Mega 4
Mega 4
Mega 4
1 Table of Contents
2
2.1 2.2 2.3 2.4 2.5 2.6
PREFACE.......................................................................................................1
Copyright ................................................................................................................. 1 Guide to Notations Used ......................................................................................... 2 Preface .................................................................................................................... 3 Acknowledgements ................................................................................................. 5 MEGA Software Development Team ...................................................................... 6 Citing MEGA in Publications ................................................................................... 7
3
3.1
3.2
3.3
3.3.1 3.3.2 3.3.3 3.3.4 3.3.5 3.3.6 3.3.7 3.3.8 3.3.9 3.3.10
4
4.1 4.2 4.3 4.4
4.5
Table of Contents 5.1.1 5.1.2 5.1.3 5.1.4 5.1.5 MEGA Format...............................................................................................................55 General Conventions....................................................................................................55 Sequence Input Data....................................................................................................57 Distance Input Data ......................................................................................................62 Tree Input Data.............................................................................................................65 Importing Data from Other Formats .............................................................................65 Convert To MEGA Format (Main File Menu)................................................................66 Built-in Genetic Codes..................................................................................................77 Adding/Modifying Genetic Code Tables .......................................................................78 Computing Statistical Attributes (Genetic Code)..........................................................78 Setup/Select Taxa & Groups Dialog.............................................................................79 Select Genetic Code Table Dialog ...............................................................................80 Sequence Data Explorer ..............................................................................................81 Distance Data Explorer.................................................................................................90
5.2 5.3
Viewing and Exploring Input Data ......................................................................... 81 Text File Editor and Format Converter .................................................................. 93 Visual Tools for Data Management ....................................................................... 98
Setup/Select Taxa & Groups Dialog.............................................................................98 Groups of taxa ..............................................................................................................99 Data Subset Selection ..................................................................................................99
5.4.1 5.4.2
6
6.1
6.2 6.3
Computing Evolutionary Distances ..................................................................... 102 Constructing Phylogenetic Trees ........................................................................ 138
6.4
6.4.1 6.4.2
7
7.1
7.2
ii
Table of Contents
7.3
7.3.1 7.3.2 7.3.3 7.3.4 7.3.5 7.3.6 7.3.7 7.3.8 7.3.9 7.3.10 7.3.11 7.3.12 7.3.13 7.3.14 7.3.15
7.4
8
8.1
APPENDIX..................................................................................................181
Appendix A: Frequently Asked Questions........................................................... 181
Computing statistics on only highlighted sites in Data Explorer.................................181 Finding the number of sites in pair-wise comparisons ...............................................181 Get more information about the codon based Z-test for selection .............................181 Menus in MEGA are so short; where are all the options?..........................................181 Writing only 4-fold degenerate sites to an output file .................................................182 Main MEGA Menus ....................................................................................................183 Setup/Select Taxa & Groups Dialog...........................................................................188 Setup/Select Taxa & Groups Dialog...........................................................................190 MEGA Dialogs ............................................................................................................199 Blank Names Are Not Permitted ................................................................................204 Data File Parsing Error ...............................................................................................204 Dayhoff/JTT Distance Could Not Be Computed.........................................................204 Domains Cannot Overlap ...........................................................................................204 Equal Input Correction Failed.....................................................................................204 Fisher's Exact Test Has Failed...................................................................................204 Gamma Distance Failed Because p > 0.99................................................................204 Gene Names Must Be Unique....................................................................................205 Inapplicable Computation Requested ........................................................................205 Incorrect Command Used...........................................................................................205 Invalid special symbol in molecular sequences .........................................................205 Jukes-Cantor Distance Failed ....................................................................................205 Kimura Distance Failed ..............................................................................................205 LogDet Distance Could Not Be Computed.................................................................205 Missing data or invalid distances in the matrix...........................................................206 No Common Sites ......................................................................................................206 Not Enough Groups Selected.....................................................................................206 Not Enough Taxa Selected ........................................................................................206 Not Yet Implemented..................................................................................................206 p distance is found to be > 1 ......................................................................................206 8.1.1 8.1.2 8.1.3 8.1.4 8.1.5
8.2
8.3
8.3.1 8.3.2 8.3.3 8.3.4 8.3.5 8.3.6 8.3.7 8.3.8 8.3.9 8.3.10 8.3.11 8.3.12 8.3.13 8.3.14 8.3.15 8.3.16 8.3.17 8.3.18 8.3.19 8.3.20
iii
Table of Contents 8.3.21 8.3.22 8.3.23 8.3.24 8.3.25 8.3.26 Poisson Correction Failed because p > 0.99 .............................................................206 Tajima-Nei Distance Could Not Be Computed ...........................................................207 Tamura (1992) Distance Could Not Be Computed ....................................................207 Tamura-Nei Distance Could Not Be Computed .........................................................207 Unexpected Error .......................................................................................................207 User Stopped Computation ........................................................................................207 ABI File Format...........................................................................................................208 Alignment Gaps ..........................................................................................................208 Alignment session ......................................................................................................208 Bifurcating Tree ..........................................................................................................208 Branch ........................................................................................................................208 ClustalW .....................................................................................................................209 Codon .........................................................................................................................209 Codon Usage..............................................................................................................209 Complete-Deletion Option ..........................................................................................209 Composition Distance.................................................................................................209 Compress/Uncompress ..............................................................................................210 Condensed Tree.........................................................................................................210 Constant Site ..............................................................................................................210 Degeneracy ................................................................................................................210 Disparity Index............................................................................................................210 Domains .....................................................................................................................211 Exon............................................................................................................................211 