Mar.

Drugs 2006, 4, 119-142

Marine Drugs
ISSN 1660-3397
© 2006 by MDPI
www.mdpi.org/marinedrugs
Special Issue on “Marine Drugs and Ion Channels” Edited by Hugo Arias
Review

Conotoxins: Therapeutic Potential and Application

Richard T. Layer 1,* and J. Michael McIntosh 2

1 Cognetix, Inc., 421 Wakara Way, Suite 201, Salt Lake City, UT 84108, USA
Phone: (801) 581-0400, Fax: (801) 581-9555, E-mail: [email protected]
2 Department of Psychiatry and Department of Biology, University of Utah, 257 S. 1400 E., Salt Lake
City, UT 84112, USA
Phone: (801) 585-3622, Fax: (801) 585-5010, E-mail: [email protected]
* Author to whom correspondence should be addressed.

Received: 30 November 2005 / Accepted: 8 March 2006 / Published: 6 April 2006

Abstract: The pharmacological variety of conotoxins, diverse peptides found in the venoms
of marine cone snails, is well recognized. Venoms from each of the estimated 500 species of
cone snails contain 50 to 200 distinct biologically active peptides. Most conotoxins
characterized to date target receptors and ion channels of excitable tissues, such as ligand-
gated nicotinic acetylcholine, N-methyl-D-aspartate, and type 3 serotonin receptors, as well
as voltage-gated calcium, sodium, and potassium channels, and G-protein-coupled receptors
including α-adrenergic, neurotensin, and vasopressin receptors, and the norepinephrine
transporter. Several conotoxins have shown promise in preclinical models of pain,
convulsive disorders, stroke, neuromuscular block, and cardioprotection. The
pharmacological selectivity of the conotoxins, coupled with the safety and efficacy
demonstrated in preclinical models, has led to their investigation as human therapeutic
agents. In the following review, we will survey the pharmacology and therapeutic rationale
of those conotoxins with potential clinical application, and discuss the unique challenges
that each will face in the course of their transition from venom component to human
therapeutic.
Keywords: conotoxin, conopeptide, cone snail, venom, analgesia
Abbreviations: 5-HT3R, type 3 serotonin receptor;AChR, nicotinic acetylcholine receptor;
CaV, voltage-gated calcium channel; CNS, central nervous system; KV, voltage-gated
potassium channel; NaV, voltage-gated sodium channel; NMDAR, N-methyl-D-aspartate
receptor; TCA, tricyclic antidepressant; TTX, tetrodotoxin.
Mar. Drugs 2006, 4 120

1. Introduction

Since the Cambrian era, predators have developed numerous strategies for finding, incapacitating,
and killing other organisms for nutritional purposes. Of interest to the pharmacologist and physician
are those predators that have developed a strategy of envenomation to overcome their prey. Typical
animal venoms contain complex mixtures of proteins, enzymes, peptides, and low molecular weight
molecules, and represent a rich source of structurally unique, bioactive compounds [1-3]. One group of
venomous animals with a particular talent for developing peptide toxins is the marine mollusks of the
genus Conus, comprising approximately 500 species. Cone snails hunt a diverse array of prey animals,
and specific cone snail species may hunt fish, polychaete worms or other snails. To accomplish this
task, cone snails produce a complex venom composed of peptide toxins, known as conopeptides or
conotoxins, with high selectivity for many of the receptors and ion channels found in their prey [4, 5].
This pharmacological profile, coupled with small size and structural stability, make the conotoxins
promising candidates for development as therapeutic compounds [1, 2, 6-8].
Cone snails produce conotoxins in a venom duct and inject them into prey through a long,
distensible proboscis and finally through a barbed hollow tooth that serves as both harpoon and
hypodermic needle [4, 5]. Each of the 500 different Conus species produces a venom containing 50-
200 different biologically active peptides. Peptides found in one species of cone snail are distinct from
peptides found in other species. Typical conotoxins are small (12-30 amino acids) and exhibit a highly
constrained structure stabilized by intramolecular disulfide bridges and posttranslational modifications.
Conotoxins are typically grouped into families based on sequence homology, cysteine bond structure,
and function [4, 5, 9]. Most families of conopeptides described to date target receptors and ion
channels associated with nervous and muscle tissue. For example, α-conopeptides target specific
subtypes of nicotinic receptors [10], δ-conopeptides delay inactivation [11] whereas µ- and µO-
conopeptides block voltage-gated sodium channels (NaV) [12, 13], σ-conopeptides block type 3
serotonin receptors (5-HT3Rs) [14], ω-conopeptides block subtypes of voltage-gated calcium channels
(CaV) [15, 16], κ- and κA-conopeptides block voltage-gated “Shaker” potassium channels (KV) [17,
18], conantokins inhibit N-methyl-D-aspartate receptors (NMDARs) [19-22], χ-conopeptides inhibit
the norepinephrine transporter [23], conopressins are agonists at vasopressin receptors [24], ρ-
conopeptides inhibit α-adrenergic receptors [25], and contulakin-G is an agonist at neurotensin
receptors [26].
The therapeutic potential of peptide drugs is well recognized, however, endogenous peptides like
the enkephalins are often poor drug candidates due to rapid degradation and poor biodistribution.
While these properties of endogenous peptides are consistent with and essential for their biological
roles as molecular signals, they are problematic properties for therapeutic drugs. In important ways,
the problems faced by physicians intending to use peptides as human therapeutics are similar to the
problems faced by cone snails using peptides to capture their prey. Both groups of users seek to alter
the behavior of excitable tissues in the recipient, and both groups of users encounter obstacles to this
goal. The peptides in each case must enter the body of the recipient, avoid premature metabolism and
excretion, find their way into the physiological space wherein resides the target protein, and produce a
selective action at that target of sufficient duration to accomplish the intended task (producing a
beneficial response in a patient or incapacitating a prey species until digested). In contrast to
Mar. Drugs 2006, 4 121

physicians, cone snails have had the benefit of 50 million years of natural selection to find solutions to
these problems. Thus, relative to endogenous neurotransmitter peptides, many conotoxins are endowed
with superior pharmaceutical properties.
There are, however, important distinctions between a physician’s patient and a cone snail’s prey.
Target proteins in prey species may be similar to target proteins in humans, but small differences may
alter the potency, selectivity, or efficacy of the conotoxin. In addition, the target protein may subserve
functions in a prey species that are distinct from those in a patient, and may be found in protected
physiological spaces of patients, like the central nervous system (CNS). Thus, while conotoxins have
intrinsic properties that may be advantageous with respect to drug development, some clinical
indications will be more amenable to therapy with conotoxins then others. We will review the
pharmacology of those conotoxin families with potential clinical application, and discuss the unique
challenges that each will face in the course of their transition from venom component to human
therapeutic.

2. Therapeutic Applications

2.1. Pain

Great progress has been made in the last 30 years toward understanding the neural substrates of
pain and identifying novel molecular targets for analgesic drug development. Fortuitously, since many
of these targets also figure prominently in the envenomation strategies of cone snails, a number of
conotoxins with analgesic properties have been identified.
Pain is a form of somatic sensation that occurs in response to actual or potential tissue damage (for
review see [27]). Conotoxins act at various locations in the sensory systems that mediate pain,
including the periphery, the spinal levels, and higher CNS centers. The sensation of pain is initiated by
noxious chemicals or extremes of temperature or pressure that activate a variety of proteins in the
terminals of specific peripheral nerve fibers, called nociceptors, resulting in depolarization and the
generation of action potentials. Peripheral nociceptors (thinly myelinated Aδ fibers and unmyelinated
C fibers) have cell bodies in the dorsal root ganglia and trigeminal ganglia and terminate largely in the
various layers comprising the dorsal horn of the spinal cord. Neurotransmitters released from
peripheral nociceptors activate receptors on spinal dorsal horn neurons which project through several
ascending pathways to the brainstem and thalamus and ultimately to the cerebral cortex. In addition,
pain information from peripheral nociceptors is modulated by input from other sensory fibers, local
interneurons, and projections descending from the brain stem.
Pain states fall into two broad categories, acute and chronic. While unpleasant, acute pain is
important for survival. It alerts an organism to important, potentially life threatening problems that
need attention. Acute pain is also transient, and resolves upon either removal of tissue from the
noxious stimulus that is causing the pain, or healing of tissue damaged by the noxious stimulus. Acute
pain, such as pain following surgery, is generally well controlled by existing drugs like nonsteroidal
anti-inflammatory drugs (NSAIDs) and opioids. Chronic pain, in contrast, does not serve an obvious
survival function. It is best considered as a disorder resulting from a dysfunctional reorganization of
the pain system, and persists for long periods of time, often long after an initial injury has healed.
Mar. Drugs 2006, 4 122

Chronic pain syndromes include spinal cord injury pain, low back pain, cancer pain, complex regional
pain syndrome, post herpetic neuralgia, diabetic neuropathy, carpal tunnel syndrome, HIV/AIDS
neuropathy, phantom limb pain, and trigeminal neuralgia. Unfortunately, current treatment strategies
for chronic pain syndromes often lack efficacy or are associated with undesirable side effects. There
remains a great need for effective treatments for chronic pain states. Ideally, new treatments for
chronic pain states will have high anatomic or pharmacologic specificity to avoid the side effects that
limit the use of drugs like opioids. Since some conotoxins have high selectivity for pain targets, and
can be coupled with appropriate administration strategies such as intraspinal infusion or subcutaneous
injection, they are well suited for use as analgesics for chronic pain. One conotoxin has been approved
for use as an analgesic, several other conotoxins are in development, and still more are being explored
for this indication (Table 1). These conotoxins are reviewed below.

Table 1. Amino Acid Sequences of Analgesic Conopeptides.

Name Sequence1 Conus Species

MVIIA CKGKGAKCSRLMYDCCTGSCRSGKC* C. magus
®
(Prialt )
CVID CKSKGAKCSKLMYDCCSGSCSGTVGRC* C. catus
(AM336)
Contulakin-G ZSEEGGSNATgKKPYIL* C. geographus
(CGX-1160)
MrIA NGVCCGYKLCHOC* C. marmoreus
a
(Xen-2174)
Conantokin-G GEXXLQXNQXLIRXKSN* C. geographus
(CGX-1007)
Vc1.1 GCCSDPRCNYDHPEIC* C. victoriae
(ACV-1)
MrVIB ACSKKWEYCIVPILGFVYCCPGLICGPFVCV C. marmoreus
(CGX-1002)
O is 4-trans-hydroxyproline; * indicates amidated C-terminus; Z is pyroglutamate; Tg is threonine with
the disaccharide Gal(β1Æ3)GalNAc(α1Æ) attached; a Xen2174 is a more chemically stable analogue
of MrIA.

