K., Schaeer S.W. et al. (2005) Sulde bin- tion of hydrothermal vent shrimps at the Mid-Atlantic Ridge.
ding is mediated by zinc ions discovered in the crystal struc- Journal of Marine Biological Association UK 80 : 485499
ture of a hydrothermal vent tubeworm hemoglobin. Proc
Natl Acad Sci USA 102 : 27132718 Gillespie D.E., Brady S.F., Bettermann A.D., Cian-
ciotto N.P., Liles M.R., Rondon M.R. et al. (2002)
Fouquet Y., Auclair G., Cambon P. & Etoubleau J. Isolation of antibiotics turbomycin A and B from a metage-
(1988) Geological setting and mineralogical and geochemi- nomic library of soil microbial DNA. Appl Environ Microbiol
cal investigations on sulde deposits near 13o N on the East 68 : 43014306
Pacic Rise. Marine Geology 84 : 145178
Giovannoni S.J., Britschgi T.B., Moyer C.L. & Field
Fuchs G., Stupperich E. & Eden G. (1980) Autotrophic K.G. (1990) Genetic diversity in sargasso sea bacterioplank-
CO2 xation in Chlorobium limicola - evidence for the ope- ton. Nature 345 : 6063
ration of a reductive tricarboxylic acid cycle in growing cells.
Arch Microbiol 128 : 6471 Giovannoni S.J., DeLong E.F., Olsen G.J. & Pace
N.R. (1988) Phylogenetic group-specic oligodeoxynucleo-
Fuhrman J.A., McCallum K. & Davis A.A. (1992) No- tide probes for identication of single microbial cells. J Bac-
vel major archaebacterial group from marine plankton. Na- teriol 170 : 720726
ture 356 : 148149
Goeau A., Barrell B.G., Bussey H., Davis R.W., Du-
Fujiwara S. (2002) Extremophiles : Developments of their jon B., Feldmann H. et al. (1996) Life with 6000 genes.
special functions and potential resources. J Biosci Bioeng Science 274 : 546, 5637
94 : 518525
Gupta R., Beg K.Q. & Lorenz P. (2002) Bacterial alka-
Gabor E.M. (2004) Harvesting novel biocatalyst from the line, proteases : molecular approaches and industrial appli-
metagenome. Ph.D. thesis, Unniv. Grohingen cations. Appl Microbiol Biotechnol 59 : 1532
Gabor E.M., de Vries E.J. & Janssen D.B. (2004) Haddad A., Camacho F., Durand P. & Cary S.C.
Construction, characterization, and use of small-insert gene (1995) Phylogenetic characterization of the epibiotic bacteria
banks of DNA isolated from soil and enrichment cultures for associated with the hydrothermal vent polychaete Alvinella
the recovery of novel amidases. Environ Microbiol 6 : 948 pompejana. Appl Environ Microbiol 61 : 16791687
958
Hallam S.J., Girguis P.R., Preston C.M., Richardson
Gaill F. & Hunt S. (1991) The biology of Annelid worms P.M. & DeLong E.F. (2003) Identication of methyl coen-
from high temperature hydrothermal vent regions. Rev Aquat zyme M reductase A (mcrA) genes associated with methane-
Sci 4 : 107137 oxidizing Archaea. Appl Environ Microbiol 69 : 54835491
249
Bibliographie
Hallam S.J., Putnam N., Preston C.M., Detter J.C., Hoehler T.M., Alperin M.J. & Albert D.B. (1994)
Rokhsar D., Richardson P.M. et al. (2004) Reverse me- Field and laboratory studies of methane oxydation in an
thanogenesis : testing the hypothesis with environmental ge- anoxic marine sediment : evidence for a methanogen-sulfate-
nomics. Science 305 : 14571462 reducer consortium. Global Biogeochem Cycles 8 : 451463
Handelsman J. (2004) Metagenomics : Application of ge- Hoek J., Banta A., Hubler F. & Reysenbach A.L.
nomics to uncultured microorganisms. Microbiol Mol Biol (2003) Microbial diversity of a sulphide spire located in the
Rev 68 : 669685 Edmond deep-sea hydrothermal vent eld on the Central In-
dian Ridge. Geobiology 1 : 119127
Handelsman J. (2005) Sorting out metagenomes. Nat Bio-
technol 23 : 389 Hohn M.J., Hedlund B.P. & Huber H. (2002) Detec-
tion of 16S rDNA sequences representing the novel phylum
Handelsman J., Liles M., Mann D., Riesenfeld C. & Nanoarchaeota : indication for a wide distribution in high
Goodman R.M. (2002) Cloning the metagenome : culture- temperature biotopes. Syst Appl Microbiol 25 : 551554
independent access to the diversity and functions of the un-
cultivated microbial world. Methods in Microbiology - Func- Huber H. & Stetter K.O. (1998) Hyperthermophiles and
tional Microbial Genomics Academic Press 33 : 241255 their possible potential in biotechnology. J Biotechnol 64 :
3952
Handelsman J., Rondon M.R., Brady S., Clardy J. &
Goodman R.M. (1998) Molecular biology provides access Huber J.A., Buttereld D.A. & Baross J.A. (2002)
to the chemistry of unknown soil microbes : a new frontier Temporal changes in archaeal diversity and chemistry in a
for natural products. Chem Biol 5 : 245249 mid-ocean ridge subseaoor habitat. Appl Environ Microbiol
68 : 15851594
Harmsen H., Prieur D. & Jeanthon C. (1997) Distribu-
tion of microorganisms in deep-sea hydrothermal vent chim- Huber J.A., Buttereld D.A. & Baross J.A. (2003)
neys investigated by whole-cell hybridization and enrichment Bacterial diversity in a subseaoor habitat following a deep-
culture of thermophilic subpopulations. Appl Environ Micro- sea volcanic eruption. FEMS Microbiol Ecol 43 : 393409
biol 63 : 28762883
Huber R. & Stetter K.O. (1992) The order Thermoto-
gales. In The Procaryotes, Balows A., Trüper H.G., Dworkin
Haymon R.M., Fornari D.J., Von Damm K.L., Lilley
M., Harder W. & Schleifer K.H. (eds). Heidelberg, New York
M.D., Pert M.R., Edmond J.M. et al. (1993) Volcanic
(1992) pp. 3809-3815. Springer, Berlin
eruption of the mid-ocean ridge along the East Pacic Rise
crest at 9 degree 45-52'N : Direct submersible observations
Hugenholtz P. (2002) Exploring prokaryotic diversity in
of seaoor phenomena associated with an eruption event in
the genomic era. Genome Biol 3 : 18
April, 1991. Earth and Planet Sci Lett 119 : 85101
Hughes D.S., Felbeck H. & Stein J.L. (1997) A histi-
Henne A., Daniel R., Schmitz R.A. & Gottschalk G. dine protein kinase homolog from the endosymbiont of the
(1999) Construction of environmental DNA libraries in Es-
hydrothermal vent tubeworm Riftia pachyptila. Appl Envi-
cherichia coli and screening for the presence of genes confer-
ron Microbiol 63 : 34943498
ring utilization of 4-hydroxybutyrate. Appl Environ Micro-
biol 65 : 39013907 Hughes J.B., Hellmann J.J., Ricketts T.H. & Bohan-
nan B.J. (2001) Counting the uncountable : statistical ap-
Henne A., Schmitz R.A., Bomeke M., Gottschalk G. proaches to estimating microbial diversity. Appl Environ Mi-
& Daniel R. (2000) Screening of environmental DNA libra- crobiol 67 : 43994406
ries for the presence of genes conferring lipolytic activity on
Escherichia coli. Appl Environ Microbiol 66 : 31133116 Hugler M., Huber H., Stetter K.O. & Fuchs G.