Extant Taxa ................................................................................................................211 Flip ..............................................................................................................................211 Format command .......................................................................................................211 Gamma parameter .....................................................................................................211 Gene ...........................................................................................................................212 Groups of taxa ............................................................................................................212 Indels ..........................................................................................................................212 Independent Sites.......................................................................................................212 Intron...........................................................................................................................212 Maximum Composite Likelihood ................................................................................213 Max-mini branch-and-bound search...........................................................................213 Maximum Parsimony Principle ...................................................................................213 Mid-point rooting.........................................................................................................213 Monophyletic ..............................................................................................................213 mRNA .........................................................................................................................213 NCBI ...........................................................................................................................214 Newick Format............................................................................................................214 Node ...........................................................................................................................214 Non-synonymous change...........................................................................................214 Nucleotide Pair Frequencies ......................................................................................215 OLS branch length estimates .....................................................................................215 Orthologous Genes ....................................................................................................215 Out-group ...................................................................................................................215 Pair-wise-deletion option ............................................................................................216 Parsimony-informative site .........................................................................................216 Polypeptide.................................................................................................................216 Positive selection........................................................................................................216 Protein parsimony.......................................................................................................216 Purifying selection ......................................................................................................216 Purines........................................................................................................................216 Pyrimidines .................................................................................................................216 Random addition trees ...............................................................................................216
8.4
8.4.1 8.4.2 8.4.3 8.4.4 8.4.5 8.4.6 8.4.7 8.4.8 8.4.9 8.4.10 8.4.11 8.4.12 8.4.13 8.4.14 8.4.15 8.4.16 8.4.17 8.4.18 8.4.19 8.4.20 8.4.21 8.4.22 8.4.23 8.4.24 8.4.25 8.4.26 8.4.27 8.4.28 8.4.29 8.4.30 8.4.31 8.4.32 8.4.33 8.4.34 8.4.35 8.4.36 8.4.37 8.4.38 8.4.39 8.4.40 8.4.41 8.4.42 8.4.43 8.4.44 8.4.45 8.4.46 8.4.47 8.4.48 8.4.49
iv
Table of Contents 8.4.50 8.4.51 8.4.52 8.4.53 8.4.54 8.4.55 8.4.56 8.4.57 8.4.58 8.4.59 8.4.60 8.4.61 8.4.62 8.4.63 8.4.64 8.4.65 RSCU..........................................................................................................................217 Singleton Sites............................................................................................................217 Staden ........................................................................................................................218 Statements in input files .............................................................................................218 Swap...........................................................................................................................218 Synonymous change ..................................................................................................218 Taxa............................................................................................................................218 Topological distance...................................................................................................219 Topology.....................................................................................................................219 Transition....................................................................................................................219 Transition Matrix .........................................................................................................219 Transition/Transversion Ratio (R) ..............................................................................219 Translation..................................................................................................................219 Transversion...............................................................................................................219 Unrooted tree..............................................................................................................219 Variable site................................................................................................................220
INDEX .........................................................................................................221
Pop-up help links Dotted Underlined + Green Help Jumps Menu/Screen Items User-Entered Text Underlined + Green Italic Monospace font
statement
set of rules
Preface
2.3 Preface
Genome sequencing is generating vast amounts of DNA sequence data from a wide range of organisms. As a result, gene sequence databases are growing rapidly. In order to conduct efficient analyses of these data, there is a need for easy-to-use computer programs, containing fast computational algorithms and useful statistical methods. The objective of the MEGA software has been to provide tools for exploring, discovering, and analyzing DNA and protein sequences from an evolutionary perspective. The first version was developed for the limited computational resources that were available on the average personal computer in early 1990s. MEGA1 made many methods of evolutionary analysis easily accessible to the scientific community for research and education. MEGA2 was designed to harness the exponentially greater computing power and a graphical interface of the late 1990s, fulfilling the fast-growing need for more extensive biological sequence analysis and exploration software. It expanded the scope of its predecessor from single gene to genome wide analyses. Two versions were developed (2.0 and 2.1), each supporting the analyses of molecular sequence (DNA and protein sequences) and pair-wise distance data. Both could specify domains and genes for multi-gene comparative sequence analysis and could create groups of sequences that would facilitate the estimation of within- and among- group diversities and infer the higher-level evolutionary relationships of genes and species. MEGA2 implemented many methods for the estimation of evolutionary distances, the calculation of molecular sequence and genetic diversities within and among groups, and the inference of phylogenetic trees under minimum evolution and maximum parsimony criteria. It included the bootstrap and the confidence probability tests of reliability of the inferred phylogenies, and the disparity index test for examining the heterogeneity of substitution pattern between lineages. MEGA 4 continues where MEGA2 left off, emphasizing the integration of sequence acquisition with evolutionary analysis. It contains an array of input data and multiple results explorers for visual representation; the handling and editing of sequence data, sequence alignments, inferred phylogenetic trees; and estimated evolutionary distances. The results explorers allow users to browse, edit, summarize, export, and generate publication-quality captions for their results. MEGA 4 also includes distance matrix and phylogeny explorers as well as advanced graphical modules for the visual representation of input data and output results. These features, which we discuss below, set MEGA apart from other comparative sequence analysis programs As with previous versions, MEGA 4 is specifically designed to reduce the time needed for mundane tasks in data analysis and to provide statistical methods of molecular evolutionary genetic analysis in an easy-to-use computing workbench. While MEGA 4 is distinct from previous versions, we have made a special effort to retain the user-friendly interface that researchers have come to identify with MEGA. This interface is obtains information from the user only on a need-to3
know basis. Furthermore, the data subsets and output results are stored in files for viewing only if the user specifically needs to do so.
Preface
2.4 Acknowledgements