2.1.1. Conotoxins acting on Spinal Pain Targets

The dorsal horn of the spinal cord is an important site for processing pain information, and is rich in
analgesic targets for conotoxin drugs. Since the spinal cord, like the rest of the CNS, lies within the
privileged domain protected by the blood-brain-barrier, delivery of conotoxins to the CNS is a
challenge requiring special technology.
An available technology for delivery of conotoxins to the CNS is intrathecal drug infusion.
Intrathecal drug infusion systems utilize fully implantable pumps that continuously deliver drugs
Mar. Drugs 2006, 4 123

through catheters placed into the intrathecal space. Intrathecal drug infusion has been used for several
years and has proven to be safe and effective means for delivering drugs for pain, spasticity and
dystonia, chemotherapeutics, and contrast media for visualizing pathology in patients with spinal
disorders. Since intrathecal infusion requires the surgical implantation of a pump and catheter, this
means of delivery is only used for chronic pain that is unresponsive to orally or intravenously
administered agents. However, intrathecal delivery has several advantages for analgesic drugs. First,
intrathecal delivery concentrates the analgesic drug within the spinal cord where analgesic actions take
place, minimizing concentrations at distant sites in the brain and periphery where side effects are often
mediated [28]. Second, drugs are continuously infused, allowing constant delivery of the minimally
effective drug concentration, and avoiding the fluctuations in drug concentrations typical of
intermittent oral dosing. Third, constant infusion through an implanted pump results in greater patient
compliance.
Despite the advantages of intrathecal infusion, existing intrathecal therapies such as opioids are not
effective in all patients and still have significant side effect profiles. Conotoxins may therefore
represent safe and effective non-opioid intrathecal therapies for the treatment of chronic intractable
pain.

2.1.2. MVIIA (Prialt®)

Nervous systems exist largely to enable organisms possessing them to respond quickly and
appropriately (i.e. in ways that promote their survival) to changes in their environments. Neurons, the
cells that comprise nervous systems, rely on rapid changes in transmembrane electrical potential to
communicate detection of environmental changes and instructions for appropriate response.
Transmembrane electrical potential is controlled by large protein assemblies, called ion channels,
which allow passage of distinct sets of ions into and out of the cell. Critical to this process is the
movement of calcium ions through voltage-gated calcium channels. Calcium channels respond to
decreases in membrane potential (depolarization) by allowing calcium ions to flow into the cell.
Calcium influx is critical for many cellular processes, including the initiation of neurotransmitter
release. A variety of CaV channels exists (including L-, P-, Q-, R-, and N-type channels), each with
distinct protein subunits, physiological and pharmacological properties. N-type CaV channels are
densely localized in the dorsal horn of the spinal cord [29, 30], and are well positioned to modulate the
release of neurotransmitters from primary nociceptive neurons.
MVIIA (at various times also called SNX-111, ziconotide, and most recently, Prialt®) was first
isolated from the venom of C. magus [31] and is a member of the ω-conotoxin family that inhibits
presynaptic neurotransmitter release [32, 33] through blockade of N-type CaV channels [34, 35].
MVIIA has been demonstrated to attenuate nociception in a variety of animal models (for review see
[36]), including models of persistent pain (i.e. the formalin test) [37-39], post-operative pain [40],
chronic inflammatory pain [41], and neuropathic pain [37, 42, 43]. MVIIA was effective in morphine
tolerant rats [44], and prolonged (7 days) intrathecal infusion of MVIIA did not produce tolerance to
its analgesic effects [39, 44].
Based on this preclinical profile, MVIIA has been studied extensively in the clinic. Prior to its
approval by the FDA in December of 2004 for the management of severe chronic pain in patients who
Mar. Drugs 2006, 4 124

are refractory to other analgesic treatments, MVIIA was administered to over 1,200 patients in three
double-blind, placebo controlled multi-center studies and four open label long-term studies [45]. In the
largest reported study, a double-blind, randomized, placebo-controlled trial in 111 cancer or AIDS
patients with treatment refractory chronic pain, intrathecal MVIIA provided clinically and statistically
significant analgesia. Specifically, to be eligible for this study, patients needed to have VASPI (Visual
Analog Scale of Pain Intensity) scores of 50 mm or greater. The VASPI is a pain assessment scale in
which patients rate their pain on a scale of 0 mm (no pain) to 100 mm (worst pain imaginable). Of the
evaluable population, mean VASPI scores improved 53.1% in the MVIIA group and 18.1% in the
placebo group. Five patients receiving MVIIA achieved complete pain relief, and 50.0% of patients
receiving MVIIA responded to therapy compared with 17.5% of those receiving placebo [46]. Clinical
experience with MVIIA has revealed a significant side effect profile for MVIIA, which includes
abnormal gait, dizziness, nystagmus, confusion, somnolence, fever, postural hypotension, urinary
retention, nausea, and vomiting [46]. However, these side effects can be minimized by starting with a
low beginning dose of intrathecal MVIIA followed by a slow titration [45].

2.1.3. CVID (AM336)

While MVIIA is effective, its side effect profile will likely limit its clinical use. CVID, first isolated
from C. catus, represents another ω-conotoxin selective for N-type CaV channels [47]. Consistent with
a role as an antinociceptive drug, CVID was shown to inhibit potassium ion-evoked release of the pro-
nociceptive neurotransmitter, substance P from rat spinal cord slices [48]. Based on its preclinical
profile to date, CVID, also called AM336, may have a superior side effect profile relative to MVIIA,
and is in clinical development for chronic pain management.
CVID was effective in the spinal nerve ligation model of neuropathic pain in the rat, and showed a
higher ratio of efficacy to behavioral toxicity than GVIA and MVIIA [49]. In addition, intrathecal
administration of CVID was effective in a model of chronic inflammatory pain and doses producing
side-effects were 10-fold larger than the doses required to produce antinociception [48]. It is possible
that the greater therapeutic ratio of CVID relative to MVIIA is due to greater selectivity for an N-type
CaV channel variant expressed in preganglionic nerve terminals [50].

The preclinical efficacy of MVIIA and CVID, coupled with the clinical success and FDA approval
of MVIIA, has demonstrated that ω-conotoxins (and conotoxins in general) can be developed as
human therapeutics, and has validated the N-type CaV channel as an important target for future
analgesic development.

2.1.4. Contulakin-G (CGX-1160)

Neurotensin is an endogenous, 13 amino acid neuropeptide that functions as a neurotransmitter in
the CNS and hormone in the periphery. Neurotensin produces a number of effects upon central
administration including hypothermia, modulation of dopamine transmission, and analgesia [51].
Three neurotensin receptor subtypes have been identified, including the G-protein coupled receptors
NTS1 and NTS2, and NTS3, a single transmembrane spanning protein identical to gp95/sortilin [51].
Neurotensin and its receptors are localized in several regions of the CNS including those important for
Mar. Drugs 2006, 4 125

spinal processing of pain information such as the superficial layers of the dorsal horn [52-54] and the
dorsal root ganglia [55]. Intrathecal administration of neurotensin is effective in models of acute pain
[56-58].
CGX-1160 (Contulakin-G) is a synthetic 16 amino acid O-linked glycopeptide originally isolated
from the venom of C. geographus [26]. CGX-1160 appears to be an agonist at neurotensin receptors
since the last six amino acids in the C-terminal portion of CGX-1160 are homologous to those in the
C-terminal portion of neurotensin, CGX-1160 inhibits the binding of [3H]neurotensin to its receptors,
and upon central injection CGX-1160 produces a behavioral syndrome in mice that is similar to that
produced by neurotensin [26].
Interestingly, while neurotensin was a far more potent inhibitor of [3H]neurotensin binding than
CGX-1160 at rat neurotensin receptors rNTR1 and rNTR2, and the mouse neurotensin receptor
mNTR3, CGX-1160 was 1 to 2 orders of magnitude more potent in an in vivo assay (a visually rated
assessment of locomotor activity) following intracerebroventricular administration to mice [26]. This
finding is supported by results in the mouse formalin test, a preclinical model of analgesic efficacy,
indicating that CGX-1160 is more potent than neurotensin by greater than 100-fold [59]. CGX-1160
has subsequently been shown in mice to potently produce full efficacy in models of chronic
inflammatory and neuropathic pain with a wide margin of safety [60]. In rats, intrathecal
administration of CGX-1160 through a chronic lumbar intrathecal catheter was effective in the
formalin test with no changes in motor function or corneal reflexes seen at doses tested [61]. In the
thermal (62.5°C) skin twitch test in dogs, CGX-1160 produced a dose-dependent increase in the skin
twitch latency lasting for approximately 6 h. In this study, no changes in motor function, body
temperature, heart rate, or blood pressure were seen at any dose tested [61]. These results indicate that
intrathecal CGX-1160 has analgesic efficacy in mice, rats, and dogs at doses that do not elicit motor or
cardiovascular side effects.
CGX-1160 has been evaluated in two Phase I clinical trials. The first clinical trial was a randomized,
double-blind, placebo-controlled study to investigate the safety and pharmacokinetics of a single
intravenous infusion of CGX-1160 in healthy volunteers. No serious adverse events occurred and no
subjects discontinued the study due to adverse events. This study demonstrated that CGX-1160 was
safe and well tolerated in this normal healthy population. The second clinical study was an open label,
dose-escalation study designed to investigate the safety, cerebrospinal fluid pharmacokinetics, and
analgesic activity of intrathecally administered CGX-1160 in subjects with central pain following
spinal cord injury. CGX-1160 was well tolerated in this study, and patients reported pain relief, a
reduction in pain intensity, and a decrease or absence of allodynia. While these promising results are
consistent with the results from nonclinical studies, analgesic efficacy remains to be confirmed in
randomized, double-blind, placebo-controlled studies.
2.1.5. MrIA (and Xen-2174)