(2003) Autotrophic CO2 xation pathway in archaea (Cre-
Higashi Y., Sunamura M., Kitamura K., Nakamura narchaeota ). Arch Microbiol 179 : 160173
K.i., Kurusu Y., Ishibashi J.i. et al. (2004) Microbial
diversity in hydrothermal surface to subsurface environments Hugler M., Wirsen C.O., Fuchs G., Taylor C.D. &
of Suiyo Seamount, Izu-Bonin Arc, using a catheter-type in Sievert S.M. (2005) Evidence for autotrophic CO2 xation
situ growth chamber. FEMS Microbiol Ecol 47 : 327336 via the reductive tricarboxylic acid cycle by members of the
ε subdivision of Proteobacteria. J Bacteriol 187 : 30203027
Hinrichs K.U., Hayes J.M., Sylva S.P., Brewer P.G.
& DeLong E.F. (1999) Methane-consuming archaebacteria Hungate R.E. (1950) The anaerobic mesophilic cellulolytic
in marine sediments. Nature 398 : 802805 bacteria. Bacteriol Rev 14 : 149
250
Bibliographie
Inagaki F., Takai K., Kobayashi H., Nealson K.H. & vulcanius sp. nov., a novel hyperthermophilic methanogen
Horikoshi K. (2003) Sulfurimonas autotrophica gen. nov., isolated from East Pacic Rise, and identication of Metha-
sp. nov., a novel sulfur-oxidizing ε-Proteobacterium isolated nococcus sp. DSM 4213T as Methanococcus fervens sp. nov.
from hydrothermal sediments in the Mid-Okinawa Trough. Int J Syst Bacteriol 49 : 5839
Int J Syst Evol Microbiol 53 : 18011805
Jeanthon C., L'Haridon S., Reysenbach A.L., Vernet
Inagaki F., Takai K., Kobayashi H., Nealson K.H. & M., Messner P., Sleytr U.B. et al. (1998) Methanococ-
Horikoshi K. (2006) Biogeographical distribution and di- cus infernus sp. nov., a novel hyperthermophilic lithotrophic
versity of microbesin methane hydrate-bearing deep marine methanogen isolated from a deep-sea hydrothermal vent. Int
sediments on the Pacic Ocean Margin. Proc Natl Acad Sci J Syst Bacteriol 48 Pt 3 : 9139
USA 103 : 28152820
Judd A.G., Hovland M., Dimitrov L.I., Gil S.G. &
Inagaki F., Takai K., Nealson K.H. & Horikoshi K. V J. (2002) The geological methane budget at continental
(2004) Sulfurovum lithotrophicum gen. nov., sp. nov., a no- margins and its inuence on climate change. Geouids 2 :
vel sulfur-oxidizing chemolithoautotroph within the Epsilon- 109126
Proteobacteria isolated from Okinawa Trough hydrothermal
sediments. Int J Syst Evol Microbiol 54 : 14771482 Jurgens G., Glockner F., Amann R., Saano A., Mon-
tonen L., Likolammi M. et al. (2000) Identication of
Jannasch H.W. (1985) The chemosynthetic support of life novel Archaea in bacterioplankton of a boreal forest lake by
and the microbial diversity at deep-sea hydrothermal vents. phylogenetic analysis and uorescent in situ hybridization.
Proc R Soc Lond B 225 : 277297 FEMS Microbiol Ecol 34 : 4556
Jannasch H.W. (1995) Microbial interactions with hydro-
Jurgens G., Lindstrom K. & Saano A. (1997) Novel
thermal uids. In Seaoor hydrothermal systems : physical,
group within the kingdom Crenarchaeota from boreal forest
chemical, biological, and geological interactions, Humphris
soil. Appl Environ Microbiol 63 : 803805
S.E., Zierenberg R.A., Mullineaux L.S. & Thomson, R.E.
(eds). Washington : American Geophysical Union. pp. 273- Jurgens K., Pernthaler J., Schalla S. & Amann R.
296 (1999) Morphological and compositional changes in a plank-
tonic bacterial community in response to enhanced protozoan
Jannasch H.W. & Jones G.E. (1959) Bacterial popula-
grazing. Appl Environ Microbiol 65 : 12411250
tions in sea water as determined by dierent methods of enu-
meration. Limnol Oceanogr 4 : 128139
Kaeberlein T., Lewis K. & Epstein S.S. (2002) Isolating
Jannasch H.W. & Wirsen C.O. (1979) Chemosynthetic "uncultivable" microorganisms in pure culture in a simulated
primary production at East Pacic sea oor spreading cen- natural environment. Science 296 : 11271129
ters. BioScience 29 : 592598
Karl D.M. (1995) Ecology of free-living, hydrothermal vent
Janssen P.H., Yates P.S., Grinton B.E., Taylor P.M. microbial communities. In The microbiology of deep-sea hy-
& Sait M. (2002) Improved culturability of soil bacteria and drothermal vents. Karl D.M. (eds). Boca Raton : CRC Press
isolation in pure culture of novel members of the divisions Inc., 35-124
Acidobacteria, Actinobacteria, Proteobacteria, and Verruco-
microbia. Appl Environ Microbiol 68 : 23912396 Karl D.M., Taylor G.T., Novitsky J.A., Jannasch
H.W., Wirsen C.O., Pace N.R. et al. (1988) A micro-
Jeanthon C. (2000) Molecular ecology of hydrothermal vent biological study of Guaymas Basin high temperature hydro-
microbial communities. Antonie Van Leeuwenhoek 77 : 117 thermal vents. Deep -Sea Res 35 : 777791
133
Karner M.B., DeLong E.F. & Karl D.M. (2001) Ar-
Jeanthon C., L'Haridon S., Cue V., Banta A., Rey- chaeal dominance in the mesopelagic zone of the Pacic
senbach A.L. & Prieur D. (2002) Thermodesulfobacte- Ocean. Nature 409 : 50710
rium hydrogeniphilum sp. nov., a thermophilic, chemoli-
thoautotrophic, sulfate-reducing bacterium isolated from a Keller M. & Zengler K. (2004) Tapping into microbial
deep-sea hydrothermal vent at Guaymas Basin, and emen- diversity. Nat Rev Microbiol 2 : 141150
dation of the genus Thermodesulfobacterium. Int J Syst Evol
Microbiol 52 : 76572 Kelley D.S., Baross J.A. & Delaney J.R. (2002) Volca-
noes, uids, and life at Mid-Ocean ridge spreading centers.