Many friends and colleagues have provided encouragement and assistance in the development of MEGA. Beta Test versions of MEGA have been used in the research laboratories of the authors, in the classrooms of Sudhir Kumar at the Arizona State University and Masatoshi Nei at the Pennsylvania State University, and by the thousands of users that signed up for the MEGA Beta program. The feedback and bug reports provided by these groups of users were invaluable to the development team. Almost all facets of design and implementation benefited from their comments and suggestions. MEGA software development is currently supported by research grants from the National Institutes of Health.
Preface
3.1.2 Installing MEGA The preferred way to install MEGA is directly from the website (www.megasoftware.net). A specially designed installation program automatically downloads MEGA and installs it in the location (directory) you specify. If you are unable to install MEGA directly from the website, you can download it as a single compressed ZIP file. Then you must use a program, such as WinZip, to uncompress this ZIP file in a temporary directory. Click on the MEGASETUP.EXE file to install MEGA on your computer automatically. Finally, you may install MEGA from a CD obtained from the authors. In this case, insert the media into the computer and then click on MEGASETUP.EXE. We recommend that you install MEGA in one of the three ways described above. Please do not simply copy MEGA-related files from one computer to another, as MEGA may not work properly if installed in this manner. 3.1.3 Uninstalling MEGA The preferred way to uninstall programs in Windows is to use Add/Remove Programs option in the control panel, which is accessible from the Start button on the lower left corner of your computer desktop. A dialog box (usually named Add/Remove programs) will display a list of programs. To remove MEGA, scroll
10
direct analysis in MEGA BLAST sequences from alignment directly Multiple Sequence Alignment Complete native implementation of ClustalW Ability to select all options on the fly Ability to align any user-selected region Ability to align translated cDNA sequences and automatic adjustment Sequencer (Trace) File editor/viewer View ABI (*.abi, .ab1) and Studfen (*.std?) Edit trace file Mask vector (or any other region) Launch direct BLAST search for whole or selected sequence Send data directly to Alignment Editor Integrated Web Browser and Sequence Fetching Direct "usual" web and GenBank browsing from MEGA One-click sequence fetching from databanks queries Send sequence data from BLAST
11
search directly into alignment Bookmark favorite sequence databank sites Data Handling Handling ambiguous states (R,Y,T, etc.) Extended MEGA format to save all data attributes Importing Data from other formats (Clustal/Nexus/etc.) Data Explorers Sequence Distance matrix Attributes supported Groups of Sequences/Taxa Domains Genes and Mixed Domain attributes Explicit labels for sites Automatic codon translation Selection of codon positions Selection of different site categories Visual Specification of Domains/Groups
12
Center Analysis Preferences Dialog Unlimited Data size for Analysis Genetic Code Table Selection Choose a desired table Ability to add/edit user defined tables
Computation of statistical attributes of a code table Degeneracy of codon positions Numbers of potential synonymous sites Inclusion of all known code tables Real-Time Caption Expert Engine Generate Captions for Distance Matrices Generate Captions for Phylogenies Generate Captions for Tests Generate Captions for Alignments Copy Captions to External Programs Save/Print Captions Integrated Text File Editor Unlimited Text File Size Multi-file Tabbed Display Columnar Block selection/Editing
13
Undo/Redo operations Line numbers Utilities to Format Sequences/Reverse complement etc. Copy Screenshots to EMF/WMF/Bitmap for presentation Sequence Data Viewer Two dimensional display of molecular sequences Display with identity symbol Drag-drop sorting of sequences Mixing coding and non-coding sequence display One-click translation Display with all or only selected taxa Data Export PAUP3, PHYLIP PAUP4, PHYLIP Interleaved Highlighting 0,2,4-fold degenerate sites Variable, parsimony informative sites Constant Sites Statistical Quantities estimation
14
DNA and protein sequence compositions Estimation by genes/domains/groups Codon Usage Estimation by genes/domains/groups Use only highlighted sites
MCL-based Estimation of Nucleotide Substitution Patterns 4x4 Rate Matrix Transition/Transversion Rate Ratios (k1, k2) Transition/Transversion Rate Bias (R) Substitution Pattern Homogeneity Test Composition Distance Disparity Index Monte-Carlo Test Distance Estimation Methods Nucleotide-by-Nucleotide Models No. of differences, pdistance, Jukes-Cantor, Kimura 2P Tajima-Nei, Tamura 3parameter, Tamura-Nei distance LogDet (Tamura-Kumar)
15
Maximum Composite Likelihood Subcomponents Transitions (ts), tranversions (tv), ts/tv ratio Number of common sites Account for rate variation among sites Relaxation of the homogeneity assumption Synonymous/Non-synonymous (Codon-by-Codon) Models Nei-Gojobori (1986) method Modified Nei-Gojobori method Li-Wu-Lou, PBL, Kumar method Subcomponents Synonymous (s), nonsynonymous (n) distances Numbers of synonymous and non-synonymous sites Differences and ratios (s-n, n-s, s/n, n/s) 4-fold degenerate site distances 0-fold degenerate site distances
16
Number of 0-fold and 4-fold degenerate sites Protein distance Number of differences, p-distance, Poisson Dayhoff and JTT distances Account for rate variation among sites Relaxation of the homogeneity assumption Distance Calculations Pair-wise Between Group Average Within Group Average Net between group Average Overall average Sequence Diversity Calculations Mean Diversity within Subpopulations Mean Diversity for Entire Population Mean Interpopulational Diversity Coefficient of Differentiation Variance Calculations Analytical
17
Bootstrap Handling missing data Automatic translation Automatic pasting of partial codons between exons Tests of Selection Codon-based tests Large sample Z-test Between Sequences Within groups Overall sequences Fisher's Exact Test Tajima's Test of Neutrality Molecular Clock Test Tajima's relative rate test Tree-making Methods Neighbor-Joining Randomized tie-breaking in bootstrapping Minimum Evolution method Branch-swapping (CloseNeighbor-Interchange; CNI)
18
Fast OLS computation method UPGMA Randomized tie-breaking in bootstrapping Maximum Parsimony Nucleotide sequences Protein sequences Max-mini branch-and-bound and min-mini searches Branch-swapping (CNI) Average branch length estimation Bootstrap Test of Phylogeny Neighbor-joining/UPGMA Minimum Evolution Maximum Parsimony Confidence Probability Test Neighbor-joining Minimum Evolution Consensus tree construction Condensed tree construction Distance Matrix Viewer View pair-wise distances
19
View between group distances View within group distances View distances and standard errors simultaneously Sort the distance matrix Drag-and-drop Group-wise By Sequence names Control display precision Export Data for printing or reimporting Tree Explorers Phylogeny Display and Graphic printing On-the-spot taxa name editing Multiple phylogeny views Linearized Tree Estimation of divergence time by calibrating molecular clock Copy to Clipboard/save to file as an EMF drawing Save to Newick format Read trees from Newick format
20
User specified control for Placement and precision of branch length Scale bar addition Collapsing branches or groups Display only a subtree Ability to view multiple trees in different viewers Tree Editing Flipping, re-rooting Add marker symbols to names Multi-color display and printing Change Tree Size Vertical separation between taxa Horizontal size Change Tree shape Multiple tree display Save tree session for future display What you see is what you get printing Multi- or single page printing Display images on tree for groups and taxa
21
3.2.2 Using MEGA in the Classroom Because MEGA includes many statistical methods for the study of molecular evolution in an interactive framework, it is instructive for classroom teaching. If you are interested in using MEGA in the classroom, there are no restrictions. Your students may download a copy from the website www.megasoftware.net or you may install copies on multiple computers in a common computing area. However, if you want to use MEGA in any other form, please contact the authors by e-mail ([email protected]). If you are using MEGA in classroom teaching, please send us the following information by e-mail for our records ([email protected]). (1) Your name, position and institution, (2) course number and title, (3) number of students, and (4) course semester and year.
3.2.3 Technical Support and Updates All minor (bug fix) and major updates of MEGA will be made available at the website www.megasoftware.net. We will send e-mail to all registered MEGA users whenever an updated version of the program or the online help manual is made available. 3.2.4 Reporting Bugs If you encounter technical problems such as unexplained errors, documentation inconsistencies, or program crashes, please report them to us by e-mail at [email protected]. For further information on reporting problems, consult the bug report page on the MEGA website (www.megasoftware.net). Please note that telephone inquiries will not be accepted. Please include the following information in your report: (1) your name and address, (2) the version of MEGA you are working with, (3) the version of Windows you are working in, (4) a copy of your data file (if possible), (5) a description of the problem, and (6) the sequence of events that led to that problem [this often is crucial to understanding and remedying the problem quickly]. 3.2.5 Guide to Notations Used Item Directory & file names File name extensions Email address/URLs 22 Convention Small Cap + Bold Small Cap + Bold Underlined Example INSTALL.TXT .TXT, .DOC, .MEG www.megasoftware.net
Pop-up help links Dotted Underlined + Green Help Jumps Menu/Screen Items User-Entered Text Underlined + Green Italic Monospace font
statement
set of rules
23
