Idi na sadržaj

ACVRL1

S Wikipedije, slobodne enciklopedije
ACVRL1
Dostupne strukture
PDBPretraga ortologa: PDBe RCSB
Spisak PDB ID kodova

2LCR, 3MY0, 4FAO

Identifikatori
AliasiACVRL1
Vanjski ID-jeviOMIM: 601284 MGI: 1338946 HomoloGene: 20058 GeneCards: ACVRL1
Lokacija gena (čovjek)
Hromosom 12 (čovjek)
Hrom.Hromosom 12 (čovjek)[1]
Hromosom 12 (čovjek)
Genomska lokacija za ACVRL1
Genomska lokacija za ACVRL1
Bend12q13.13Početak51,906,908 bp[1]
Kraj51,923,361 bp[1]
Lokacija gena (miš)
Hromosom 15 (miš)
Hrom.Hromosom 15 (miš)[2]
Hromosom 15 (miš)
Genomska lokacija za ACVRL1
Genomska lokacija za ACVRL1
Bend15|15 F1Početak101,026,403 bp[2]
Kraj101,043,217 bp[2]
Obrazac RNK ekspresije
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija aktivnost sa transferazom
nucleotide binding
protein kinase activity
activin binding
transforming growth factor beta-activated receptor activity
vezivanje iona metala
kinase activity
protein serine/threonine kinase activity
transmembrane receptor protein serine/threonine kinase activity
GO:0001948, GO:0016582 vezivanje za proteine
BMP receptor activity
ATP binding
protein kinase binding
transforming growth factor beta binding
transforming growth factor beta receptor activity, type I
activin receptor activity, type I
SMAD binding
growth factor binding
Ćelijska komponenta integral component of membrane
membrana
integral component of plasma membrane
soma
dendrit
ćelijska membrana
cell surface
receptor complex
activin receptor complex
Biološki proces cellular response to transforming growth factor beta stimulus
negative regulation of cell adhesion
GO:0009373 regulation of transcription, DNA-templated
positive regulation of endothelial cell differentiation
positive regulation of endothelial cell proliferation
blood vessel morphogenesis
negative regulation of blood vessel endothelial cell migration
lymphangiogenesis
regulation of DNA replication
Fosforilacija
endothelial tube morphogenesis
retina vasculature development in camera-type eye
wound healing, spreading of epidermal cells
lymphatic endothelial cell differentiation
positive regulation of pathway-restricted SMAD protein phosphorylation
cellular response to BMP stimulus
negative regulation of endothelial cell differentiation
in utero embryonic development
blood vessel endothelial cell proliferation involved in sprouting angiogenesis
Krvotok
positive regulation of angiogenesis
venous blood vessel development
negative regulation of endothelial cell migration
negative regulation of endothelial cell proliferation
regulation of blood vessel endothelial cell migration
regulation of blood pressure
GO:0060469, GO:0009371 positive regulation of transcription, DNA-templated
protein phosphorylation
blood vessel remodeling
negative regulation of cell migration
transmembrane receptor protein serine/threonine kinase signaling pathway
negative regulation of cell growth
positive regulation of chondrocyte differentiation
Angiogeneza
artery development
regulation of endothelial cell proliferation
positive regulation of BMP signaling pathway
transforming growth factor beta receptor signaling pathway
negative regulation of focal adhesion assembly
negative regulation of DNA biosynthetic process
GO:0072468 Transdukcija signala
negative regulation of cell population proliferation
blood vessel maturation
activin receptor signaling pathway
response to hypoxia
endocardial cushion to mesenchymal transition
endocardial cushion morphogenesis
negative regulation of gene expression
dorsal aorta morphogenesis
GO:0003257, GO:0010735, GO:1901228, GO:1900622, GO:1904488 positive regulation of transcription by RNA polymerase II
BMP signaling pathway
pattern specification process
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_000020
NM_001077401