Descending noradrenergic projections from brain stem nuclei form part of an endogenous pain
control system. These descending neurons release the neurotransmitter norepinephrine and suppress
the activity of nociceptive neurons in the dorsal horn. Inhibition of norepinephrine reuptake has long
been recognized as a strategy for the treatment of neuropathic pain, and tricyclic antidepressants
(TCAs) have been used for this purpose for many years. Unfortunately, many patients are
Mar. Drugs 2006, 4 126

unresponsive to these drugs, or are unable to tolerate their side effects (typically orthostatic
hypotension, dry mouth, and sedation).
Recently, χ-conopeptide MrIA (χ-MrIA), a 13-residue peptide originally isolated from the venom of
C. marmoreus [62], was shown to inhibit the activity of norepinephrine transporter [63]. This
inhibition was selective, since χ-MrIA had no effect on the activity of the dopamine or serotonin
transporters [23]. The binding site χ-MrIA appears to overlap with that for TCAs, since the
conopeptide competitively inhibited the binding of [3H]nisoxetine and [3H]mazindol to the expressed
rat and human norepinephrine transporter [23]. However, a comparison of the interactions of χ-MrIA,
desipramine, and cocaine with human norepinephrine transporter mutants revealed that while the
binding sites overlap, they are not identical [64]. The solution structure of χ-MrIA has also been
determined using NMR spectroscopy [65].
Consistent with its mechanism of action, χ-MrIA has been shown to produce analgesia in several
preclinical pain models. The conopeptide produced potent and dose-dependent analgesia in the hot
plate test following intrathecal administration, at doses that did not produce motor impairment as
measured by the rotarod test [62]. Intrathecal χ-MrIA also reduced mechanical allodynia in rats with a
chronic constriction injury of the sciatic nerve, a model of neuropathic pain [66].
Although the sequence has not been made public, Xen2174 is a more chemically stable analogue of
χ-MrIA that also inhibits the norepinephrine transporter. Intrathecal Xen2174 reversed the mechanical
allodynia induced in rats in two models of neuropathic pain, the chronic constriction injury of the
sciatic nerve and the L5/L6 spinal-nerve injury. At doses that reversed the allodynia, side-effects were
mild for both χ-MrIA and Xen2174 [66]. Intrathecal administration of Xen2174 also reduced the
tactile hypersensitivity that develops following paw incisional surgery in rats, a model of post-
operative pain. Finally, these data suggest that intrathecal administration of Xen2174 at the time of
spinal anesthesia might produce postoperative analgesia in humans [67]. These results suggest that χ-
conopeptides may represent a new treatment for post-operative pain, and, due to their selectivity, may
provide relief to some chronic pain patients with fewer side effects than conventional TCAs like
nortriptyline and desipramine. These results also demonstrate that chemical stability limitations of
some natural conotoxins (like χ-MrIA) can be circumvented by the synthesis of more stable analogs
(like Xen2174).

2.1.6. Conantokins (i.e. CGX-1007)

NMDA receptors comprise a large family of heterooligomeric ligand-gated ion channels that
contain multiple, allosterically coupled recognition sites for the neurotransmitter glutamate, the co-
neurotransmitter glycine, as well as for polyamines, ions and use-dependent channel blockers (for
review see [68]). Activation of NMDARs expressed on neurons results initially in calcium influx,
which subsequently can influence gene activation, neuronal survival, axon outgrowth, and synaptic
strength. Activation of NMDARs also plays a major role in central sensitization, a phenomenon
initiated by excessive activity of peripheral nociceptors (such as occurs following nerve or tissue
injury) and a major component of chronic pain states [69]. Native NMDARs are composed of subunits
from three families, NR1 (a single subunit with eight known splice variants), NR2 (four different
subunits: NR2A, NR2B, NR2C and NR2D), and NR3, with different subunit compositions resulting in
Mar. Drugs 2006, 4 127

different functional and pharmacological characteristics [70-72] (for more details see the introductory
minireview by Arias in this special issue). In addition, distinct NMDARs comprised of different
subunits display more restricted tissue distributions [73-76]. The development of selective inhibitors
for distinct subtypes of NMDARs represents a promising strategy for the development of NMDAR
antagonists with improved efficacy and side effect profiles.
NMDAR antagonists are effective in animal models of peripheral tissue or nerve injury, and have
demonstrated efficacy in man, however, unacceptable side effects have limited their use. Recently, due
to a more favorable side effect profile, antagonists with selectivity for NMDARs containing NR2B
subunits have emerged as potential treatments for persistent pain states [77]. One reason for the
improved therapeutic index of NR2B selective antagonists may be the more restricted localization of
the NR2B subunit to nociceptive primary afferents (sensory neurons carrying pain information) and
the neurons of dorsal horn [78, 79].
The conantokins are a novel family of post-translationally modified, small peptide (17-27 amino
acids long) antagonists of the NMDAR that are found in a variety of cone snail venoms and exhibit a
range of potencies and selectivities at distinct NMDARs [80]. Conantokin-G (also referred to as CGX-
1007), the most extensively characterized conantokin, selectively inhibits NMDARs containing the
NR2B subunit [81, 82].
Conantokins-G and -T were effective in several mouse models of persistent pain (formalin test),
chronic inflammatory (complete Freund’s adjuvant induced allodynia), and neuropathic pain (partial
sciatic nerve ligation allodynia) [83]. In the formalin test, for both conantokin-G and conantokin-T the
effective dose (ED50) was well below the toxic dose (TD50), and efficacy was observed for four hours
after administration [83]. These data indicate that the conantokins represent a class of NMDAR
inhibitors with potential utility in the control of chronic pain states with fewer side effects relative to
non-subtype selective NMDAR antagonists.
Anticonvulsant drugs are often used in the treatment of chronic pain. Furthermore, in addition to
their major role in initiating and sustaining pain states, the release of glutamate and subsequent
activation of NMDARs also play critical roles in the initiation and propagation of seizure activity.
Accordingly, the conantokins have also been shown to be effective anticonvulsants in a variety of
preclinical models of seizure disorders. In Frings audiogenic seizure susceptible (AGS) mice,
intracerebroventricular administration of either conantokin-G or -R potently suppressed audiogenic
seizures at doses that did not impair rotorod performance [84, 85]. In CF#1 mice,
intracerebroventricular administration of either conantokin-G or -R was effective in suppressing
seizures induced by threshold tonic extension, maximal electroshock, and subcutaneous
pentylenetetrazol. Anticonvulsant effects occurred at doses well below those that produce rotarod
impairment [84, 85]. Conantokin-G was also effective in suppressing seizures induced by
subcutaneous picrotoxin and subcutaneous bicuculline [85]. Furthermore, chronic infusion of
conantokin-G in Frings AGS mice for 28 days via an osmotic pump system produced no cumulative
toxicity or tolerance to the anticonvulsant effect [85]. In rats, conantokin-G blocked maximal
electroshock seizures and fully expressed corneal-kindled seizures, but failed to prevent the acquisition
of corneal-kindled seizures [85]. In amygdala kindled rats, conantokin-G dose dependently blocked the
expression of secondarily generalized seizures, while another NR2B selective NMDAR antagonist, CI-
1041, was ineffective [86]. Similar to the results in corneal-kindled rats, neither conantokin-G nor CI-
Mar. Drugs 2006, 4 128

1041 were able to prevent or delay acquisition of amygdala kindling [86]. Overall, these studies
indicate that conantokins display a broad efficacy profile in experimental models of both pain and
seizure disorders with a larger separation between effective and toxic doses than other NMDAR
antagonist drugs.

2.1.7. Conotoxins Acting on Systemic Pain Targets

Not all analgesic conotoxins will require intrathecal delivery. A variety of pain targets exist in the
periphery, and conotoxin families that interact with these targets have been identified. Since these
targets are accessible following parenteral routes of administration such as intravenous, subcutaneous,
and intramuscular administration. Appropriate coupling with sustained release formulations or chronic
parenteral delivery devices would make sustained delivery of conotoxins medically feasible.

2.1.8. Vc1.1 (ACV-1)

Neuronal nicotinic receptors (AChRs), ligand-gated ion channels composed of pentameric

assemblies of α (α2 through α10) and β (β2 through β4) subunits, are expressed in many regions of
the central and peripheral nervous systems, and are known to play an important role in modulating
pain pathways. Nicotinic agonists such as epibatidine (originally isolated from the skin of the
Ecuadorian tree frog, Epipedobates tricolor), and its analogs like ABT-594 produce antinociception in
animal models [87, 88], and mice lacking α4 and β2 subunits demonstrate reduced antinociception in
response to administration of nicotinic agonists [89].
Many species of cone snails utilize antagonists of neuronal AChRs in their venoms [90]. The largest
family of conopeptides targeting the neuronal AChR is the α-conopeptides [91]. Interestingly, an α-
conopeptide from C. victoriae, Vc1.1 (ACV-1), shows potent analgesia in a number of animal models.
Like other α-conopeptides, Vc1.1 inhibits the binding of [3H]epibatidine to neuronal AChRs and
inhibits nicotine-induced catecholamine release from bovine adrenal chromaffin cells [92]. Local
perfusion of Vc1.1 into the footpads of rats was also able to inhibit the vascular inflammatory response
activated by antidromic electrical stimulation of C-fibers, suggesting an ability to inhibit C-fiber
function [92]. It is possible that Vc1.1 is inhibiting C-fiber function through an action on the neuronal
AChRs that are found on C-fibers, including human C-fibers [93].
In in vivo studies, intramuscular injection of Vc1.1 suppressed pain behaviors (mechanical
hyperalgesia) in two rat models of neuropathic pain, the chronic constriction injury model and the
partial sciatic nerve ligation model. Seven days of treatment with Vc1.1 (after the development of
hyperalgesia) resulted in a reduction of mechanical hyperalgesia in both models for up to a week
following cessation of treatment. Vc1.1 also accelerated functional recovery of injured neurons as
measured by the ability of the terminals to mount an inflammatory vascular response upon perfusion of
the blister base (raised over the footpad innervated by the injured nerve) with substance P [94].