9. Trees from Distance Data 3.3.2 Creating Multiple Sequence Alignments In this example, we will create an alignment from protein sequence data that will be imported into the alignment editor using different methods. Ex 1.0.1: Start MEGA by double-clicking on the MEGA desktop icon, or by using the Windows start-menu to click on the MEGA icon located in the programs folder. Ex 1.0.2: Launch the Alignment Explorer by selecting the Alignment|Alignment Explorer/CLUSTAL menu command. In order to align sequences contained in a Sequence Data File, do the following: Ex 1.1.1: Add unaligned sequences from the hsp20.fas example file into the Alignment Explorer by clicking selecting the Data|Open|Retrieve Sequences from File menu command. Ex 1.1.2: Select the Edit|Select All menu command to select every site for all sequences in the alignment. Ex 1.1.3: Select the Alignment|Align by ClustalW menu command to align the selected sequences data using the ClustalW algorithm. Ex 1.1.4: Save the current alignment session by selecting the Data|Save Session menu item. This will allow the current alignment session to be restored for future editing. Ex 1.1.5: Exit the Alignment Explorer by selecting the Data|Exit Alignment Explorer menu item. A message will appear asking if you would like to save the data to a MEGA file. Choose "YES," and then a "Save As" dialog box will appear. Enter hsp20_aligned.meg as the file name, and click the "Save" button. An input box will appear asking for a title for the data. Enter "HSP 20 Aligned by MEGA" as the title, and click the "OK" button. Another dialog box will appear asking you if the sequence data is protein coding. In this case, click "Yes." A final dialog box will appear asking you if you would like to open the data file in MEGA. Click "Yes." Now, we will examine how to send sequence data from the Internet (Web Explorer) to the Alignment Explorer. Ex 1.2.1: If the Alignment Explorer already contains sequence data, select the Data| Create new menu command to create a new alignment from Alignment Explorer window. Choose "YES" on the dialog box that appears to indicate that you are creating a DNA sequence. Ex 1.2.2: Activate the Web Explorer tab by selecting Web|Query Gene Banks from the menu. Ex 1.2.3: When the NCBI Entrez site is loaded, select either the nucleotide or protein database, enter a search term into the search box, and press the "GO" button. Ex 1.2.4: When the search results are displayed, select the specific search item and choose "Sequence" from the menu bar. Press the "Add to Alignment" button
24
located to the left of the address box. This will display the Web Fetch dialog window. Ex 1.2.5: Click the box to the left of each accession number whose sequences information you would like to fetch from the web. When you are done, you can select accessions by pressing the "Fetch" button. Ex 1.2.6: When the status column indicates that all sequences are fetched, press the "Send to Alignment" button to send the fetched sequence data to the Alignment Explorer. Ex 1.2.7: Align the fetched data using the steps detailed in Ex 1.1.2 Ex 1.1.5. You may also open a trace file in the Trace Data Viewer/Editor and send it directly to the Alignment Explorer. 3.3.3 Estimating Evolutionary Distances from Nucleotide Sequences In this example, we will compute various distances for the Adh sequences from 11 Drosophila species. We will use the data from the previous example to study various sequence statistics. In addition, we will see how these distances can be written in a file in various formats through options for page size, precision, and relative placement of distances and their standard errors. Ex 2.0.1: Start MEGA by double-clicking on the MEGA desktop icon, or by using the Windows start-menu to click on the MEGA icon located in the programs folder. Activate the data file Drosophila_Adh.meg using the instructions given in Ex 2.2.1 Ex 2.2.3. We will begin by computing the proportion of nucleotide differences between each pair of Adh sequences. Ex 2.1.1: Select the Distance|Compute Pair-wise command (F7) to display the distance analysis preferences dialog box. Ex 2.1.2: In the Options Summary tab, click the Model preference pull-down and then select the Nucleotide|p-distance option. Ex 2.1.3: You may look around at the other options, but at this moment, we will be using the defaults for the remaining options. Click "Compute" to begin the computation. Ex 2.1.4: A progress indicator will appear briefly, and then the distance computation results will be displayed in grid form in a new window. We will now compute distances and compare them using other methods. Ex 2.2.1: Select the Distance|Compute Pair-wise command. Use the Models pull-down to select the Nucleotide|Jukes-Cantor method. Now click "Compute" to begin the computation. Ex 2.2.2: Follow the steps in Ex. 2.1.1- Ex 2.1.3 and compute the Tamura-Nei Distance. Ex 2.2.3: You should now have open results windows containing the distances estimated by three different methods, which you can now compare. Ex 2.2.4: After youve compared the results, select the File|Quit Viewer option for each result window.
25
Summary: we have computed nucleotide distances from the nucleotide sequence data in the file Drosophila_Adh.meg. Let us now compute the proportion of amino acid differences. Note that MEGA will automatically translate the nucleotide sequences into amino acid sequences using the selected genetic code table. Ex 2.3.1: Select the Distance|Compute Pair-wise command (F7) to display the distance analysis preferences dialog box. Ex 2.3.2: In the Options Summary tab, click the Models pulldown and then select the Amino Acid|p-distance option. Ex 2.3.3: Click the "Compute" button to accept the default values for the rest of the options and begin the computation. Ex 2.3.4: A progress dialog box will appear briefly. As with the previous nucleotide estimation, a results viewer window will be displayed, showing the distances in a grid format. Ex 2.3.5: After you have inspected the results, use the File|Quit Viewer command to close the results viewer. To shut down MEGA, select the File|Exit menu command from the main MEGA application window and indicate that you would like to close the data file.
3.3.4 Constructing Trees and Selecting OTUs from Nucleotide Sequences The Crab_rRNA.meg file contains nucleotide sequences for the large subunit mitochondrial rRNA gene from different crab species (Cunningham et al. 1992). Since the rRNA gene is transcribed, but not translated, it falls in the category of non-coding genes. Let us use this data file to illustrate the procedures of building trees and in-memory sequence data editing, using the commands present in the Data and Phylogeny menus. Ex 3.0.1: Start MEGA by double-clicking on the MEGA desktop icon, or by using the Windows start-menu to click on the MEGA icon located in the programs folder. Ex 3.1.1: Activate the data file Crab_rRNA.meg using the instructions given in Ex 2.1.1 - Ex 2.1.3. Let us start by building a neighbor-joining tree. Ex 3.2.1: Select the Phylogeny|Construct Phylogeny|Neighbor-Joining command to display the analysis preferences dialog box. Ex 3.2.2: In the Options Summary tab, click the Models pull-down (found in the Substitution Model section), and then select the Nucleotide|p-distance option. Ex 3.2.3: Click "Compute" to accept the defaults for the rest of the options and begin the computations. A progress indicator will appear briefly before the tree displays in the Tree Explorer. Ex 3.2.4: To select a branch, click on it with the left mouse button. If you click on a branch with the right mouse button, you will get a small options menu that will let you flip the branch and perform various other operations on it. To edit the
26
OTU labels, double click on them. Ex 3.2.5: Change the branch style by using the View|Tree/Branch Style command from the Tree Explorer menu. Ex 3.2.6: Press the Up arrow key () just once to move the cursor upwards to the next branch. Ex 3.2.7: Select the View|Topology Only command from the Tree Explorer menu to display the branching pattern (without actual branch lengths on the screen. Ex 3.2.8: Press F1 to examine the help for tree editor. Use this feature to become familiar with the many operations that Tree Explorer is capable of performing. Ex 3.2.9: DO NOT remove the tree from the screen. We shall use it for illustrating how a tree can be printed. Now, you will print the NJ tree that you have on your screen in MEGA. Ex 3.3.1: Select the File|Print command from the Tree Explorer menu to bring up a standard Windows print dialog. Ex 3.3.2: To restrict the size of the printed tree to a single sheet of paper, choose the File|Print in a Sheet command from the Tree Explorer menu. Ex 3.3.3: Select the File|Exit Tree Explorer (Ctrl-Q) command to exit the Tree Explorer. A warning box will inform you that your tree data has not been saved. Click the "OK" button to close Tree Explorer without saving the tree session. In MEGA, you can also construct Maximum Parsimony (MP) trees. Let us construct a Maximum Parsimony tree(s) by using the branch-&-bound search option. Ex 3.4.1: Select the Phylogeny |Construct Phylogeny | Maximum Parsimony command. In the Analysis Preference window, choose the Max-Mini Branch-&Bound Search option in the MP Tree Search Options tab. Ex 3.4.2: Click the "Compute" button to accept the defaults for the other options and begin the calculation. A progress window will appear briefly, and the tree will be displayed in Tree Explorer. Ex 3.4.3: Now print this tree (See Ex 3.3.1 - 3.3.2). You do not have to specify the printer name again, because MEGA remembers your selection. Ex 3.4.4: Select the File|Exit Tree Explorer (Ctrl-Q) command to exit the Tree Explorer. A warning box will inform you that your tree data has not been saved. Click "OK" to close Tree Explorer without saving the tree session. Ex 3.4.5: Compare the NJ and MP trees. For this data set, the branching pattern of these two trees is identical. As an exercise, use the Heuristic Search for finding the MP tree. In this example, you will find the same tree as that obtained by the branch-and-bound method if you use the default option (search factor equal to 2 for all steps of OTU addition). However, the computational time will be much shorter. Actually, in this example, even a search factor equal to 0 will recover the MP tree.