Jeanthon C., L'Haridon S., Reysenbach A.L., Corre Annual Review of Earth and Planetary Sciences 30 : 385
E., Vernet M., Messner P. et al. (1999) Methanococcus 491
251
Bibliographie
Kelley D.S., Karson J.A., Blackman D.K., Fruh- Krüger M., Meyerdierks A., Glockner F.O., Amann
Green G.L., Buttereld D.A., Lilley M.D. et al. (2001) R., Widdel F., Kube M. et al. (2003) A conspicuous ni-
An o-axis hydrothermal vent eld near the Mid-Atlantic ckel protein in microbial mats that oxidize methane anaero-
Ridge at 30 degrees N. Nature 412 : 145149 bically. Nature 426 : 878881
Kelley D.S., Karson J.A., Fruh-Green G.L., Yoerger Kuypers M.M., Sliekers A.O., Lavik G., Schmid M.,
D.R., Shank T.M., Buttereld D.A. et al. (2005) A Jorgensen B.B., Kuenen J.G. et al. (2003) Anaerobic
serpentinite-hosted ecosystem : the Lost City hydrothermal ammonium oxidation by anammox bacteria in the Black Sea.
eld. Science 307 : 14281434 Nature 422 : 60811
Keough B.P., Schmidt T.M. & Hicks R.E. (2003) Ar-
Kvenvolden K.A. (1988) Methane hydrates and global cli-
chaeal nucleic acids in picoplankton from great lakes on three
mate. Global Biogeochem Cycles 2 : 221229
continents. Microb Ecol 46 : 238248
Kim U.J., Shizuya H., de Jong P.J., Birren B. & Si- Kvenvolden K.A. (1999) Potential eects of gas hydrate
mon M.I. (1992) Stable propagation of cosmid sized human on human welfare. Proc Natl Acad Sci USA 96 : 34203426
DNA inserts in an F factor based vector. Nucleic Acids Res
La Paglia C. & Hartzell P.L. (1997) Stress-induced pro-
20 : 10831085
duction of biolm in the hyperthermophilic Archaeoglobus
Kluyver A.J. & Van Niel C.B. (1936) Prospects for a fulgidus. Appl Environ Microbiol 63 : 31583163
natural system of classication of Bacteria. zbl. bakt., ii abt.
94 :369-403. Int J Syst Bacteriol 30 : 225420 Laue B.E. & Nelson D.C. (1994) Characterization of the
gene encoding the autotrophic ATP sulfurylase from the bac-
Knietsch A., Bowien S., Whited G., Gottschalk G. terial endosymbiont of the hydrothermal vent tubeworm Rif-
& Daniel R. (2003a) Identication and characterization tia pachyptila. J Bacteriol 176 : 37233929
of coenzyme B12-dependent glycerol dehydratase- and diol
dehydratase-encoding genes from metagenomic DNA libra- Le Bris N., Sarradin P.M. & Caprais J.C. (2003)
ries derived from enrichment cultures. Appl Environ Micro- Contrasted sulphide chemistries in the environment of 13o N
biol 69 : 30483060 EPR vent fauna. Deep Sea Research Part I : Oceanographic
Research Papers 50 : 737747
Knietsch A., Waschkowitz T., Bowien S., Henne A. &
Daniel R. (2003b) Construction and screening of metageno- Le Bris N., Zbinden M. & Gaill F. (2005) Processes
mic libraries derived from enrichment cultures : generation controlling the physico-chemical micro-environments associa-
of a gene bank for genes conferring alcohol oxidoreductase ted with Pompeii worms. Deep Sea Res I 52 : 10711083
activity on Escherichia coli. Appl Environ Microbiol 69 :
14081416 L'Haridon S., Cilia V., Messner P., Raguenes G.,
Gambacorta A., Sleytr U.B. et al. (1998) Desulfurobac-
Knietsch A., Waschkowitz T., Bowien S., Henne A.
terium thermolithotrophum gen. nov., sp. nov., a novel auto-
& Daniel R. (2003c) Metagenomes of complex microbial
trophic, sulphur-reducing bacterium isolated from a deep-sea
consortia derived from dierent soils as sources for novel
hydrothermal vent. Int J Syst Bacteriol 48 : 70111
genes conferring formation of carbonyls from short chain po-
lyols on Escherichia coli. J Mol Microbiol 5 : 4656 Liles M.R., Manske B.F., Bintrim S.B., Handelsman
Knittel K., Losekann T., Boetius A., Kort R. & J. & Goodman R.M. (2003) A census of rRNA genes and
Amann R. (2005) Diversity and distribution of methano- linked genomic sequences within a soil metagenomic library.
trophic archaea at cold seeps. Appl Environ Microbiol 71 : Appl Environ Microbiol 69 : 26842691
467479
Londsale P. (1977) Clustering of suspension-feeding macro-
Könneke M., Bernhard A.E., de la Torre J.R., Walker benthos near abyssal hydrothermal vents at oceanic sprea-
C.B., Waterbury J.B. & Stahl D.A. (2005) Isolation of ding centers. Deep-Sea Res 24 : 857863
an autotrophic ammonia-oxidizing marine archaeon. Nature
437 : 543546 Longnecker K. (2001) MSc Oregon State University, 2001,
Oceanography
Kormas K.A., Tivey M.K., Von Damm K. & Teske
A. (2006) Bacterial and archaeal phylotypes associated with Longnecker K. & Reysenbachach A.L. (2001) Expan-
distinct mineralogical layers of a white smoker spire from sion of the geographic distribution of a novel lineage of ε-
a deep-sea hydrothermal vent site (9o N, East Pacic Rise). Proteobacteria to a hydrothermal vent site on the Southern
Environ Microbiol 8 : 909920 East Pacic Rise. FEMS Microbiol Ecol 35 : 287293
252
Bibliographie
Lopez-Garcia P., Brochier C., Moreira D. & Majernik A., Gottschalk G. & Daniel R. (2001) Scree-
Rodriguez-Valera F. (2004) Comparative analysis of a ge- ning of environmental DNA libraries for the presence of genes
nome fragment of an uncultivated mesopelagic crenarchaeote conferring (Na+ )(Li+ )/H+ antiporter activity on Escheri-
reveals multiple horizontal gene transfers. Environ Microbiol chia coli : characterization of the recovered genes and the
6 : 1934 corresponding gene products. J Bacteriol 183 : 66456653
Lopez-Garcia P., Duperron S., Philippot P., Foriel J., Man D., Wang W., Sabehi G., Aravind L., Post A.F.,
Susini J. & Moreira D. (2003a) Bacterial diversity in hy- Massana R. et al. (2003) Diversication and spectral tu-
drothermal sediment and epsilonproteobacterial dominance ning in marine proteorhodopsins. Embo J 22 : 17251731
in experimental microcolonizers at the Mid-Atlantic Ridge.