2.1.9. Conotoxin Inhibitors of Voltage-Gated Sodium Channels

NaV channels control membrane excitability in neurons by allowing sodium ions to enter the cell,
resulting in depolarization and propagation of action potentials. The family of NaV channels comprises
Mar. Drugs 2006, 4 129

a variety of related proteins with distinct physiological and pharmacological properties. NaV channel
subtypes also differ in their tissue expression patterns, with specific subtypes localized to brain regions,
skeletal muscle, peripheral neurons, and heart. Local anesthetic drugs work by blocking these channels
and interrupting the flow of action potentials in neurons carrying nociceptive (and other sensory)
information from the periphery to the CNS. Local anesthetics also produce toxic side effects by
interacting with sodium channels in non-nervous tissue such as cardiovascular muscle.
Certain NaV channel subtypes are expressed selectively in nociceptors, and represent attractive
targets for drug development. These subtypes include the tetrodotoxin (TTX)-resistant subtypes
NaV1.8 and NaV1.9, the TTX-sensitive subtype NaV1.7, as well as NaV1.3, a TTX-sensitive channel
that up-regulates in damaged peripheral nerves (for review see [95]). The development of compounds
with improved selectivity at these specific NaV channels is proceeding rapidly (see reviews in this
special issue) and holds great promise toward the treatment of a variety of pain states.
Several conotoxins have been identified that interact with these NaV channel subtypes that are
expressed selectively in nociceptors. The µO-conotoxins MrVIA and MrVIB, from C. marmoreus,
inhibit transient TTX-resistant sodium current in rat dorsal root ganglion neurons, as well as TTX-
sensitive sodium currents [96]. The µ-conotoxins SIIIA (from C. striatus), KIIIA (from C. kenoshitai),
and SmIIIA (from C. stercusmuscarum) inhibit TTX-resistant sodium currents in neurons from frog
sympathetic and dorsal root ganglia but only poorly block action potentials in frog skeletal muscle that
are mediated by TTX-sensitive sodium channels [97, 98]. Finally, crude venom from C. ventricosus is
able to produce a selective block of TTX-resistant NaV1.8 currents in rat dorsal root ganglion neurons
[95]. These studies indicate that sodium channel-inhibiting conotoxins may represent systemically
active analgesic candidates.

2.2. Stroke

Stroke is a leading cause of death and adult disability, including cognitive and functional
impairment, in the United States and around the world. Despite intensive research, the development of
safe and effective drugs for the treatment of stroke has yet to meet with much clinical success. The
cognitive and functional impairment that follows ischemic stroke results from occlusion of blood
vessels in the brain, often a consequence of atherosclerotic plaque formation or blood clots originated
in the heart. Blood vessel occlusion results in loss of oxygen and glucose supply, depletion of brain
ATP, and the consequent loss of ability to maintain and restore ionic gradients in neurons. As neurons
depolarize, intracellular calcium concentrations rise to toxic levels, glutamate is released and
extracellular glutamate increases, and the cycle of depolarization is exacerbated. Neurons in the core
of the infarcted region swell and burst, resulting in the initiation of inflammatory processes. The death
of cells in the core of the infarct initiates a progressive series of degenerative events, including
secondary apoptotic processes, in the neuronal tissue surrounding the core (the penumbra). The
neuronal damage and cell death originally confined to the core expands over time to the much larger
surrounding penumbral region.
Since calcium influx through both CaV channels and NMDARs has been implicated in neuronal loss
following ischemic stroke, compounds that inhibit these targets remain promising candidates for stroke
treatment. ω-Conotoxins and conantokins inhibit CaV channels and NMDARs respectively, and have
Mar. Drugs 2006, 4 130

shown efficacy in animal models of stroke. Importantly, these peptides can be administered via acute
bolus injections or systemic infusions, both feasible approaches to drug delivery upon diagnosis of
acute stroke. These studies are reviewed below.

2.2.1. MVIIA (Prialt®)

The synthetic ω-conotoxin MVIIA is effective in a variety of preclinical models of stroke (reviewed
in [36]). Intravenous administration of MVIIA was neuroprotective in a model of transient forebrain
ischemia, the rat model of four-vessel occlusion, even when administered 24 h after ischemia [99, 100].
Similarly, intravenous administration of MVIIA was neuroprotective in the rat middle cerebral artery
occlusion (MCAo) model of focal cerebral ischemia [99, 101], and in a rabbit model of focal cerebral
ischemia [102].
In rats with permanent occlusions of the right middle cerebral and right common carotid arteries
and transient occlusion of the left common carotid artery, intravenous infusion of MVIIA reduced the
cortical volume of infarction as well as the amount of extracellular glutamate [103]. Based on these
results, a phase I safety study of intravenous MVIIA in healthy volunteers was performed [104]. The
major side effect observed in this study was orthostatic hypotension. Phase II neuroprotective efficacy
trials of MVIIA were suspended [36].

2.2.2. Conantokins (i.e. CGX-1007)

Activation of NMDARs is also a critical contributor to the dangerous rise in intracellular calcium
concentrations during ischemia. While NMDAR antagonists have been successful in animal models of
stroke (focal ischemia), they have demonstrated a lack of efficacy or unacceptable levels of side effects
in the clinic [105, 106]. Despite these results, studies in animal models of stroke suggest that
conantokins may still be effective in the clinic.
The most extensively studied conantokin, conantokin-G (also called CGX-1007), produced a dose-
dependent and complete neuroprotection of primary cultures of rat cerebellar neurons against neuronal
injury produced by hypoxia/hypoglycemia, NMDA, glutamate, or veratridine [107]. Subsequently,
intracerebroventricular administration of conantokin-G provided significant neuroprotection in the rat
MCAo model of focal cerebral ischemia, along with significant improvement in neurological score at
24 h post-occlusion [107]. Intrathecal delivery represents a more feasible route of administration in an
emergency room situation following a stroke. In the rat MCAo model of focal cerebral ischemia,
intrathecal administration of conantokin-G reduced infarct volume assessed at 24 h post-occlusion.
Moreover, intrathecal administration of conantokin-G beginning at 8 h post-occlusion also
significantly reduced core infarct size and improved the neurological score [108].
One possible explanation for the clinical failure of some NMDAR antagonists in stroke trials is an
inability to reduce secondary apoptotic processes that lead to delayed cell death. The protein kinase
inhibitor staurosporine induces apoptotic cell death in primary cultures of rat forebrain neurons,
defined morphologically by cell shrinkage, chromatin condensation, and appearance of apoptotic
bodies. In primary cultures of rat forebrain neurons, conantokin-G inhibited staurosporine-induced cell
damage [109]. Changes in gene expression may also contribute to delayed cell death following
Mar. Drugs 2006, 4 131

ischemic brain injury. Intracerebroventricular administration of conantokin-G reduced the expression

of c-fos mRNA (a gene associated with delayed cell death), increased Bcl-2 immunoreactivity (an anti-
apoptotic gene), and reduced DNA fragmentation (a hallmark of apoptosis), following occlusion of the
middle cerebral artery in rats [110].
The ability of conantokin-G to reduce core infarct size in rats when given up to 4 to 8 h post-
occlusion [107, 108], coupled with the unique ability (relative to non-selective NMDAR antagonists
like MK-801) to reduce staurosporine-induced apoptotic cell death [109], and the ability to up-regulate
the expression of the anti-apoptotic protein Bcl-2 [110], indicates that conantokins may represent an
important therapeutic tool in the treatment of ischemic stroke, and should theoretically be effective in
hemorrhagic stroke where current “clot-busting” drugs are contraindicated.
Since conantokin-G is effective in animal models of stroke, reduces staurosporine-induced
apoptotic cell death, up-regulates the expression of the anti-apoptotic protein Bcl-2, and exhibits a
favorable preclinical safety profile, conantokins may represent promising compounds for use in the
acute treatment of stroke.

2.3. Neuromuscular Block

Neuromuscular blocking drugs inhibit the actions of acetylcholine on AChRs of the neuromuscular
junction through either depolarization block (i.e., succinylcholine) or competitive antagonism (i.e., d-
tubocurarine). They are used to provide muscle relaxation during surgery, to facilitate positive pressure
ventilation during and after anesthesia in the intensive care unit, and to facilitate tracheal intubation
[111]. Neuromuscular blocking drugs facilitate tracheal intubation by relaxing the muscles of the
larynx. Many situations, including trauma, emergency cesarean section, crises in intensive care, and
unconscious patients at risk for vomiting and aspiration, require rapid protection of the airway by
tracheal intubation to insure adequate ventilation. Due to its fast onset and short duration of action,
succinylcholine is the drug of choice for facilitating tracheal intubation. Unfortunately, succinylcholine
also elicits many undesirable side effects including fasciculations (rippling, uncoordinated muscle
contraction), postoperative muscle pain, hyperkalemia (which can elicit severe cardiovascular
consequences), vagally mediated bradycardia, histamine-induced hypotension and anaphylaxis, and a
life threatening malignant hyperthermia. There is therefore a major need for alternatives to
succinylcholine.
The primary paralytic toxins in fish hunting cone snails of the Indo-Pacific region comprise a
subclass of the α-conopeptides. Known as α3/5 conotoxins, they are characterized structurally by two
conserved disulphide bridges which form two loops of three and five amino acids (Table 2). They
produce immobilization of prey through highly selective competitive inhibition of AChRs of the
neuromuscular junction [90]. The α3/5 conotoxins display distinct binding site selectivity despite a
relatively high degree of homology. For example, conopeptides MI and GI are ~10,000 times more
potent for the α/δ interface than for the α/γ interface mammalian neuromuscular AChRs. Conopeptide
SI, on the other hand, is less potent and does not distinguish between these two agonist/competitive
antagonist binding sites [112-115]. At nicotinic receptors from Torpedo electric organ, the selectivity
of α-conopeptide MI is reversed, with much higher affinity for the α/γ interface [113, 114]. Due to
their selectivity and mechanism of competitive blockade, the α3/5 conotoxins may represent new
Mar. Drugs 2006, 4 132

neuromuscular blocking drugs that lack the side-effects of depolarizing neuromuscular blockers like
succinylcholine.

Table 2. Amino Acid Sequences of some α3/5-Conotoxins.

Name Sequence1 Conus Species

GI ECCNPACGRHYSC* C. geographus

MI GRCCHPACGKNYSC* C. magus

SI ICCNPACGPKYSC* C. striatus
1
The disulphide connectivity is C1-C3, C2-C4. * indicates amidated C terminus.