27
We will now examine how some data editing features work in MEGA. For noncoding sequence data, OTUs as well as sites can be selected for analysis. Let us remove the first OTU from the current data set. Ex 3.5.1: Select the Data|Setup/Select Taxa & Groups command. A dialog box is displayed. Ex 3.5.2: All the OTU labels are checked ( ) in the left box. This indicates that all OTUs are included in the current active data subset. To remove the first OTU from the data, uncheck the checkbox next to the OTU name in the left pane. Ex 3.5.3: Now, from this data set, construct a neighbor-joining tree (Ex 3.2.1) that contains 12 OTUs instead of 13. To inactivate the operational data set and end the current session of MEGA, press the hot-key Alt + X.
3.3.5 Tests of the Reliability of a Tree Obtained In this example, we will conduct two different tests using protein-coding genes from the chloroplast genomes of nine different species. Ex 4.0.1: Start MEGA by double-clicking on the MEGA desktop icon, or by using the Windows start-menu to click on the MEGA icon located in the programs folder. Ex 4.0.2: Activate the data in the Chloroplast_Martin.meg file by using the File|Open command. We will begin with the bootstrap test for the neighbor-joining tree. Ex 4.1.1: Select the Phylogeny |Bootstrap Test of Phylogeny|Neighbor-Joining Tree command from the main application menu. Ex 4.1.2: An analysis preferences dialog box appears. Use the Models pulldown to ensure that the Amino Acid|p-distance model is selected. Note that only the Amino Acid submenu is available. Ex 4.1.3: Click "Compute" to accept the default values for the rest of the options. A progress indicator provides the progress of the test as well as the details of your analysis preferences. Ex 4.1.4: Once the computation is complete, the Tree Explorer appears and displays two tree tabs. The first tab is the original Neighbor-Joining tree, and the second is the Bootstrap consensus tree. Ex 4.1.5: To produce a condensed tree, use the Compute|Condensed Tree menu command from the Tree Explorer menu. This tree shows all the branches that are supported at the default cutoff value of BCL 50. Ex 4.1.6: To change this value, select the View|Options menu command and click the cutoff values tab. Select the Compute|Condensed Tree menu command and the NJ tree will reappear. Ex 4.1.7: Print this tree. (see Ex 3.3.1 - Ex 3.3.2) Ex 4.1.8: Select the File|Exit Tree Explorer (Ctrl-Q) command to exit the Tree Explorer. A warning box will inform you that your tree data has not been saved. Click "OK" to close Tree Explorer without saving the tree session.
28
For neighbor-joining trees, you may conduct the standard error test for every interior branch by using the Phylogeny|Neighbor-Joining command. In MEGA, this test is available for the p-distance, Poisson Correction, and Gamma distance for amino acid sequences. Since we did the above analysis for the p-distance, we will use the same distance estimation method to compare the results from the bootstrap and standard error tests. Ex 4.2.1: Go to the Phylogeny menu and select the Construct Phylogeny|Neighbor-Joining command to produce an analysis preferences dialog box. In the Models preference pull-down, be sure that p-distance is the model chosen. Click on the Test of Phylogeny tab to reveal the test options. Under the Test of Inferred Phylogeny option group, check the Interior Branch Test option. Ex 4.2.2: Click "Compute" to begin the computation. A progress indicator will appear briefly. The neighbor-joining tree with confidence probabilities (CP) from the standard error test of branch lengths is displayed on the screen. Ex 4.2.3: Compare the CP values on this tree with the BCL values of the tree that you printed in the previous procedure. Ex 4.2.4: Now exit MEGA using the Alt + X command.
3.3.6 Working With Genes and Domains Ex 5.0.1: Start MEGA by double-clicking on the MEGA desktop icon, or by using the Windows start-menu to click on the MEGA icon located in the programs folder. Ex 5.0.2: Activate the data present in the Contigs.meg file by using the File|Open command. We will now examine how to define and edit gene and domain definitions Ex 5.1.1: Select the Data|Setup/Select Genes & Domains menu command. Ex 5.1.2: Delete the Data domain by right clicking on it and selecting Delete Gene/Domain from the popup menu. Ex 5.1.3: Right-click on the Genes/Domains item in the Names column, and select Add New Domain. Right-click on the new domain and select Edit Name from the popup menu and set the name to "Exon1." Ex 5.1.4: Select the ellipsis button next to the question mark in the From column to set the first site of the domain. When the site selection window appears, select site number 1 and push the "OK" button. Ex 5.1.5: Select the ellipsis button in the To column to set the last site of the domain. When the site selection window appears, select site number 3918 and push the "OK" button. Ex 5.1.6: Check the box in the Coding column to indicate that this domain is protein coding. Ex 5.1.7: Add two more domains to the Genes/Domains item. One of these domains will be named "Intron1" and will begin at site 3919 and end at site
29
5191. The other will be named "Exon2" and will begin at site 5192 and end at site 8421. Be sure to check the checkbox in the Coding column for "Exon2" to indicate a protein-coding domain. Ex 5.1.8: Right-click on the Genes/Domains item and select Insert New Gene from the popup menu. Change the name of this gene to "Predicted Gene," and click-and-drag all of the domains to this new gene such that they are displayed as children of the "Predicted Gene" node in the display tree. Ex 5.1.9: Press the "Close" button at the bottom of the window to exit the Gene/Domain manager. We will now use these domain definitions in computing pair-wise distances. Ex 5.2.1: Select the Distances|Compute Pair-wise menu item from the main menu. Ex 5.2.2: On the Include Sites tab, make sure that the "Noncoding sites" option does not have a checkmark next to it. Go back to the main menu and press the "Compute" button to begin the analysis. Ex 5.2.3: When the computation is complete the Distance Explorer will display the pair-wise distance computed using only the sequence data from exonic domains of the "Predicted Gene."