Environ Microbiol 5 : 961976 Maneeld M., Whiteley A.S., Griths R.I. & Bailey
M.J. (2002a) RNA stable isotope probing, a novel means
Lopez-Garcia P., Gaill F. & Moreira D. (2002) Wide of linking microbial community function to phylogeny. Appl
bacterial diversity associated with tubes of the vent worm Environ Microbiol 68 : 536773
Riftia pachyptila. Environ Microbiol 4 : 204215
Maneeld M., Whiteley A.S., Ostle N., Ineson P. &
Lopez-Garcia P., Philippe H., Gail F. & Moreira D. Bailey M.J. (2002b) Technical considerations for RNA-
(2003b) Autochthonous eukaryotic diversity in hydrother- based stable isotope probing : an approach to associating
mal sediment and experimental microcolonizers at the Mid- microbial diversity with microbial community function. Ra-
Atlantic Ridge. Proc Natl Acad Sci USA 100 : 697702 pid Commun Mass Spectrom 16 : 217983
Lorenz P. & Eck J. (2005) Metagenomics and industrial Marteinsson V., Birrien J.L., Kristjansson J.K. &
applications. Nat Rev Microbiol 3 : 510516 Prieur D. (1995) First isolation of thermophilic aerobic non-
sporulating heterotrophic bacteria from deep-sea hydrother-
Lorenz P., Liebeton K., Niehaus F. & Eck J. (2002)
mal vents. FEMS Microbiology Ecology 18 : 163174
Screening for novel enzymes for biocatalytic processes : ac-
cessing the metagenome as a resource of novel functional Marteinsson V.T., Birrien J.L., Jeanthon C. & Prieur
sequence space. Curr Opin Biotechnol 13 : 572577 D. (1996) Numerical taxonomic study of thermophilic Ba-
cillus isolated from three geographically separated deep-sea
Lorenz P. & Schleper C. (2002) Metagenome - a chal-
hydrothermal. FEMS Microbiol Ecol 21 : 255266
lenging source of enzyme discovery. J Mol Catal B-Enzym
19-20 : 1319 Médigue C., Bocs S., Labarre L., Mathe C. & Vallenet
D. (2002) Bio-informatique (1) : L'annotation in silico des
Lowe T.M. & Eddy S.R. (1997) tRNAscan-SE : a program
séquences génomiques. Ms Med Sci 18 : 237250
for improved detection of transfer RNA genes in genomic
sequence. Nucleic Acids Res 25 : 955964 Meyerdierks A., Kube M., Lombardot T., Knittel K.,
Bauer M., Glockner F.O. et al. (2005) Insights into the
Ludwig W. & Klenk H.P. (2001) Overview : A phylo-
genomes of archaea mediating the anaerobic oxidation of me-
genetic backbone and taxonomic framework for procaryotic
thane. Environ Microbiol 7 : 19371951
systematics. In Bergey's Manual of Systematic Bacteriology,
Boone D.R., Castenholz R.W. & Garrity G.M. (eds). Berlin : Millikan D.S., Felbeck H. & Stein J.L. (1999) Identi-
Springer-Verlag. 2nd edn, vol.1, pp. 49-65 cation and characterization of a agellin gene from the endo-
symbiont of the hydrothermal vent tubeworm Riftia pachyp-
MacGregor B.J., Moser D.P., Alm E.W., Nealson
tila. Appl Environ Microbiol 65 : 31293133
K.H. & Stahl D.A. (1997) Crenarchaeota in Lake Michigan
sediment. Appl Environ Microbiol 63 : 11781181 Miroshnichenko M.L., Kostrikina N.A., Chernyh
MacNeil I.A., Tiong C.L., Minor C., August P.R., N.A., Pimenov N.V., Tourova T.P., Antipov A.N.
Grossman T.H., Loiacono K.A. et al. (2001) Expression et al. (2003) Caldithrix abyssi gen. nov., sp. nov., a nitrate-
reducing, thermophilic, anaerobic bacterium isolated from a
and isolation of antimicrobial small molecules from soil DNA
Mid-Atlantic Ridge hydrothermal vent, represents a novel
libraries. J Mol Microbiol Biotechnol 3 : 301308
bacterial lineage. Int J Syst Evol Microbiol 53 : 3239
Madigan M.T. (1996) Brock : Biology of Microorganisms.
Madigan M.T., Martinko J.M. & Parker J. (eds). Prentice Miroshnichenko M.L., Kostrikina N.A., L'Haridon
Hall College Div ; 8th Package edition S., Jeanthon C., Hippe H., Stackebrandt E. et al.