In anaesthetized cats, α-conopeptides GI and MI have previously been shown to produce

neuromuscular blockade at doses of 20-80 µg/kg. Both were rapidly reversed by the
acetylcholinesterase inhibitor neostigmine. At doses that produced neuromuscular blockade, neither
MI or GI had effects on arterial blood pressure, heart rate, or responses to vagal and preganglionic
stimulation [116]. In addition, GI competitively blocked AChRs at neuromuscular junctions in the rat
sciatic nerve-gastrocnemius muscle and frog abdominal muscle preparations. In this study, GI did not
produce ganglionic blockade in the parasympathetic ganglion, or an anti-muscarinic effect [117].
These results further indicate the specificity of the α3/5 conopeptides for nicotinic receptors of the
neuromuscular junction.
While hundreds of neuromuscular blocking drugs have been synthesized since the first clinical use
of d-tubocurarine in 1942 [118], none are ideal, particularly for facilitating intubation. The properties
of α3/5 conopeptides, however, have led to speculation that their analogs might represent rapidly
biodegradable drugs which permit the use of high doses in order to gain rapid onset of action [119].
Importantly, the α3/5 conopeptides are effective following acute intravenous injection, which is how
the current generation of neuromuscular blocking drugs are administered. Since the therapeutic goal is
a quick acting agent of short duration, potential susceptibility to peptidase degradation and rapid
systemic clearance are advantages rather than liabilities.

2.4. Cardioprotection

Acute myocardial infarction occurs when the blood supply to a part of the heart muscle
(myocardium) is stopped. Often this is a result of a coronary thrombosis. Coronary thombosis occurs
when atherosclerotic plaques tear and trigger the formation of blood clots that block the coronary
artery. The major treatment goal is to limit the size of the infarction by restoring the blood supply to
the myocardium (reperfusion). This is currently accomplished pharmacologically with thrombolytic
drugs or surgically through percutaneous coronary intervention in the catheterization laboratory.
Despite these treatments, acute myocardial infarction resulting from coronary heart disease is a leading
cause of death in the world. There is therefore a major need for drugs which can complement
thrombolytic therapy or catheterization and further reduce the size of an infarction. Many drugs have
Mar. Drugs 2006, 4 133

been demonstrated in preclinical models to limit infarct size. Unfortunately, these drugs either do not
reduce infarct size when given after initiation of ischemia, or are associated with hypotension, and are
therefore of limited usefulness in the clinic.
κ-PVIIA, also called CGX-1051, is a 27 amino acid conopeptide originally isolated from the venom
of C. purpurascens [17] that blocks KV “Shaker” channels with high affinity [17, 120, 121]. In rabbits,
rats, and dogs, acute intravenous administration of κ-PVIIA substantially reduces infarct size in
models of acute myocardial infarction. Specifically, in rabbits, intravenous administration of κ-PVIIA
5 min before a 3 h reperfusion reduced the size of a myocardial infarct following a 30 min occlusion of
a branch of the left coronary artery. The cardioprotection produced by κ-PVIIA was sustained even
when reperfusion was permitted to last for 72 h, indicating that the peptide prevents, rather than delays,
the loss of myocardium [122]. In rats, intravenous administration of κ-PVIIA 5 min before a 3 h
reperfusion reduced the size of a myocardial infarct following a 25 min occlusion of the left coronary
artery [123]. Finally, in dogs, intravenous administration of κ-PVIIA 5 min before a 3 h reperfusion
reduced the size of a myocardial infarct following a 60 min occlusion of a branch of the left anterior
descending coronary artery [123]. Administration of κ-PVIIA caused no adverse alterations in
cardiovascular hemodynamics at any dose tested in rabbits, rats, or dogs [122, 123].
While the mechanism underlying the cardioprotective efficacy of κ-PVIIA is unclear, it is unlikely
to depend on circulating leukocytes since the peptide reduced infarct size in crystalloid-perfused,
isolated rabbit hearts [122]. In addition, prior administration of either the mitochondrial KATP
inhibitors glibenclamide or 5-hydroxydecanoate reversed the ability of κ-PVIIA to reduce infarct size
in rabbits. Likewise, prior administration of the MEK1/2 inhibitor PD 98059 also reversed the effect of
κ-PVIIA indicating that functionally active mitochondrial KATP channels and extracellular receptor
kinase (ERK) are necessary for protection [122].
Based on these preclinical results, κ-PVIIA may represent a valuable adjunct to coronary artery
thrombolytic therapy and percutaneous transluminal coronary angioplasty in the management of acute
myocardial infarction. Importantly, κ-PVIIA is effective following acute intravenous injection just
before the time of reperfusion. It remains to be seen if continuous intravenous infusion is more
effective, but either mode of administration is feasible upon diagnosis of myocardial infarction and
initiation of steps to restore cardiac perfusion.

3. Conclusions

The pharmacological variety of the conotoxins found in the venoms of marine cone snails, and their
synthetic analogs, is well recognized. The ability of many conotoxins to distinguish between closely
related subtypes of target proteins has led to their widespread use as pharmacological tools. Most
conotoxins characterized to date target receptors and ion channels of excitable tissues, including such
diverse targets as ligand-gated AChRs, NMDARs, and 5-HT3Rs, as well as CaV, NaV, and KV channels,
G-protein-coupled receptors including α-adrenergic, neurotensin, and vasopressin receptors, and the
norepinephrine transporter. Several conotoxins have shown promise in preclinical models of pain,
convulsive disorders, stroke, neuromuscular block, and cardioprotection. Despite their promise in these
models, conotoxins possess some characteristics, like size, charge, and susceptibility to peptidase
degradation that can limit their clinical usefulness. However, when combined with appropriate
Mar. Drugs 2006, 4 134

delivery technologies, such as intrathecal infusion or acute intravenous injection, conotoxins emerge as
very promising strategies for the treatment of a variety of human pathologies. Moreover, conotoxin
selectivity is useful in the validation of clinical targets, like the N-type CaV channel for neuropathic
pain. The unique pharmacological profiles of the conotoxins, adapted over millions of years as
synergistic components of a sophisticated envenomation strategy, coupled with their safety and
efficacy as demonstrated in preclinical models, has led to their investigation as human therapeutic
agents. The recent approval by the FDA of MVIIA (Prialt®) for chronic pain indicates that the
pharmaceutical challenges posed by conotoxins are surmountable, and holds out the hope that other
safe and effective treatments for human pathologies remain to be found in the venom ducts of marine
snails.

References

1. Bogin, O. Venom Peptides and their Mimetics as Potential Drugs. Modulator 2005, 19, 14-20.
2. Lewis, R. J.; Garcia, M. L. Therapeutic potential of venom peptides. Nat. Rev. Drug Discov. 2003,
2, 790-802.
3. Rash, L.; Hodgson, W. Pharmacology and biochemistry of spider venoms. Toxicon 2002, 40, 225-
254.
4. Olivera, B. M.; Rivier, J.; Clark, C.; Ramilo, C. A.; Corpuz, G. P.; Abogadie, F. C.; Mena, E. E.;
Woodward, S. R.; Hillyard, D. R.; Cruz, L. J. Diversity of Conus neuropeptides. Science 1990,
249, 257-263.
5. Terlau, H.; Olivera, B. M. Conus venoms: a rich source of novel ion channel-targeted peptides.
Physiol. Rev. 2004, 84, 41-68.
6. Livett, B. G.; Gayler, K. R.; Khalil, Z. Drugs from the sea: conopeptides as potential therapeutics.
Curr. Med. Chem. 2004, 11, 1715-1723.
7. McIntosh, J. M.; Jones, R. M. Cone venom--from accidental stings to deliberate injection.
Toxicon 2001, 39, 1447-1451.
8. Shen, G. S.; Layer, R. T.; McCabe, R. T. Conopeptides: From deadly venoms to novel
therapeutics. Drug Discov. Today 2000, 5, 98-106.
9. Jones, R. M.; Bulaj, G. Conotoxins - new vistas for peptide therapeutics. Curr. Pharm. Des. 2000,
6, 1249-1285.
10. Myers, R. A.; Zafaralla, G. C.; Gray, W. R.; Abbott, J.; Cruz, L. J.; Olivera, B. M. alpha-
Conotoxins, small peptide probes of nicotinic acetylcholine receptors. Biochemistry 1991, 30,
9370-9377.
11. Shon, K. J.; Hasson, A.; Spira, M. E.; Cruz, L. J.; Gray, W. R.; Olivera, B. M. Delta-conotoxin
GmVIA, a novel peptide from the venom of Conus gloriamaris. Biochemistry 1994, 33, 11420-
11425.
12. McIntosh, J. M.; Hasson, A.; Spira, M. E.; Gray, W. R.; Li, W.; Marsh, M.; Hillyard, D. R.;
Olivera, B. M. A new family of conotoxins that blocks voltage-gated sodium channels. J. Biol.
Chem. 1995, 270, 16796-16802.
Mar. Drugs 2006, 4 135