3.3.7 Test of Positive Selection In this example, we present various analyses of protein-coding nucleotide sequences for five alleles from the human HLA-A locus (Nei and Hughes 1991). Ex 6.0.1: Start MEGA by double-clicking on the MEGA desktop icon, or by using the Windows start-menu to click on the MEGA icon located in the programs folder. Ex 6.1.1: Activate the data present in the HLA_3Seq.meg file by using the File|Open command. Ex 6.1.2: Now that the data file is active, note that various details about the data file are displayed at the bottom of the main application window, and more menu items have become available on the main menu. Let us compute the synonymous and non-synonymous distances appropriate for studying positive Darwinian selection in this set of antigen recognition codons. Ex 6.2.1: Select the Selection|Codon-based Z-Tests from the menu command. An analysis preferences dialog appears. Use the Models pull-down in the Options Summary tab to select Syn-Nonsysnonymous|Nei-Gojobori Method|pdistance model. In the Test Hypothesis (HA: alternative) tab, select Positive Selection (HA: dN > dS) from the pull-down, and select the Overall Average from the Analysis Scope tab. Click the GAPS/Missing Data tab and make sure that the Pair-wise Deletion option is selected. Ex 6.2.2: Click on "Compute" to accept the default values for the remaining options. A progress indicator appears briefly; the computation results are 30
displayed in a results window in grid format. Ex 6.2.3: The Prob column contains the probability computed (must be <0.05 for hypothesis rejection at 5% level), and the Stat column contains the statistic used to compute the probability. The difference in synonymous and non-synonymous substitutions should be significant at the 5% level. Ex 6.2.4: Exit MEGA and deactivate the active data file using the Alt + X command. 3.3.8 Managing Taxa with Groups Ex 7.0.1: Start MEGA by double-clicking on the MEGA desktop icon, or by using the Windows start-menu to click on the MEGA icon located in the programs folder. Ex 7.0.2: Activate the data present in the Crab_rRNA.meg file by using the File|Open command. We will now examine how to define and edit groups of taxa. Ex 7.1.2: Select the Data|Setup/Select Taxa & Groups menu command. Ex 7.1.3: Press the "New Group" button found below the Taxa/Groups pane to add a new group to the data. Name this new group "Pagurus." Ex 7.1.4: While holding the Control button on the keyboard, click on all of the Pagurus species in the Ungrouped Taxa pane to highlight them. When they are all highlighted, press the left-facing arrow button found on the vertical toolbar between the two windowpanes. Ex 7.1.5: Select the "All" group in the Taxa/Groups pane and press the "New Group" button to add a second group. Name this group "Non-Pagurus." Add the remaining unassigned taxa to this group and press the "Close" button at the bottom of the window to exit this view. Ex 7.1.6: Now that groups have been defined, the Compute Within Group Mean, Compute Between Group Means, and Compute Net Between Group Means menu commands from the Distance menu item may be used to analyze the data.
3.3.9 Computing Statistical Quantities for Nucleotide Sequences In this exercise, we illustrate the use of the Data Explorer for computing various statistical quantities of nucleotide sequences. In addition, we explain shortcuts for obtaining frequently used commands, methods of accessing on-line help, and the distinction between enabled and disabled commands. Ex 8.0.1: Start MEGA by double-clicking on the MEGA desktop icon, or by using the Windows start-menu to click on the MEGA icon located in the programs folder. We now will examine the contents of the file Drosophila_Adh.meg by using
31
the built-in Text Editor. Ex 8.1.1: Click on the File menu item to expand the menu options. To activate the text editor, either click File |Text Editor or press the F3 key on your keyboard. In the text editor, use the File|Open command to open the Drosophila_Adh.meg file. Ex 8.1.2: Examine the Drosophila_Adh.meg file. Take note of the #mega format specifier, title, OTU names, and the interleaved sequence data. Ex 8.1.3: We advise that you exit the text editor before proceeding with data analysis. Select the File menu item from the text editor's menu, and click the Exit option from the expanded menu. If the editor asks you if you would like to save the changes that you have made to the file, select No. To study statistical quantities of the data in the file Drosophila_Adh.meg, we must first activate it. Ex 8.2.1: You can activate a data file using the link titled "Click me to activate a data file" in the main application window, or select the File menu item from the main menu and click the Open Data option from the expanded menu. You may also press the F5 key on your keyboard. All of these methods will display a standard Windows open file dialog box. Ex 8.2.2: Open the Drosophila_Adh.meg data file under the Examples folder. Ex 8.2.3: A progress dialog box will appear briefly. When the data file is active, details about it are displayed at the bottom of the main application window. More menu items now are available on the main menu. Examine the main menu. Now that the data file is active, the menu items Data, Distances, Pattern, and Selection have become available. We now will use Data Explorer to compute some basic statistics for these data. Ex 8.3.1: Select the Data|Data Explorer command, or press the F4 key if the Sequence Data Viewer is not available. Ex 8.3.2: DNA sequences are displayed on the screen in a grid format. Use the left and right arrow keys () or the mouse to move from site to site; note a change in the bottom-left corner of the display. Use the up and down () arrow keys or the mouse to move between OTUs. The Total Sites view on the bottomleft panel displays the sequence length under the current site position, and the Highlighted Sites display "None" because no special site attributes are yet highlighted. Ex 8.3.3: To highlight variable sites, select the Highlight|Variable Sites option, click the button labeled "V" from the shortcut bar below the menu, or press the V key. All sites that are variable are highlighted, and the number in the Highlighted Sites displays changes. When you press V again, the sites return to the normal color, and Highlighted Sites displays "None." Ex 8.3.4: Now to highlight the parsimony-informative, press the P key, click on the button labeled "Pi" from the shortcut bar below the menu, or select the Highlight/Parsim-info sites menu command. To highlight 0, 2, and 4-fold degenerate sites, press the 0, 2, or 4 keys from the Sequence Data Explorer, respectively, click on the corresponding button from the shortcut bar below the
32
menu, or select the corresponding command from the highlight menu. Ex 8.3.5: To compute the nucleotide base frequencies, select the Statistics|Nucleotide Composition menu command. This will calculate the composition and display the results of the calculation in a text file using the builtin text editor. Ex 8.3.6: To compute codon usage, select the Statistics|Codon Usage menu command. This will calculate the codon usage and display the results of the calculation in a text file using the built-in text editor. Ex 8.3.7: To compute nucleotide pair frequencies, select the Statistics|Nucleotide Pair Frequencies|Directional, or the Statistics|Nucleotide Pair Frequencies|Unidirectional menu command. This will calculate the pair frequencies and display the results of the calculation in a text file using the builtin text editor. Ex 8.3.8: To translate these protein-coding sequences into amino acid sequences and back, press the T key, or select the Data|Translate/Untranslate menu command from the Data Explorer menu. Ex 8.3.9: Once the sequences are translated, calculate the amino acid composition by selecting the Statistics|Amino Acid Composition menu command from the Data Explorer Menu. Ex 8.3.10: To shut down MEGA, select the File|Exit menu command from the main MEGA application window and close the data file.