(2002) Nautilia lithotrophica gen. nov., sp. nov., a thermo-
Madsen E.L. (2005) Identifying microorganisms respon- philic sulfur-reducing epsilon-proteobacterium isolated from
sible for ecologically signicant biogeochemical processes. a deep-sea hydrothermal vent. Int J Syst Evol Microbiol 52 :
Nat Rev Microbiol 3 : 439446 12991304
253
Bibliographie
Miroshnichenko M.L., L'Haridon S., Schumann P., Nakagawa T., Takai K., Suzuki Y., Hirayama H.,
Spring S., Bonch-Osmolovskaya E.A., Jeanthon C. Konno U., Tsunogai U. et al. (2006) Geomicrobiological
et al. (2004) Caminibacter profundus sp. nov., a novel ther- exploration and characterization of a novel deep-sea hydro-
mophile of Nautiliales ord. nov. within the class Epsilon- thermal system at the TOTO caldera in the Mariana Volca-
proteobacteria , isolated from a deep-sea hydrothermal vent. nic Arc. Environ Microbiol 8 : 3749
Int J Syst Evol Microbiol 54 : 4145
Nelson D.C., Wirsen C.O. & Jannasch H.W. (1989)
Moreira D., Rodriguez-Valera F. & Lopez-Garcia P. Characterization of large, autotrophic Beggiatoa spp. abun-
(2004) Analysis of a genome fragment of a deep-sea un- dant at hydrothermal vents of the Guaymas Basin. Appl
cultivated group II euryarchaeote containing 16s rDNA, a Environ Microbiol 55 : 29092917
spectinomycin-like operon and several energy metabolism
genes. Environ Microbiol 6 : 959969 Nelson K.E. (2003) The future of microbial genomics. En-
viron Microbiol 5 : 12231225
Moyer C.L., Dobbs F.C. & Karl D.M. (1994) Estima-
tion of diversity and community structure through restriction Nelson K.E., Clayton R.A., Gill S.R., Gwinn M.L.,
fragment length polymorphism distribution analysis of bac- Dodson R.J., Haft D.H. et al. (1999) Evidence for lateral
terial 16S rRNA genes from a microbial mat at an active, gene transfer between Archaea and Bacteria from genome
hydrothermal vent system, Loihi Seamount, Hawaii. Appl sequence of Thermotoga maritima. Nature 399 : 323329
Environ Microbiol 60 : 8719
Nercessian O. (2003) Etude de la diversité spécique et
Moyer C.L., Dobbs F.C. & Karl D.M. (1995) Phyloge- fonctionnelle des communautés microbiennes associées à des
netic diversity of the bacterial community from a microbial sources hydrothermales marines profondes par des approches
mat at an active, hydrothermal vent system, Loihi Seamount, moléculaires. Ph.D. thesis, Thèse de l'Université de Bretagne
Hawaii. Appl Environ Microbiol 61 : 15551562 Occidentale
Moyer C.L., Tiedje J.M., Dobbs F.C. & Karl D.M. Nercessian O., Bienvenu N., Moreira D., Prieur D. &
(1998) Diversity of deep-sea hydrothermal vent Archaea from Jeanthon C. (2005a) Diversity of functional genes of me-
Loihi Seamount, Hawaii. Deep Sea Research Part II : Topical thanogens, methanotrophs and sulfate reducers in deep-sea
Studies in Oceanography 45 : 303317 hydrothermal environments. Environ Microbiol 7 : 11832
Nakagawa S., Inagaki F., Takai K., Horikoshi K. & Nercessian O., Fouquet Y., Pierre C., Prieur D. &
Sako Y. (2005a) Thioreductor micantisoli gen. nov., sp. Jeanthon C. (2005b) Diversity of Bacteria and Archaea as-
nov., a novel mesophilic, sulfur-reducing chemolithoauto- sociated with a carbonate-rich metalliferous sediment sample
troph within the ε-Proteobacteria isolated from hydrother- from the Rainbow vent eld on the Mid-Atlantic Ridge. En-
mal sediments in the Mid-Okinawa Trough. Int J Syst Evol viron Microbiol 7 : 698714
Microbiol 55 : 599605
Nercessian O., Prokofeva M., Lebedinski A., L'Hari-
Nakagawa S., Takai K., Inagaki F., Chiba H., Ishiba- don S., Cary C., Prieur D. et al. (2004) Design of 16S
shi J., Kataoka S. et al. (2005b) Variability in microbial rRNA-targeted oligonucleotide probes for detecting cultured
community and venting chemistry in a sediment-hosted ba- and uncultured archaeal lineages in high-temperature envi-
ckarc hydrothermal system : Impacts of subseaoor phase- ronments. Environ Microbiol 6 : 170182
separation. FEMS Microbiol Ecol 54 : 14155
Nercessian O., Reysenbach A.L., Prieur D. & Jean-
Nakagawa S., Takai K., Inagaki F., Hirayama H., Nu- thon C. (2003) Archaeal diversity associated with in situ
noura T., Horikoshi K. et al. (2005c) Distribution, phylo- samplers deployed on hydrothermal vents on the East Paci-
genetic diversity and physiological characteristics of epsilon- c Rise (13 degrees N. Environ Microbiol 5 : 492502
Proteobacteria in a deep-sea hydrothermal eld. Environ
Microbiol 7 : 16191632 Newman J.R. & Fuqua C. (1999) Broad-host-range ex-
pression vectors that carry the l-arabinose-inducible Esche-
Nakagawa S., Takai K., Inagaki F., Horikoshi K. & richia coli araBAD promoter and the araC regulator. Gene
Sako Y. (2005d) Nitratiruptor tergarcus gen. nov., sp. nov. 227 : 197203
and Nitratifractor salsuginis gen. nov., sp. nov., nitrate-
reducing chemolithoautotrophs of the ε-Proteobacteria iso- Noonan J.P., Hofreiter M., Smith D., Priest J.R.,
lated from a deep-sea hydrothermal system in the Mid- Rohland N., Rabeder G. et al. (2005) Genomic sequen-
Okinawa Trough. Int J Syst Evol Microbiol 55 : 925933 cing of Pleistocene cave bears. Science 309 : 5979
254
Bibliographie
Ochsenreiter T., Selezi D., Quaiser A., Bonch- Prieur D., Chamroux S., Durand P., Erauso G., Fera
Osmolovskaya L. & Schleper C. (2003) Diversity and P., Jeanthon C. et al. (1990) Metabolic diversity in epi-
abundance of Crenarchaeota in terrestrial habitats studied biotic microora associated with the Pompeii worms Alvi-
by 16S RNA surveys and real time PCR. Environ Microbiol nella pompejana and A. caudata (polychaete : Annelida )
5 : 787797 from deep-sea hydrothermal vents. Mar Biol 106 : 361367
Ogram A., Sayler G.S. & Barkay T. (1987) The extrac- Prieur D., Erauso G. & Jeanthon C. (1995) Hyperther-
tion and purication of microbial DNA from sediments. J mophilic life at deep-sea hydrothermal vents. Planet Space
Microbiol Methods 7 : 5766 Sci 43 : 115121
Olsen G.J., Lane D.J., Giovannoni S.J., Pace N.R. Prieur D. & Jeanthon C. (1987) Preliminary study of he-
terotrophic bacteria isolated from two deep-sea hydrother-
& Stahl D.A. (1986) Microbial ecology and evolution : a
mal vent invertebrates : Alvinella pompejana (polychaete)
ribosomal RNA approach. Annu Rev Microbiol 40 : 337
and Bathymodiolus thermophilus (bivalve). Symbiosis 4 :
365
8798
Orphan V.J., House C.H., Hinrichs K.U., McKeegan
Pruzzo C., del Mar Lleo M., Signoretto C., Zampini
K.D. & DeLong E.F. (2002) Multiple archaeal groups me-
M., Pane L., Colwell R.R. et al. (2003) Persistence of
diate methane oxidation in anoxic cold seep sediments. Proc
adhesive properties in Vibrio cholerae after long-term expo-
Natl Acad Sci USA 99 : 76637668
sure to sea water. Environ Microbiol 5 : 850858
Pace N.R. (1997) A molecular view of microbial diversity Quaiser A., Ochsenreiter T., Klenk H.P., Kletzin A.,
and the biosphere. Science 276 : 734740 Treusch A.H., Meurer G. et al. (2002) First insight into
the genome of an uncultivated crenarchaeote from soil. En-
Pace N.R., Stahl D.A., Lane D.J. & Olsen G.J. (1985) viron Microbiol 4 : 603611
Analyzing natural microbial populations by rRNA sequences.