13. Cruz, L. J.; Kupryszewski, G.; LeCheminant, G. W.; Gray, W. R.; Olivera, B. M.; Rivier, J. mu-
conotoxin GIIIA, a peptide ligand for muscle sodium channels: chemical synthesis, radiolabeling,
and receptor characterization. Biochemistry 1989, 28, 3437-3442.
14. England, L. J.; Imperial, J.; Jacobsen, R.; Craig, A. G.; Gulyas, J.; Akhtar, M.; Rivier, J.; Julius,
D.; Olivera, B. M. Inactivation of a serotonin-gated ion channel by a polypeptide toxin from
marine snails. Science 1998, 281, 575-578.
15. Olivera, B. M.; McIntosh, J. M.; Cruz, L. J.; Luque, F. A.; Gray, W. R. Purification and sequence
of a presynaptic peptide toxin from Conus geographus venom. Biochemistry 1984, 23, 5087-5090.
16. McCleskey, E. W.; Fox, A. P.; Feldman, D. H.; Cruz, L. J.; Olivera, B. M.; Tsien, R. W.;
Yoshikami, D. Omega-conotoxin: direct and persistent blockade of specific types of calcium
channels in neurons but not muscle. Proc. Natl. Acad. Sci. U. S. A. 1987, 84, 4327-4331.
17. Shon, K. J.; Stocker, M.; Terlau, H.; Stuhmer, W.; Jacobsen, R.; Walker, C.; Grilley, M.; Watkins,
M.; Hillyard, D. R.; Gray, W. R.; Olivera, B. M. kappa-Conotoxin PVIIA is a peptide inhibiting
the shaker K+ channel. J. Biol. Chem. 1998, 273, 33-38.
18. Craig, A. G.; Zafaralla, G.; Cruz, L. J.; Santos, A. D.; Hillyard, D. R.; Dykert, J.; Rivier, J. E.;
Gray, W. R.; Imperial, J.; DelaCruz, R. G.; Sporning, A.; Terlau, H.; West, P. J.; Yoshikami, D.;
Olivera, B. M. An O-Glycosylated Neuroexcitatory Conus Peptide. Biochemistry 1998, 37,
16019-16025.
19. Jimenez, E. C.; Donevan, S.; Walker, C.; Zhou, L. M.; Nielsen, J.; Cruz, L. J.; Armstrong, H.;
White, H. S.; Olivera, B. M. Conantokin-L, a new NMDA receptor antagonist: determinants for
anticonvulsant potency. Epilepsy Res. 2002, 51, 73-80.
20. Haack, J. A.; Rivier, J.; Parks, T. N.; Mena, E. E.; Cruz, L. J.; Olivera, B. M. Conantokin-T. A
gamma-carboxyglutamate containing peptide with N-methyl-d-aspartate antagonist activity. J.
Biol. Chem. 1990, 265, 6025-6029.
21. McIntosh, J. M.; Olivera, B. M.; Cruz, L. J.; Gray, W. R. Gamma-carboxyglutamate in a
neuroactive toxin. J. Biol. Chem. 1984, 259, 14343-14346.
22. White, H. S.; McCabe, R. T.; Armstrong, H.; Donevan, S. D.; Cruz, L. J.; Abogadie, F. C.; Torres,
J.; Rivier, J. E.; Paarmann, I.; Hollmann, M.; Olivera, B. M. In vitro and in vivo characterization
of conantokin-R, a selective NMDA receptor antagonist isolated from the venom of the fish-
hunting snail Conus radiatus. J. Pharmacol. Exp. Ther. 2000, 292, 425-432.
23. Sharpe, I. A.; Palant, E.; Schroeder, C. I.; Kaye, D. M.; Adams, D. J.; Alewood, P. F.; Lewis, R. J.
Inhibition of the norepinephrine transporter by the venom peptide chi-MrIA. Site of action, Na+
dependence, and structure-activity relationship. J. Biol. Chem. 2003, 278, 40317-40323.
24. Cruz, L. J.; de Santos, V.; Zafaralla, G. C.; Ramilo, C. A.; Zeikus, R.; Gray, W. R.; Olivera, B. M.
Invertebrate vasopressin/oxytocin homologs. Characterization of peptides from Conus geographus
and Conus straitus venoms. J. Biol. Chem. 1987, 262, 15821-15824.
25. Sharpe, I. A.; Thomas, L.; Loughnan, M.; Motin, L.; Palant, E.; Croker, D. E.; Alewood, D.; Chen,
S.; Graham, R. M.; Alewood, P. F.; Adams, D. J.; Lewis, R. J. Allosteric alpha 1-adrenoreceptor
antagonism by the conopeptide rho-TIA. J. Biol. Chem. 2003, 278, 34451-34457.
26. Craig, A. G.; Norberg, T.; Griffin, D.; Hoeger, C.; Akhtar, M.; Schmidt, K.; Low, W.; Dykert, J.;
Richelson, E.; Navarro, V.; Mazella, J.; Watkins, M.; Hillyard, D.; Imperial, J.; Cruz, L. J.;
Mar. Drugs 2006, 4 136

Olivera, B. M. Contulakin-G, an O-glycosylated invertebrate neurotensin. J. Biol. Chem. 1999,

274, 13752-13759.
27. Basbaum, A. I.; Jessell, T. M. The Perception of Pain. Principles of Neural Science; Fourth ed.;
McGraw-Hill: New York, 2000; pp 472-491.
28. Gokin, A.; Strichartz, G. Local anesthetics acting on the spinal cord. Spinal Drug Delivery;
Elsevier Science: Amsterdam, 1999; pp 477-501.
29. Westenbroek, R. E.; Hoskins, L.; Catterall, W. A. Localization of Ca2+ channel subtypes on rat
spinal motor neurons, interneurons, and nerve terminals. J. Neurosci. 1998, 18, 6319-6330.
30. Gohil, K.; Bell, J. R.; Ramachandran, J.; Miljanich, G. P. Neuroanatomical distribution of
receptors for a novel voltage-sensitive calcium-channel antagonist, SNX-230 (omega-conopeptide
MVIIC). Brain Res. 1994, 653, 258-266.
31. Olivera, B. M. Omega Conotoxin MVIIA: From Marine Snail Venom to Analgesic Drug. Drugs
from the Sea; Karger: Basel, 2000; pp 74-85.
32. Yeager, R. E.; Yoshikami, D.; Rivier, J.; Cruz, L. J.; Miljanich, G. P. Transmitter release from
presynaptic terminals of electric organ: inhibition by the calcium channel antagonist omega Conus
toxin. J. Neurosci. 1987, 7, 2390-2396.
33. Kerr, L. M.; Yoshikami, D. A venom peptide with a novel presynaptic blocking action. Nature
1984, 308, 282-284.
34. Olivera, B. M.; Cruz, L. J.; de Santos, V.; LeCheminant, G. W.; Griffin, D.; Zeikus, R.; McIntosh,
J. M.; Galyean, R.; Varga, J.; Gray, W. R.; et al. Neuronal calcium channel antagonists.
Discrimination between calcium channel subtypes using omega-conotoxin from Conus magus
venom. Biochemistry 1987, 26, 2086-2090.
35. Miljanich, G. P.; Ramachandran, J. Antagonists of neuronal calcium channels: structure, function,
and therapeutic implications. Annu. Rev. Pharmacol. Toxicol. 1995, 35, 707-734.
36. Miljanich, G. P. Ziconotide: neuronal calcium channel blocker for treating severe chronic pain.
Curr. Med. Chem. 2004, 11, 3029-3040.
37. Bowersox, S. S.; Gadbois, T.; Singh, T.; Pettus, M.; Wang, Y. X.; Luther, R. R. Selective N-type
neuronal voltage-sensitive calcium channel blocker, SNX-111, produces spinal antinociception in
rat models of acute, persistent and neuropathic pain. J. Pharmacol. Exp. Ther. 1996, 279, 1243-
1249.
38. Malmberg, A. B.; Yaksh, T. L. Voltage-sensitive calcium channels in spinal nociceptive
processing: blockade of N- and P-type channels inhibits formalin-induced nociception. J.
Neurosci. 1994, 14, 4882-4890.
39. Malmberg, A. B.; Yaksh, T. L. Effect of continuous intrathecal infusion of omega-conopeptides,
N-type calcium-channel blockers, on behavior and antinociception in the formalin and hot-plate
tests in rats. Pain 1995, 60, 83-90.
40. Wang, Y. X.; Pettus, M.; Gao, D.; Phillips, C.; Scott Bowersox, S. Effects of intrathecal
administration of ziconotide, a selective neuronal N-type calcium channel blocker, on mechanical
allodynia and heat hyperalgesia in a rat model of postoperative pain. Pain 2000, 84, 151-158.
41. Sluka, K. A. Blockade of N- and P/Q-type calcium channels reduces the secondary heat
hyperalgesia induced by acute inflammation. J. Pharmacol. Exp. Ther. 1998, 287, 232-237.
Mar. Drugs 2006, 4 137

42. Chaplan, S. R.; Pogrel, J. W.; Yaksh, T. L. Role of voltage-dependent calcium channel subtypes
in experimental tactile allodynia. J. Pharmacol. Exp. Ther. 1994, 269, 1117-1123.
43. Xiao, W. H.; Bennett, G. J. Synthetic omega-conopeptides applied to the site of nerve injury
suppress neuropathic pains in rats. J. Pharmacol. Exp. Ther. 1995, 274, 666-672.
44. Wang, Y. X.; Gao, D.; Pettus, M.; Phillips, C.; Bowersox, S. S. Interactions of intrathecally
administered ziconotide, a selective blocker of neuronal N-type voltage-sensitive calcium
channels, with morphine on nociception in rats. Pain 2000, 84, 271-281.
45. Webster, L.; Fakata, K. Ziconotide for chronic severe pain. Practical Pain Management 2005, 5,
47-56.
46. Staats, P. S.; Yearwood, T.; Charapata, S. G.; Presley, R. W.; Wallace, M. S.; Byas-Smith, M.;
Fisher, R.; Bryce, D. A.; Mangieri, E. A.; Luther, R. R.; Mayo, M.; McGuire, D.; Ellis, D.
Intrathecal ziconotide in the treatment of refractory pain in patients with cancer or AIDS: a
randomized controlled trial. JAMA 2004, 291, 63-70.
47. Lewis, R. J.; Nielsen, K. J.; Craik, D. J.; Loughnan, M. L.; Adams, D. A.; Sharpe, I. A.; Luchian,
T.; Adams, D. J.; Bond, T.; Thomas, L.; Jones, A.; Matheson, J. L.; Drinkwater, R.; Andrews, P.
R.; Alewood, P. F. Novel omega-conotoxins from Conus catus discriminate among neuronal
calcium channel subtypes. J. Biol. Chem. 2000, 275, 35335-35344.
48. Smith, M. T.; Cabot, P. J.; Ross, F. B.; Robertson, A. D.; Lewis, R. J. The novel N-type calcium
channel blocker, AM336, produces potent dose-dependent antinociception after intrathecal dosing
in rats and inhibits substance P release in rat spinal cord slices. Pain 2002, 96, 119-127.
49. Scott, D. A.; Wright, C. E.; Angus, J. A. Actions of intrathecal omega-conotoxins CVID, GVIA,
MVIIA, and morphine in acute and neuropathic pain in the rat. Eur. J. Pharmacol. 2002, 451,
279-286.
50. Adams, D. J.; Smith, A. B.; Schroeder, C. I.; Yasuda, T.; Lewis, R. J. Omega-conotoxin CVID
inhibits a pharmacologically distinct voltage-sensitive calcium channel associated with transmitter
release from preganglionic nerve terminals. J. Biol. Chem. 2003, 278, 4057-4062.
51. Vincent, J. P.; Mazella, J.; Kitabgi, P. Neurotensin and neurotensin receptors. Trends Pharmacol.
Sci. 1999, 20, 302-309.
52. Young, W.; Kuhar, M. Neurotensin receptor localization by light microscopic autoradiography in
rat brain. Brain Res. 1981, 206, 273-285.
53. Seybold, V. S.; Elde, R. P. Neurotensin immunoreactivity in the superficial laminae of the dorsal
horn of the rat: I. Light microscopic studies of cell bodies and proximal dendrites. J. Comp.
Neurol. 1982, 205, 89-100.
54. Uhl, G.; Goodman, R.; Snyder, S. Neurotensin-containing cell bodies, fibers and nerve terminals
in the brain stem of the rat: immunohistochemical mapping. Brain Res. 1979, 167, 77-91.
55. Zhang, X.; Xu, Z.-Q.; Bao, L.; Dagerlind, A.; Hokfelt, T. Complementary distribution of receptors
for neurotensin and NPY in small neurons in rat lumbar DRGs and regulation of the receptors and
peptides after peripheralaxotomy. J. Neurosci. 1995, 15, 2733-2747.
56. Yaksh, T. L.; Schmauss, C.; Micevych, P. E.; Abay, E. O.; Go, V. L. Pharmacological studies on
the application, disposition, and release of neurotensin in the spinal cord. Ann. N. Y. Acad. Sci.
1982, 400, 228-243.
Mar. Drugs 2006, 4 138