3.3.10 Constructing Trees from Distance Data This example introduces procedures for selecting options from menus, opening files in the read-only mode, activating a distance data file, and building trees from the distance data. Ex 9.0.1: Start MEGA by double-clicking on the MEGA desktop icon, or by using the Windows start-menu to click on the MEGA icon located in the programs folder. Ex 9.0.2: A Splash screen appears which displays the current version of MEGA. Ex 9.0.3: The Splash screen automatically disappears, and the MEGA application becomes available. In this example, we use the data in the Hum_Dist.meg file. Although we will not edit the file, we will use MEGA's built-in text editor to examine its contents before we proceed further. Ex 9.1.1: Click on File menu to expand the menu options. Click on the menu item labeled Text Editor, or press the F3 key to activate the built-in text editor. Ex 9.1.2: Use the Text Editor to view the contents of the Hum_Dist.meg file. To open a file with the Text Editor, click on the folder icon below the main menu or on the File menu item, then choose Open from the expanded menu. You may also use the key combination Ctrl+O to open a file. All of these options will lead you to a standard Windows open file dialog box. Use this dialog box to locate the Examples folder found in the MEGA installation directory, and open the
33
Hum_Dist.meg file. After you open the file with the dialog box, you will see the file contents displayed in the Text Editor window. Ex 9.1.3: Examine the contents of the data file and then exit the Text Editor before proceeding with data analysis. Select the File menu item from the Text Editors menu, and click Exit from the expanded menu. If the editor asks you if you would like to save your changes, select No. A data file must be activated before an analysis can be performed. (Note that opening a file for browsing or editing is different from activating it for analysis). Now we will activate the Hum_Dist.meg data file. Ex 9.2.1: You can activate a data file by using the link titled "Click me to activate a data file" in the main application window, or by selecting the File menu item from the main menu and clicking the Open Data option from the expanded menu. You can also press the F5 key. All of these methods will display a standard Windows open file dialog box. Ex 9.2.2: Use the open file dialog box to locate and open the Hum_Dist.meg file located in the Examples folder. After you have selected the file for opening, a progress indicator will appear briefly. Ex 9.2.3: When the data file is active, the Input Distance Data Viewer is launched to display the contents of the data file. We will now make a phylogenetic tree from the distance data. Ex 9.3.1: Switch back to main MEGA application window. From the expanded menu in the Phylogeny menu, select the Construct Phylogeny|Neighbor-Joining command. Ex 9.3.2: A confirmation Analysis Preferences window will appear, indicating that MEGA is ready to conduct the requested analysis. Click on the button labeled "Compute." A progress meter will appear briefly. Ex 9.3.3: The Tree Explorer will display a neighbor-joining tree on the screen when the analysis completes. To exit the Tree Explorer, select the File menu item from the Tree Explorer menu and click the Exit Tree Explorer option from the expanded menu. The Tree Explorer will ask you if you would like to save the tree data. If you save the tree, you can use Tree Explorer to view and manipulate it in the future. With this, let us end this session of MEGA. Ex 9.4.1: Go to the File menu and click on the Close Data command. The program will inquire if you would like the active data to be closed. Select "Yes." Ex 9.4.2: To exit MEGA, press Alt + X, or select the Exit command from the expanded File menu.
34
4 Part II: Assembling Data for Analysis 4.1 Text File Editor and Format Converter
MEGA includes a Text File Editor, which is useful for creating and editing ASCII text files. It is invoked automatically by MEGA if the input data file processing modules detect errors in the data file format. In this case, you should make appropriate changes and save the data file. The text editor is straightforward if you are familiar with programs like Notepad. Click on the section you wish to change, type in the new text, or select text to cut, copy or paste. Only the display font can be used in a document. You can have as many different text editor windows open at one time and you may close them independently. However, if you have a file open in the Text Editor, you should save it and close the Text Editor window before trying to use that data file for analysis in MEGA. Otherwise, MEGA may not have the most up-to-date version of the data. The Text File Editor and Format converter is a sophisticated tool with numerous special capabilities that include: Large files The ability to operate on files of virtually unlimited size and line lengths. General purpose Used to view/edit any ASCII text file. Undo/ReDo The availability of an unlimited depth of undo/redo options Search/Replace Searches for and does block replacements for arbitrary strings. Clipboard Supports familiar clipboard cut, copy, and paste operations. Normal and Column blocks Supports regular contiguous line blocks and columnar blocks. This is quite useful while manually aligning sequences in the Text Editor. Drag/Drop Moves text with the familiar cut and paste operations or you can select the text and then move it with the mouse. Screenshots Creates screen snapshots for teaching and documentation purposes directly from the edit window. Printing Prints the contents of the edit file.
The Text Editor contains a menu bar, a toolbar, and a status bar. The Menu bar Menu Description File menu The File Menu contains the functions that are most commonly used to open, save, rename, 35
print, and close files. (Although there is no separate "rename" function available, you can rename a file by choosing the Save As menu item and giving the file a different name before you save it.) Edit menu The Edit Menu contains functions that are commonly used to manipulate blocks of text. Many of the edit menu items interact with the Windows Clipboard, which is a hidden window that allows various selections to be copied and pasted across documents and applications. The Search Menu has several functions that allow you to perform searches and replacements of text strings. You can also jump directly to a specific line number in the file. The Display Menu contains functions that affect the visual display of files in the edit windows. The Utilities Menu contains several functions that make this editor especially useful for working with files containing molecular sequence data (note that the MEGA editor does not try to understand the contained data, it simply operates on the text, assuming that the user knows what (s)he is doing.
Search menu
Toolbar The Toolbar contains shortcuts to some frequently used menu commands. Status Bar The Status bar is positioned at the bottom of the editor window. It shows the position of the cursor (line number and position in the line), whether the file has been edited, and the status of some keyboard keys (CAPS, NUM, and SCROLL lock). Hotkeys and Shortcut keys Many menu items have a hotkey and/or a shortcut key. These are special key combinations that are helpful for people who are more comfortable using a keyboard than the mouse. Hotkeys are identified by an underscore character in the name of the menu item, e.g., "File", "New". These allow you to hold down the Alt-key, which is usually found next to the space bar on the keyboard, then hit the underlined letter to produce the same action as if you clicked that name with the mouse. We show this using the notation <Alt>+key e.g., the hotkey for the file menu item is shown as <Alt>+F. Be sure that you depress both keys together, holding the <Alt> key down a little bit longer than the letter key. (Some people try hitting both keys simultaneously, as if theyre hitting two keys on a piano 36
keyboard. Quite often, this approach does not produce the desired results.) For instance, you could create a new file by clicking the mouse on the "File" menu item, then clicking on the "New" item beneath it. Using hotkeys, you could type <Alt>+F followed by <Alt>+N. Or, more simply, while youre holding down the <Alt> key, hit the F key followed by the N key, then release the <Alt> key. You might notice that several menu items, e.g., the New Item on the File menu, show something to the right that looks like Ctrl+N. This is called a Shortcut key sequence. Whereas executing a command with hotkeys often requires several keystrokes, shortcut keys can do the same thing with just one keystroke. Shortcut keys work the same as hotkeys, using the <Ctrl> key instead of the <Alt> key. To create a new file, for example, you can hold down the <Ctrl> key and hit the N key, which is shown as <Ctrl>+N here. (In the menus, this appears simply as Ctrl+N.) Not all menu items have associated shortcut keys because there are only 26 shortcut keys, one for each letter of the alphabet. Hotkeys, in contrast, are localized to each menu and submenu. For hotkeys to work, the menu item must be visible whereas shortcut keys work at any time. For instance, if you are typing data into a text file and want to create a note in a new window, you may simply hit the shortcut key sequence, <Ctrl>+N to generate a new window. After you type the note, you can hit <Ctrl>+S to save it, give it a file name, hit the enter key [this part doesnt make sense]; then you can hit the <Alt>+F+C hotkey sequence to close the file (there is no shortcut key for closing a file).