ASM news 51 : 412 Quaiser A., Ochsenreiter T., Lanz C., Schuster S.C.,
Treusch A.H., Eck J. et al. (2003) Acidobacteria form
Pearson A., McNichol A.P., Benitez-Nelson B.C., a coherent but highly diverse group within the bacterial do-
Hayes J.M. & Eglinton T.I. (2001) Origins of lipid bio- main : evidence from environmental genomics. Mol Microbiol
markers in Santa Monica Basin surface sediment : a case 50 : 563575
study unsing compound-specic D1 4C analysis. Geochim
Cosmochim Acta 65 : 31233137 Radajewski S., Webster G., Reay D.S., Morris S.A.,
Ineson P., Nedwell D.B. et al. (2002) Identication of
Pfeifer B.A., Admiraal S.J., Gramajo H., Cane D.E. active methylotroph populations in an acidic forest soil by
& Khosla C. (2001) Biosynthesis of complex polyketides in stable-isotope probing. Microbiology 148 : 23312342
a metabolically engineered strain of E. coli. Science 291 :
17901792 Rappe M.S. & Giovannoni S.J. (2003) The uncultured
microbial majority. Annu Rev Microbiol 57 : 369394
Philippe H. & Germot A. (2000) Phylogeny of eukaryotes
Rees H.C., Grant S., Jones B., Grant W.D. & Heaphy
based on ribosomal RNA : long-branch attraction and models
S. (2003) Detecting cellulase and esterase enzyme activities
of sequence evolution. Mol Biol Evol 17 : 8304
encoded by novel genes present in environmental DNA libra-
Piel J., Hui D., Wen G., Butzke D., Platzer M., Fu- ries. Extremophiles 7 : 415421
setani N. et al. (2004) Antitumor polyketide biosynthesis Reysenbach A.L., Liu Y., Banta A.B., Beveridgz T.J.,
by an uncultivated bacterial symbiont of the marine sponge
Kirshtein J.D., Schouten S. et al. (2006) A ubiqui-
Theonella swinhoei. Proc Natl Acad Sci USA 101 : 16222 tous thermoacidophilic archaeon from deep-sea hydrothermal
16227
vents. Nature 442 : 444447
Polz M.F. & Cavanaugh C.M. (1995) Dominance of one Reysenbach A.L., Longnecker K. & Kirshtein J. (2000)
bacterial phylotype at a Mid-Atlantic Ridge hydrothermal Novel bacterial and archaeal lineages from an in situ growth
vent site. Proc Natl Acad Sci USA 92 : 72327236 chamber deployed at a Mid-Atlantic Ridge hydrothermal
vent. Appl Environ Microbiol 66 : 37983806
Preston C.M., Wu K.Y., Molinski T.F. & DeLong
E.F. (1996) A psychrophilic crenarchaeon inhabits a marine Reysenbach A.L. & Shock E. (2002) Merging genomes
sponge : Cenarchaeum symbiosum gen. nov., sp. nov. Proc with geochemistry in hydrothermal ecosystems. Science
Natl Acad Sci USA 93 : 62416 296 : 10771082
255
Bibliographie
Richardson T.H., Tan X., Frey G., Callen W., Cabell Sandaa R.A., Enger O. & Torsvik V. (1999) Abundance
M., Lam D. et al. (2002) A novel, high performance enzyme and diversity of Archaea in heavy-metal-contaminated soils.
for starch liquefaction. discovery and optimization of a low Appl Environ Microbiol 65 : 32933297
ph, thermostable alpha-amylase. J Biol Chem 277 : 26501
26507 Sandler S.J., Hugenholtz P., Schleper C., DeLong
E.F., Pace N.R. & Clark A.J. (1999) Diversity of radA
Riesenfeld C.S., Schloss P.D. & Handelsman J. (2004) genes from cultured and uncultured archaea : comparative
Metagenomics : genomic analysis of microbial communities. analysis of putative RadA proteins and their use as a phylo-
Annu Rev Genet 38 : 525552 genetic marker. J Bacteriol 181 : 907915
256
Bibliographie
Schwecke T., Aparicio J.F., Molnar I., Konig A., Stean R.J., Goksoyr J., Bej A.K. & Atlas R.M.
Khaw L.E., Haydock S.F. et al. (1995) The biosynthetic (1988) Recovery of DNA from soils and sediments. Appl
gene cluster for the polyketide immunosuppressant rapamy- Environ Microbiol 54 : 29082915
cin. Proc Natl Acad Sci USA 92 : 78397843
Stein J.L., Marsh T.L., Wu K.Y., Shizuya H. & De-
Segonzac M. (1992) Les peuplements associés à l'hy- Long E.F. (1996) Characterization of uncultivated proka-
drothermalisme océanique du Snake Pit (dorsale medio- ryotes : isolation and analysis of a 40-kilobase-pair genome
Atlantique ; 23o N, 3480 m) : composition et microdistribu- fragment from a planktonic marine archaeon. J Bacteriol
tion de la megafaune. CR Acad Sci paris 314 : 593600 178 : 591599
Shizuya H., Birren B., Kim U., Mancino V., Slepak
T., Tachiiri Y. et al. (1992) Cloning and stable mainte- Steinberg D.K., Carlson C.A., Bates N.R., Johnson
nance of 300-kilobase-pair fragments of human DNA in Es-
R.J., Michaels A.F. & Knap A.F. (2001) Overview of the
U.S. JGOFS Bermuda Atlantic Time-series Study (BATS) :
cherichia coli using an F-factor-based vector. Proc Natl Acad
A decade-scale look at ocean biology and biogeochemistry.