NM_001277255
NM_001277257
NM_001277258
NM_001277259
NM_009612

RefSeq (bjelančevina)

NP_000011
NP_001070869

NP_001264184
NP_001264186
NP_001264187
NP_001264188
NP_033742

Lokacija (UCSC)Chr 12: 51.91 – 51.92 MbChr 15: 101.03 – 101.04 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Receptor R3 serin/treonin-protein kinaze je enzim koji je kod ljudi kodiran genom ACVRL1.[5][6][7]

ACVRL1 je receptor u signalnom putu TGF-beta. Poznat je i kao aktivinska receptoolika kinaza 1 ili ALK1.

Aminokiselinska sekvenca

[uredi | uredi izvor]

Dužina polipeptidnog lanca je 503 aminokiseline, a molekulska težina 56.124 Da.[8].

1020304050
MTLGSPRKGLLMLLMALVTQGDPVKPSRGPLVTCTCESPHCKGPTCRGAW
CTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVS
LVLEATQPPSEQPGTDGQLALILGPVLALLALVALGVLGLWHVRRRQEKQ
RGLHSELGESSLILKASEQGDSMLGDLLDSDCTTGSGSGLPFLVQRTVAR
QVALVECVGKGRYGEVWRGLWHGESVAVKIFSSRDEQSWFRETEIYNTVL
LRHDNILGFIASDMTSRNSSTQLWLITHYHEHGSLYDFLQRQTLEPHLAL
RLAVSAACGLAHLHVEIFGTQGKPAIAHRDFKSRNVLVKSNLQCCIADLG
LAVMHSQGSDYLDIGNNPRVGTKRYMAPEVLDEQIRTDCFESYKWTDIWA
FGLVLWEIARRTIVNGIVEDYRPPFYDVVPNDPSFEDMKKVVCVDQQTPT
IPNRLAADPVLSGLAQMMRECWYPNPSARLTALRIKKTLQKISNSPEKPK
VIQ

Funkcija

[uredi | uredi izvor]

Ovaj gen kodira receptor ćelijske površine tipa I za superporodicu liganada TGF-beta. S drugim receptorima tipa I dijeli visok stupanj sličnosti u poddomenima serin-treonin kinaza, regiji bogatoj glicinom i serinom (zvanoim GS-domen) koji prethodi domenu kinaze i kratkom repu C-terminala. Kodirani protein, koji se ponekad naziva i ALK1, dijeli slične domenske strukture sa drugim blisko povezanim proteinima ALK ili proteinima kinaze sličnim aktivinu koji tvore potporodicu receptorskih serin/treonin kinaza. Mutacije u ovom genu povezane su s hemoragičnom telangiektazijom tipa 2, poznatom i kao Rendu-Osler-Weberov sindrom 2.[7]

Patologija

[uredi | uredi izvor]

Mutacija germinativne linije ACVRL1 su povezane sa:

Somatski mozaicizam u ACVRL1 povezan je s teškom plućnom arterijskom hipertenzijom.[11]

ACVRL1 direktno stupa u interakciju s lipoproteinom niske gustoće (LDL), što implicira da bi mogao inicirati rane faze ateroskleroze.[12]

Utvrđeno je da je abnormalna aktivnost ACVRL1 usko povezana s idiopatskom plućnom arterijskom hipertenzijom.

Kao cilj lijekova

[uredi | uredi izvor]

Bliske/porodično-srodne kinaze

[uredi | uredi izvor]

(Ne miješati s anaplazijska limfomska kinaza (ALK))
ALK4 je ACVR1B, ALK7 je ACVR1C, a ALK5 je [dio] receptor TGF-β tip I.[14]

Također pogledajte

[uredi | uredi izvor]