57. Spampinato, S.; Romualdi, P.; Candeletti, S.; Cavicchini, E.; Ferri, S. Distinguishable effects of
intrathecal dynorphins, somatostatin, neurotensin and s-calcitonin on nociception and motor
function in the rat. Pain 1988, 35, 95-104.
58. Martin, G. E.; Naruse, T. Differences in the pharmacological actions of intrathecally administered
neurotensin and morphine. Regul. Pept. 1982, 3, 97-103.
59. Wagstaff, J.; Layer, R.; Craig, A. CGX-1160: A broad-spectrum, non-opioid analgesic
conopeptide: from discovery to the clinic? Venoms to Drugs Conference: Heron Island,
Queensland, Australia, 2002.
60. Bulaj, G.; Yoshikami, D.; Zhang, M.; Terlau, H.; Layer, R.; Wagstaff, J.; Olivera, B. Cone Snail
Venoms as a Rich Pharmacopoeia of Analgesic Peptides. Venoms to Drugs Conference: Heron
Island, Queensland, Australia, 2005.
61. Allen, J.; McCumber, D.; Wagstaff, J.; Layer, R.; McCabe, R.; Yaksh, T. Intrathecal CGX-1160
produces analgesia in the rat formalin test and canine thermal twitch model. Society for
Neuroscience, 2001; pp 615.612.
62. McIntosh, J. M.; Corpuz, G. O.; Layer, R. T.; Garrett, J. E.; Wagstaff, J. D.; Bulaj, G.;
Vyazovkina, A.; Yoshikami, D.; Cruz, L. J.; Olivera, B. M. Isolation and characterization of a
novel conus peptide with apparent antinociceptive activity. J. Biol. Chem. 2000, 275, 32391-
32397.
63. Sharpe, I. A.; Gehrmann, J.; Loughnan, M. L.; Thomas, L.; Adams, D. A.; Atkins, A.; Palant, E.;
Craik, D. J.; Adams, D. J.; Alewood, P. F.; Lewis, R. J. Two new classes of conopeptides inhibit
the alpha1-adrenoceptor and noradrenaline transporter. Nat. Neurosci. 2001, 4, 902-907.
64. Bryan-Lluka, L. J.; Bonisch, H.; Lewis, R. J. chi-Conopeptide MrIA partially overlaps
desipramine and cocaine binding sites on the human norepinephrine transporter. J. Biol. Chem.
2003, 278, 40324-40329.
65. Nilsson, K. P.; Lovelace, E. S.; Caesar, C. E.; Tynngard, N.; Alewood, P. F.; Johansson, H. M.;
Sharpe, I. A.; Lewis, R. J.; Daly, N. L.; Craik, D. J. Solution structure of chi-conopeptide MrIA, a
modulator of the human norepinephrine transporter. Biopolymers 2005, 80, 815-823.
66. Nielsen, C. K.; Lewis, R. J.; Alewood, D.; Drinkwater, R.; Palant, E.; Patterson, M.; Yaksh, T. L.;
McCumber, D.; Smith, M. T. Anti-allodynic efficacy of the chi-conopeptide, Xen2174, in rats
with neuropathic pain. Pain 2005, 118, 112-124.
67. Obata, H.; Conklin, D.; Eisenach, J. C. Spinal noradrenaline transporter inhibition by reboxetine
and Xen2174 reduces tactile hypersensitivity after surgery in rats. Pain 2005, 113, 271-276.
68. Dingledine, R.; Borges, K.; Bowie, D.; Traynelis, S. F. The glutamate receptor ion channels.
Pharmacol. Rev. 1999, 51, 7-61.
69. Woolf, C. J. The pathophysiology of peripheral neuropathic pain--abnormal peripheral input and
abnormal central processing. Acta Neurochir. Suppl. 1993, 58, 125-130.
70. Priestley, T.; Laughton, P.; Myers, J.; Le Bourdelles, B.; Kerby, J.; Whiting, P. J.
Pharmacological properties of recombinant human N-methyl-D-aspartate receptors comprising
NR1a/NR2A and NR1a/NR2B subunit assemblies expressed in permanently transfected mouse
fibroblast cells. Mol. Pharmacol. 1995, 48, 841-848.
Mar. Drugs 2006, 4 139

71. Monyer, H.; Burnashev, N.; Laurie, D. J.; Sakmann, B.; Seeburg, P. H. Developmental and
regional expression in the rat brain and functional properties of four NMDA receptors. Neuron
1994, 12, 529-540.
72. Laurie, D. J.; Seeburg, P. H. Ligand affinities at recombinant N-methyl-D-aspartate receptors
depend on subunit composition. Eur. J. Pharmacol. 1994, 268, 335-345.
73. Ishii, T.; Moriyoshi, K.; Sugihara, H.; Sakurada, K.; Kadotani, H.; Yokoi, M.; Akazawa, C.;
Shigemoto, R.; Mizuno, N.; Masu, M.; et al. Molecular characterization of the family of the N-
methyl-D-aspartate receptor subunits. J. Biol. Chem. 1993, 268, 2836-2843.
74. Petralia, R. S.; Wang, Y. X.; Wenthold, R. J. The NMDA receptor subunits NR2A and NR2B
show histological and ultrastructural localization patterns similar to those of NR1. J. Neurosci.
1994, 14, 6102-6120.
75. Tolle, T. R.; Berthele, A.; Zieglgansberger, W.; Seeburg, P. H.; Wisden, W. The differential
expression of 16 NMDA and non-NMDA receptor subunits in the rat spinal cord and in
periaqueductal gray. J. Neurosci. 1993, 13, 5009-5028.
76. Yung, K. K. Localization of glutamate receptors in dorsal horn of rat spinal cord. Neuroreport
1998, 9, 1639-1644.
77. Chizh, B. A.; Headley, P. M.; Tzschentke, T. M. NMDA receptor antagonists as analgesics: focus
on the NR2B subtype. Trends Pharmacol. Sci. 2001, 22, 636-642.
78. Boyce, S.; Wyatt, A.; Webb, J. K.; O'Donnell, R.; Mason, G.; Rigby, M.; Sirinathsinghji, D.; Hill,
R. G.; Rupniak, N. M. Selective NMDA NR2B antagonists induce antinociception without motor
dysfunction: correlation with restricted localisation of NR2B subunit in dorsal horn.
Neuropharmacology 1999, 38, 611-623.
79. Ma, Q. P.; Hargreaves, R. J. Localization of N-methyl-D-aspartate NR2B subunits on primary
sensory neurons that give rise to small-caliber sciatic nerve fibers in rats. Neuroscience 2000, 101,
699-707.
80. Layer, R. T.; Wagstaff, J. D.; White, S. W. Conantokins: Peptide antagonists of NMDA receptors.
Curr. Med. Chem. 2004, 11, 3173-3184.
81. Klein, R. C.; Prorok, M.; Galdzicki, Z.; Castellino, F. J. The amino acid residue at sequence
position 5 in the conantokin peptides partially governs subunit-selective antagonism of
recombinant N-methyl-D-aspartate receptors. J. Biol. Chem. 2001, 276, 26860-26867.
82. Donevan, S. D.; McCabe, R. T. Conantokin G is an NR2B-selective competitive antagonist of N-
methyl-D- aspartate receptors. Mol. Pharmacol. 2000, 58, 614-623.
83. Malmberg, A. B.; Gilbert, H.; McCabe, R. T.; Basbaum, A. I. Powerful antinociceptive effects of
the cone snail venom-derived subtype-selective NMDA receptor antagonists conantokins G and T.
Pain 2003, 101, 109-116.
84. White, H. S.; McCabe, R. T.; Armstrong, H.; Donevan, S. D.; Cruz, L. J.; Abogadie, F. C.; Torres,
J.; Rivier, J. E.; Paarmann, I.; Hollmann, M.; Olivera, B. M. In vitro and in vivo characterization
of conantokin-R, a selective NMDA receptor antagonist isolated from the venom of the fish-
hunting snail Conus radiatus. J. Pharmacol. Exp. Ther. 2000, 292, 425-432.
85. Armstrong, H.; Zhou, L. M.; Layer, R. T.; Nielsen, J.; McCabe, R. T.; White, H. S.
Anticonvulsant profile of conantokin-G (Con-G): A novel, broad-spectrum NMDA antagonist.
Epilepsia 1998, 39, 39-40.
Mar. Drugs 2006, 4 140