Sci USA 89 : 87948797
Deep-Sea Research II 48 : 14051447
Sievert S., Wieringa E., Wirsen C. & Taylor C. (2006)
Growth and mechanism of lamentous-sulfur formation Straub K.L. & Buchholz-Cleven B.E. (2001) Geobacter
by Candidatus Arcobacter suldicus in opposing oxygen- bremensis sp. nov. and Geobacter pelophilus sp. nov., two
sulde gradients. Environ Microbiol : doi :10.1111/j.1462 dissimilatory ferric-iron-reducing bacteria. Int J Syst Evol
2920.2006.01156.x Microbiol 51 : 18058
Sievert S.M., Brinkho T., Muyzer G., Ziebis W. & Strous M. & Jetten M.S.M. (2004) Anaerobic oxidation
Kuever J. (1999) Spatial heterogeneity of bacterial popula- of methane and ammonium. Annual Review of Microbiology
tions along an environmental gradient at a shallow submarine 58 : 99117
hydrothermal vent near Milos Island (Greece). Appl Environ
Microbiol 65 : 38342842 Strous M., Pelletier E., Mangenot S., Rattei T., Leh-
ner A., Taylor M.W. et al. (2006) Deciphering the evo-
Sievert S.M. & Kuever J. (2000) Desulfacinum hydro-
lution and metabolism of an anammox bacterium from a
thermale sp. nov., a thermophilic, sulfate-reducing bacte-
community genome. Nature 440 : 7904
rium from geothermally heated sediments near Milos Island
(Greece). Int J Syst Evol Microbiol 50 : 123946
Takai K., Campbell B.J., Cary S.C., Suzuki M., Oida
Simon H.M., Dodsworth J.A. & Goodman R.M. H., Nunoura T. et al. (2005a) Enzymatic and genetic cha-
(2000) Crenarchaeota colonize terrestrial plant roots. En- racterization of carbon and energy metabolisms by deep-sea
viron Microbiol 2 : 495505 hydrothermal chemolithoautotrophic isolates of Epsilonpro-
teobacteria. Appl Environ Microbiol 71 : 73107320
Slobodkin A., Campbell B., Cary S.C., Bonch-
Osmolovskaya E. & Jeanthon C. (2001) Evidence for the Takai K., Gamo T., Tsunogai U., Nakayama N., Hi-
presence of thermophilic Fe(III)-reducing microorganisms in rayama H., Nealson K.H. et al. (2004a) Geochemical and
deep-sea hydrothermal vents at 13 degrees N (East Pacic microbiological evidence for a hydrogen-based, hyperthermo-
Rise). FEMS Microbiol Ecol 36 : 235243 philic subsurface lithoautotrophic microbial ecosystem (Hy-
perSLiME) beneath an active deep-sea hydrothermal eld.
Snaidr J., Amann R., Huber I., Ludwig W. & Schlei- Extremophiles 8 : 269282
fer K.H. (1997) Phylogenetic analysis and in situ identica-
tion of bacteria in activated sludge. Appl Environ Microbiol
Takai K., Hirayama H., Nakagawa T., Suzuki Y.,
63 : 28842896
Nealson K.H. & Horikoshi K. (2005b) Lebetimonas aci-
Somerville C.C., Knight I.T., Straube W.L. & Col- diphila gen. nov., sp. nov., a novel thermophilic, acidophi-
well R.R. (1989) Simple, rapid method for direct isolation lic, hydrogen-oxidizing chemolithoautotroph within the 'Ep-
of nucleic acids from aquatic environments. Appl Environ silonproteobacteria', isolated from a deep-sea hydrothermal
Microbiol 55 : 548554 fumarole in the Mariana Arc. Int J Syst Evol Microbiol 55 :
183189
Stach J.E.M. & Burns R.G. (2002) Enrichment versus
biolm culture : a functional and phylogenetic comparison of Takai K. & Horikoshi K. (1999) Genetic diversity of Ar-
polycyclic aromatic hydrocarbon-degrading microbial com- chaea in deep-sea hydrothermal vent environments. Genetics
munities. Environ Microbiol 4 : 169182 152 : 12851297
257
Bibliographie
Takai K., Inagaki F., Nakagawa S., Hirayama H., Nu- Tettelin H., Nelson K.E., Paulsen I.T., Eisen J.A.,
noura T., Sako Y. et al. (2003) Isolation and phylo- Read T.D., Peterson S. et al. (2001) Complete genome
genetic diversity of members of previously uncultivated ε- sequence of a virulent isolate of Streptococcus pneumoniae.
Proteobacteria in deep-sea hydrothermal elds. FEMS Mi- Science 293 : 498506
crobiol Lett 218 : 167174
Torarinsson E., Klenk H.P. & Garrett R.A. (2005) Di-
Takai K., Komatsu T., Inagaki F. & Horikoshi K. vergent transcriptional and translational signals in Archaea.
(2001a) Distribution of Archaea in a black smoker chimney Environ Microbiol 7 : 4754
structure. Appl Environ Microbiol 67 : 36183629
Torsvik V. & Ovreas L. (2002) Microbial diversity and
function in soil : from genes to ecosystems. Curr Opin Mi-
Takai K., Moser D.P., DeFlaun M., Onstott T.C. &
crobiol 5 : 240245
Fredrickson J.K. (2001b) Archaeal diversity in waters from
deep south african gold mines. Appl Environ Microbiol 67 : Treusch A.H., Kletzin A., Raddatz G., Ochsenreiter
57505760 T., Quaiser A., Meurer G. et al. (2004) Characterization
of large-insert DNA libraries from soil for environmental ge-
Takai K., Nealson K.H. & Horikoshi K. (2004b) Hydro- nomic studies of Archaea. Environ Microbiol 6 : 970980
genimonas thermophila gen. nov., sp. nov., a novel thermo-
philic, hydrogen-oxidizing chemolithoautotroph within the ε- Tringe S.G. & Rubin E.M. (2005) Metagenomics : DNA
Proteobacteria, isolated from a black smoker in a Central In- sequencing of environmental samples. Nature Rev Genet 6 :
dian Ridge hydrothermal eld. Int J Syst Evol Microbiol 805814
54 : 2532
Tringe S.G., von Mering C., Kobayashi A., Salamov
Tang L., Shah S., Chung L., Carney J., Katz L., A.A., Chen K., Chang H.W. et al. (2005) Comparative
Khosla C. et al. (2000) Cloning and heterologous expres- metagenomics of microbial communities. Science 308 : 554
sion of the epothilone gene cluster. Science 287 : 640642 557
258
Bibliographie
Vicente M.F., Basilio A., Cabello A. & Pelaez F. Wirsen C.O., Jannasch H.W. & Molyneaux S.J. (1993)
(2003) Microbial natural products as a source of antifungals. Chemosynthetic microbial activity at Mid-Atlantic Ridge hy-
Clin Microbiol Infect 9 : 1532 drothermal vent sites. J Geophys 98 : 96939703
Voget S., Leggewie C., Uesbeck A., Raasch C., Jaeger Wirsen C.O., Sievert S.M., Cavanaugh C.M., Moly-
K.E. & Streit W.R. (2003) Prospecting for novel biocata- neaux S.J., Ahmad A., Taylor L.T. et al. (2002) Cha-
lysts in a soil metagenome. Appl Environ Microbiol 69 : racterization of an autotrophic sulde-oxidizing marine Ar-
62356242 cobacter sp. that produces lamentous sulfur. Appl Environ
Microbiol 68 : 316325
Von Damm K.L. (2001) Lost City found. Nature 412 :
127128 Woese C.R. (1987) Bacterial evolution. Microbiol Rev 51 :
221271
von Wintzingerode F., Gobel U.B. & Stackebrandt E.