Reference

[uredi | uredi izvor]
  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000139567 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000000530 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ ten Dijke P, Ichijo H, Franzén P, Schulz P, Saras J, Toyoshima H, Heldin CH, Miyazono K (oktobar 1993). "Activin receptor-like kinases: a novel subclass of cell-surface receptors with predicted serine/threonine kinase activity". Oncogene. 8 (10): 2879–87. PMID 8397373.
  6. ^ Johnson DW, Berg JN, Baldwin MA, Gallione CJ, Marondel I, Yoon SJ, Stenzel TT, Speer M, Pericak-Vance MA, Diamond A, Guttmacher AE, Jackson CE, Attisano L, Kucherlapati R, Porteous ME, Marchuk DA (juni 1996). "Mutations in the activin receptor-like kinase 1 gene in hereditary haemorrhagic telangiectasia type 2". Nature Genetics. 13 (2): 189–95. doi:10.1038/ng0696-189. PMID 8640225. S2CID 21379604.
  7. ^ a b "Entrez Gene: ACVRL1 activin A receptor type II-like 1".
  8. ^ "UniProt, P37023". Pristupljeno 6. 8. 2021.
  9. ^ Olivieri C, Mira E, Delù G, Pagella F, Zambelli A, Malvezzi L, Buscarini E, Danesino C (juli 2002). "Identification of 13 new mutations in the ACVRL1 gene in a group of 52 unselected Italian patients affected by hereditary haemorrhagic telangiectasia". Journal of Medical Genetics. 39 (7): 39e–39. doi:10.1136/jmg.39.7.e39. PMC 1735165. PMID 12114496.
  10. ^ Vandenbriele C, Peerlinck K, de Ravel T, Verhamme P, Vanassche T (april 2014). "Pulmonary arterio-venous malformations in a patient with a novel mutation in exon 10 of the ACVRL1 gene". Acta Clinica Belgica. 69 (2): 139–41. doi:10.1179/0001551213Z.00000000012. PMID 24724759. S2CID 35264961.
  11. ^ Jones G, Robertson L, Harrison R, Ridout C, Vasudevan P (august 2014). "Somatic mosaicism in ACVRL1 with transmission to several offspring affected with severe pulmonary arterial hypertension". American Journal of Medical Genetics. Part A. 164A (8): 2121–3. doi:10.1002/ajmg.a.36568. PMID 24753439. S2CID 5417225.
  12. ^ Kraehling JR, Chidlow JH, Rajagopal C, Sugiyama MG, Fowler JW, Lee MY, Zhang X, Ramírez CM, Park EJ, Tao B, Chen K, Kuruvilla L, Larriveé B, Folta-Stogniew E, Ola R, Rotllan N, Zhou W, Nagle MW, Herz J, Williams KJ, Eichmann A, Lee WL, Fernández-Hernando C, Sessa WC (novembar 2016). "Genome-wide RNAi screen reveals ALK1 mediates LDL uptake and transcytosis in endothelial cells". Nature Communications. 7: 13516. Bibcode:2016NatCo...713516K. doi:10.1038/ncomms13516. PMC 5121336. PMID 27869117.
  13. ^ Gupta S, Gill D, Pal SK, Agarwal N (2015). "Activin receptor inhibitors--dalantercept". Current Oncology Reports. 17 (4): 14. doi:10.1007/s11912-015-0441-5. PMID 25708802. S2CID 22676858.
  14. ^ Laping NJ, Grygielko E, Mathur A, Butter S, Bomberger J, Tweed C, Martin W, Fornwald J, Lehr R, Harling J, Gaster L, Callahan JF, Olson BA (juli 2002). "Inhibition of transforming growth factor (TGF)-beta1-induced extracellular matrix with a novel inhibitor of the TGF-beta type I receptor kinase activity: SB-431542". Molecular Pharmacology. 62 (1): 58–64. doi:10.1124/mol.62.1.58. PMID 12065755.

Dopunska literatura

[uredi | uredi izvor]

Vanjski linkovi

[uredi | uredi izvor]

Šablon:Signalizacija TGF-beta