86. Barton, M. E.; White, H. S. The effect of CGX-1007 and CI-1041, novel NMDA receptor
antagonists, on kindling acquisition and expression. Epilepsy Res. 2004, 59, 1-12.
87. Bannon, A. W.; Decker, M. W.; Holladay, M. W.; Curzon, P.; Donnelly-Roberts, D.; Puttfarcken,
P. S.; Bitner, R. S.; Diaz, A.; Dickenson, A. H.; Porsolt, R. D.; Williams, M.; Arneric, S. P.
Broad-spectrum, non-opioid analgesic activity by selective modulation of neuronal nicotinic
acetylcholine receptors. Science 1998, 279, 77-81.
88. Badio, B.; Daly, J. W. Epibatidine, a potent analgetic and nicotinic agonist. Mol. Pharmacol. 1994,
45, 563-569.
89. Marubio, L. M.; del Mar Arroyo-Jimenez, M.; Cordero-Erausquin, M.; Lena, C.; Le Novere, N.;
de Kerchove d'Exaerde, A.; Huchet, M.; Damaj, M. I.; Changeux, J. P. Reduced antinociception in
mice lacking neuronal nicotinic receptor subunits. Nature 1999, 398, 805-810.
90. McIntosh, J. M.; Santos, A. D.; Olivera, B. M. Conus peptides targeted to specific nicotinic
acetylcholine receptor subtypes. Annu. Rev. Biochem. 1999, 68, 59-88.
91. Dutton, J. L.; Craik, D. J. alpha-Conotoxins: nicotinic acetylcholine receptor antagonists as
pharmacological tools and potential drug leads. Curr. Med. Chem. 2001, 8, 327-344.
92. Sandall, D. W.; Satkunanathan, N.; Keays, D. A.; Polidano, M. A.; Liping, X.; Pham, V.; Down, J.
G.; Khalil, Z.; Livett, B. G.; Gayler, K. R. A novel alpha-conotoxin identified by gene sequencing
is active in suppressing the vascular response to selective stimulation of sensory nerves in vivo.
Biochemistry 2003, 42, 6904-6911.
93. Lang, P.; Burgstahler, R.; Sippel, W.; Irnich, D.; Schlotter-Weigel, B.; Grafe, P. Characterization
of neuronal nicotinic acetylcholine receptors in the membrane of unmyelinated human C-fiber
axons by in vitro studies. J. Neurophysiol. 2003, 90, 3295-3303.
94. Satkunanathan, N.; Livett, B.; Gayler, K.; Sandall, D.; Down, J.; Khalil, Z. Alpha-conotoxin
Vc1.1 alleviates neuropathic pain and accelerates functional recovery of injured neurones. Brain
Res. 2005.
95. Wood, J.; Boorman, J.; Okuse, K.; Baker, M. Voltage-gated sodium channels and pain pathways.
J. Neurobiol. 2004, 61, 55-71.
96. Daly, N. L.; Ekberg, J. A.; Thomas, L.; Adams, D. J.; Lewis, R. J.; Craik, D. J. Structures of
muO-conotoxins from Conus marmoreus. I nhibitors of tetrodotoxin (TTX)-sensitive and TTX-
resistant sodium channels in mammalian sensory neurons. J. Biol. Chem. 2004, 279, 25774-25782.
97. West, P. J.; Bulaj, G.; Garrett, J. E.; Olivera, B. M.; Yoshikami, D. Mu-conotoxin SmIIIA, a
potent inhibitor of tetrodotoxin-resistant sodium channels in amphibian sympathetic and sensory
neurons. Biochemistry 2002, 41, 15388-15393.
98. Bulaj, G.; West, P. J.; Garrett, J. E.; Marsh, M.; Zhang, M. M.; Norton, R. S.; Smith, B. J.;
Yoshikami, D.; Olivera, B. M. Novel conotoxins from Conus striatus and Conus kinoshitai
selectively block TTX-resistant sodium channels. Biochemistry 2005, 44, 7259-7265.
99. Buchan, A. M.; Gertler, S. Z.; Li, H.; Xue, D.; Huang, Z. G.; Chaundy, K. E.; Barnes, K.; Lesiuk,
H. J. A selective N-type Ca(2+)-channel blocker prevents CA1 injury 24 h following severe
forebrain ischemia and reduces infarction following focal ischemia. J. Cereb. Blood Flow Metab.
1994, 14, 903-910.
100. Valentino, K.; Newcomb, R.; Gadbois, T.; Singh, T.; Bowersox, S.; Bitner, S.; Justice, A.;
Yamashiro, D.; Hoffman, B. B.; Ciaranello, R.; et al. A selective N-type calcium channel
Mar. Drugs 2006, 4 141

antagonist protects against neuronal loss after global cerebral ischemia. Proc. Natl. Acad. Sci. U.
S. A. 1993, 90, 7894-7897.
101. Yenari, M. A.; Palmer, J. T.; Sun, G. H.; de Crespigny, A.; Mosely, M. E.; Steinberg, G. K. Time-
course and treatment response with SNX-111, an N-type calcium channel blocker, in a rodent
model of focal cerebral ischemia using diffusion-weighted MRI. Brain Res. 1996, 739, 36-45.
102. Perez-Pinzon, M. A.; Yenari, M. A.; Sun, G. H.; Kunis, D. M.; Steinberg, G. K. SNX-111, a
novel, presynaptic N-type calcium channel antagonist, is neuroprotective against focal cerebral
ischemia in rabbits. J. Neurol. Sci. 1997, 153, 25-31.
103. Takizawa, S.; Matsushima, K.; Fujita, H.; Nanri, K.; Ogawa, S.; Shinohara, Y. A selective N-type
calcium channel antagonist reduces extracellular glutamate release and infarct volume in focal
cerebral ischemia. J. Cereb. Blood Flow Metab. 1995, 15, 611-618.
104. McGuire, D.; Bowersox, S.; Fellmann, J. D.; Luther, R. R. Sympatholysis after neuron-specific,
N-type, voltage-sensitive calcium channel blockade: first demonstration of N-channel function in
humans. J. Cardiovasc. Pharmacol. 1997, 30, 400-403.
105. Lees, K. R. Cerestat and other NMDA antagonists in ischemic stroke. Neurology 1997, 49, S66-
69.
106. Dawson, D. A.; Wadsworth, G.; Palmer, A. M. A comparative assessment of the efficacy and
side-effect liability of neuroprotective compounds in experimental stroke. Brain Res. 2001, 892,
344-350.
107. Williams, A. J.; Dave, J. R.; Phillips, J. B.; Lin, Y.; McCabe, R. T.; Tortella, F. C.
Neuroprotective efficacy and therapeutic window of the high-affinity N- methyl-D-aspartate
antagonist conantokin-G: in vitro (primary cerebellar neurons) and in vivo (rat model of transient
focal brain ischemia) studies. J. Pharmacol. Exp. Ther. 2000, 294, 378-386.
108. Williams, A. J.; Ling, G.; McCabe, R. T.; Tortella, F. C. Intrathecal CGX-1007 is neuroprotective
in a rat model of focal cerebral ischemia. Neuroreport 2002, 13, 821-824.
109. Williams, A. J.; Dave, J. R.; Lu, X. M.; Ling, G.; Tortella, F. C. Selective NR2B NMDA receptor
antagonists are protective against staurosporine-induced apoptosis. Eur. J. Pharmacol. 2002, 452,
135-136.
110. Williams, A. J.; Ling, G.; Berti, R.; Moffett, J. R.; Yao, C.; Lu, X. M.; Dave, J. R.; Tortella, F. C.
Treatment with the snail peptide CGX-1007 reduces DNA damage and alters gene expression of
c-fos and bcl-2 following focal ischemic brain injury in rats. Exp. Brain Res. 2003, 153, 16-26.
111. Bevan, D. R. Neuromuscular blocking drugs: onset and intubation. J. Clin. Anesth. 1997, 9, 36S-
39S.
112. Groebe, D. R.; Gray, W. R.; Abramson, S. N. Determinants involved in the affinity of alpha-
conotoxins GI and SI for the muscle subtype of nicotinic acetylcholine receptors. Biochemistry
1997, 36, 6469-6474.
113. Groebe, D. R.; Dumm, J. M.; Levitan, E. S.; Abramson, S. N. alpha-Conotoxins selectively
inhibit one of the two acetylcholine binding sites of nicotinic receptors. Mol. Pharmacol. 1995, 48,
105-111.
114. Hann, R. M.; Pagan, O. R.; Eterovic, V. A. The alpha-conotoxins GI and MI distinguish between
the nicotinic acetylcholine receptor agonist sites while SI does not. Biochemistry 1994, 33, 14058-
14063.
Mar. Drugs 2006, 4 142

115. Hann, R. M.; Pagan, O. R.; Gregory, L. M.; Jacome, T.; Eterovic, V. A. The 9-arginine residue of
alpha-conotoxin GI is responsible for its selective high affinity for the alphagamma agonist site on
the electric organ acetylcholine receptor. Biochemistry 1997, 36, 9051-9056.
116. Marshall, I. G.; Harvey, A. L. Selective neuromuscular blocking properties of alpha-conotoxins in
vivo. Toxicon 1990, 28, 231-234.
117. Hashimoto, K.; Uchida, S.; Yoshida, H.; Nishiuchi, Y.; Sakakibara, S.; Yukari, K. Structure-
activity relations of conotoxins at the neuromuscular junction. Eur. J. Pharmacol. 1985, 118, 351-
354.
118. Griffith, H.; Johnson, G. The use of curare in general anesthesia. Anesthesiology 1942, 3, 418-420.
119. Bowman, W. Development of new neuromuscular blocking drugs. Asia Pacific Journal of
Pharmacology 1997, 12, 57-64.
120. Terlau, H.; Shon, K. J.; Grilley, M.; Stocker, M.; Stuhmer, W.; Olivera, B. M. Strategy for rapid
immobilization of prey by a fish-hunting marine snail. Nature 1996, 381, 148-151.
121. Terlau, H.; Boccaccio, A.; Olivera, B. M.; Conti, F. The block of Shaker K+ channels by kappa-
conotoxin PVIIA is state dependent. J. Gen. Physiol. 1999, 114, 125-140.
122. Zhang, S. J.; Yang, X. M.; Liu, G. S.; Cohen, M. V.; Pemberton, K.; Downey, J. M. CGX-1051, a
peptide from Conus snail venom, attenuates infarction in rabbit hearts when administered at
reperfusion. J. Cardiovasc. Pharmacol. 2003, 42, 764-771.
123. Lubbers, N. L.; Campbell, T. J.; Polakowski, J. S.; Bulaj, G.; Layer, R. T.; Moore, J.; Gross, G. J.;
Cox, B. F. Postischemic administration of CGX-1051, a peptide from cone snail venom, reduces
infarct size in both rat and dog models of myocardial ischemia and reperfusion. J. Cardiovasc.
Pharmacol. 2005, 46, 141-146.

Samples Availability: Available from the authors.

© 2006 by MDPI (http://www.mdpi.org). Reproduction is permitted for noncommercial purposes.