(1997) Determination of microbial diversity in environmen- Woese C.R. & Fox G.E. (1977) Phylogenetic structure of
tal samples : pitfalls of PCR-based rRNA analysis. FEMS the prokaryotic domain : the primary kingdoms. Proc Natl
Microbiol Rev 21 : 213229 Acad Sci USA 74 : 50885090
Voordeckers J.W., Starovoytov V. & Vetriani C. Woese C.R., Kandler O. & Wheelis M.L. (1990) To-
(2005) Caminibacter mediatlanticus sp. nov., a thermophilic, wards a natural system of organisms : proposal for the do-
chemolithoautotrophic, nitrate-ammonifying bacterium iso- mains Archaea, Bacteria, and Eucarya. Proc Natl Acad Sci
lated from a deep-sea hydrothermal vent on the Mid-Atlantic USA 87 : 45764579
Ridge. Int J Syst Evol Microbiol 55 : 7739
Yin B., Crowley D., Sparovek G., De Melo W.J. &
Waksman S.A. & Curtis R.E. (1916) The actinomyces of Borneman J. (2000) Bacterial functional redundancy along
soil. Soil Sci 1 : 99134
a soil reclamation gradient. Appl Environ Microbiol 66 :
43615
Wang G.Y., Graziani E., Waters B., Pan W., Li X.,
McDermott J. et al. (2000) Novel natural products from
Yurkov V.V., Krieger S., Stackebrandt E. & Beatty
soil DNA libraries in a streptomycete host. Org Lett 2 :
J.T. (1999) Citromicrobium bathyomarinum, a novel aerobic
24012404
bacterium isolated from deep-sea hydrothermal vent plume
waters that contains photosynthetic pigment-protein com-
Washio T., Sasayama J. & Tomita M. (1998) Analy-
plexes. J Bacteriol 181 : 45174525
sis of complete genomes suggests that many prokaryotes do
not rely on hairpin formation in transcription termination.
Zbinden M. & Cambon-Bonavita M.A. (2003) Occur-
Nucleic Acids Res 26 : 545663
rence of Deferribacterales and Entomoplasmatales in the
Waters C.M. & Bassler B.L. (2005) Quorum sensing : deep-sea Alvinocarid shrimp Rimicaris exoculata gut. FEMS
cell-to-cell communication in Bacteria. Annual Review of Microbiol Ecol 46 : 2330
Cell and Developmental Biology 21 : 319346
Zbinden M., Le Bris N., Compere P., Martinez I.,
Werner E., Holder A.A. & Hoheisel J.D. (1997) Growth Guyot F. & Gaill F. (2003) Mineralogical gradients asso-
and storage of YAC clones in Hogness freezing medium. Nu- ciated with alvinellids at deep-sea hydrothermal vents. Deep
cleic Acids Res 25 : 14671468 Sea Research Part I : Oceanographic Research Papers 50 :
269280
Whitehead N.A., Barnard A.M., Slater H., Simpson
N.J. & Salmond G.P. (2001) Quorum-sensing in gram- Zehnder A.J. & Brock T.D. (1979) Methane formation
negative bacteria. FEMS Microbiol Rev 25 : 365404 and methane oxidation by methanogenic Bacteria. J Bacte-
riol 137 : 430432
Whitman W.B., Boone D.R. & Koga Y. (2001) Metha-
nocaldococcaceae. In Bergey's Manual of Systematic Bacte- Zengler K., Toledo G., Rappe M., Elkins J., Mathur
riology, Boone D.R., Castenholz R.W. & Garrity G. (eds), E.J., Short J.M. et al. (2002) Cultivating the uncultured.
vol. 1. pp 242-246. 2nd edn. Springer-Verlag, New York Proc Natl Acad Sci USA 99 : 1568115686
Whitman W.B., Coleman D.C. & Wiebe W.J. (1998) Zhao Y., Jeruzalmi D., Moare I., Leighton L., Las-
Prokaryotes : The unseen majority. Proc Natl Acad Sci USA ken R. & Kuriyan J. (1999) Crystal structure of an ar-
95 : 65786583 chaebacterial DNA polymerase. Structure 7 : 118999
259
Bibliographie
260
Résumé
Nos connaissances de la diversité des communautés microbiennes marines ont longtemps été restreintes
aux informations précieuses, mais incomplètes, issues de l'utilisation de méthodes de culture.
Lors de cette étude, des techniques moléculaires (PCR, clonage, séquençage, hybridation, construction
d'une banque métagénomique) et des marqueurs génétiques [ARNr 16S, gènes codants pour des enzymes
spéciques de la voie inverse du cycle tricarboxylique (aclB, oorA)] ont été utilisés pour contourner les
limites inhérentes aux méthodes de culture et accéder à la diversité spécique ainsi qu'aux fonctions des
micro-organismes incultivés des sources hydrothermales profondes.
Ce travail de recherche a permis :
de conrmer l'importance écologique des ε-Proteobacteria dans l'écosystème hydrothermal profond,
notamment dans les processus de colonisation de surfaces vierges exposées aux uides hydrother-
maux,
de mettre au point une sonde oligonucléotidique spécique des ε-Proteobacteria permettant de les
quantier et de les observer dans un échantillon environnemental,
de montrer la présence de bactéries Arcobacter-like vraisemblablement sulfo-oxydantes et qui se-
raient impliquées dans la formation d'un biolm lamenteux contenant essentiellement du soufre,
et d'obtenir via l'approche métagénomique, les premiers fragments génomiques d'Archaea inculti-
vées hydrothermales.
Grâce à l'utilisation combinée de diérentes approches moléculaires, ce travail a permis d'apporter
un nouvel éclairage sur la diversité des communautés microbiennes de l'écosystème hydrothermal marin
profond.