Open File in New Window: Launches a new instance to view/edit another file. Open File: Allows you to select another file to view/edit in the current window. Save File: Save the current data to a file in Staden format. Print: Prints the current trace data, excluding all masked regions. Add to Alignment Explorer: DNA sequence data, excluding all masked regions, is sent to the Alignment Explorer and appears as a new sequence at the end of the current alignment. Exit: Closes the current window.
Edit menu
Copy: This menu provides options to (1) copy DNA sequences from FASTA or plain text formats to the clipboard and (2) copy the exact portion you are viewing of the currently displayed trace image to the clipboard in the Windows Enhanced Meta File format. For FASTA format copying, both the sequence name and the DNA data will be copied, excluding the masked regions. To copy only the selected portion of the sequence, use the plain text copy command (If nothing is selected, then the plain text command will copy the entire sequence, except for the masked regions). Mask Upstream: Mask or unmask region to the left (upstream) of the cursor. Mask Downstream: Mask or unmask region to the right (downstream) of the cursor. Reverse Complement: Reverse complements the entire sequence.
Search menu
Find: Finds a specified query sequence. Find Next: Finds the next occurrence of the query sequence. To specify the query sequence, first use the Find menu command. Find Previous: Finds the previous occurrence of a query sequence. To specify the query sequence, first use the Find command. Next N: Go to the next indeterminate (N) nucleotide. Search in File: This command searches another file, which you specify, for the selected sequence in the current window. It can be used when you are assembling sequence subclones to build a contig. Do BLAST Search: Launch web browser to BLAST the currently selected sequence. If nothing is selected, the entire sequence, excluding the masked regions, will be used.
38
This causes the web browser window to navigate back to the web location found before the current site in the explorer location history. This causes the web browser window to navigate forward to the web location found after the current site in the explorer location history. This causes the web browser to terminate loading a web location. This causes the web browser to reload the current web location. This causes the web browser to extract sequence data from the current web page and send it to Alignment Builders alignment grid as new sequence rows. If the web explorer is unable to find properly formatted sequence data in the current web page a warning box will appear. Address The web location, or address field, is located in the second Field toolbar. This field contains the URL of the current web location as well as a pull down list of previously visited URLs. If a new URL is entered into the box and the Enter key is pressed, the web explorer will attempt to navigate to the entered URL. Links This toolbar provides shortcuts to a selection of websites. There are number of menus in the web browser, including Data, Edit, View, Links, Go, and Help. These menus provide access to routine functionalities, which are self-explanatory in use.
4.4.2 Copy Screenshot to Clipboard Utilities | Copy Screenshot to Clipboard This item presents three other options for selecting the format of an image that is being copied to the clipboard. Once it is copied, it can be pasted in any other graphic or word processing program. Bitmap Format: This is the common Windows Bitmap (BMP) Format. Windows Metafile Format: This selects the Windows Metafile Format (WMF)
39
Enhanced Metafile Format: This selects the Windows Enhanced Metafile Format. 4.4.3 Format Selected Sequence Utilities | Convert to Mega Format This submenu presents four other menu items that offer some common ways of reformatting text. Merge Multiple Lines: This is used to merge several separate lines into one long (very wide) line Remove Spaces/Digits: This is used to remove spaces and digits from a genetic sequence. Insert Spaces Every 3: This is used to break the selected text into threecharacter chunks (e.g., codons). Note that it does not remove any already existing spaces. Insert Spaces Every 10: This is used to break the selected text into tencharacter chunks. 4.4.4 Reverse Complement Utilities | Reverse Complement This item reverses the order of characters in the selected block and then replaces each character by its complement. Only A, T, U, C, and G are complemented; the rest of the characters are left as they are. Please use it carefully as MEGA does not validate whether the characters in the selected block are nucleotides. 4.4.5 Convert to Mega Format (in Text Editor) Utilities | Convert to Mega Format This item converts the sequence data in the current edit window, or in a selected file, into a MEGA format file. It brings up a dialog box, which allows you to choose the file and/or the format for this purpose. MEGA converts the data file and displays the converted data in the editor. Files written in a number of popular data formats can be converted into MEGA format. MEGA supports the conversion of CLUSTAL, NEXUS (PAUP, MacClade), PHYLIP, GCG, FASTA, PIR, NBRF, MSF, IG, and XML formats. Details about how MEGA reads and converts these file formats are given in the section Importing Data from Other Formats.
implementation (for the complete sequence or data in any rectangular region). The Alignment Explorer also provides tools for exploring web-based databases (e.g., NCBI Query and BLAST searches) and retrieving desired sequence data directly into the current alignment. The Alignment Explorer has the following menus in its main menu: Data, Edit, Search, Alignment, Web, Sequencer, Display, and Help. In addition, there are Toolbars that provide quick access to many Alignment Explorer functions. The main Alignment Explorer window contains up to two alignment grids. For amino acid input sequence data, the Alignment Explorer provides only one view. However, it offers two views of DNA sequence data: the DNA Sequences grid and the Translated Protein Sequences grid. These two views are present in alignment grids in the two tabs with each grid displaying the sequence data for the current alignment. Each row represents a single sequence and each column represents a site. A "*" character is used to indicate site columns, exhibiting consensus across all sequences. An entire sequence may be selected by clicking on the gray sequence label cell found to the left of the sequence data. An entire site may be selected by clicking on the gray cell found above the site column. The alignment grid has the ability to assign a unique color to each unique nucleotide or amino acid and it can display a background color for each cell in the grid. This behavior can be controlled from the Display menu item found in the main menu. Please note that when the ClustalW alignment algorithm is initiated, it only will align the sites currently selected in the alignment grids. Multiple sites may be selected by clicking and then dragging the mouse within the grid. Note that all of the manual or automatic alignment procedures carried out in the Protein Sequences grid will be imposed on the corresponding DNA sequences as soon as you flip to the DNA sequence grid. Even more importantly, the Alignment Explorer provides unlimited UNDO capabilities. 4.5.2 Creating Multiple Sequence Alignments In this example, we will create an alignment from protein sequence data that will be imported into the alignment editor using different methods. Ex 1.0.1: Start MEGA by double-clicking on the MEGA desktop icon, or by using the Windows start-menu to click on the MEGA icon located in the programs folder. Ex 1.0.2: Launch the Alignment Explorer by selecting the Alignment|Alignment Explorer/CLUSTAL menu command. In order to align sequences contained in a Sequence Data File, do the following: Ex 1.1.1: Add unaligned sequences from the hsp20.fas example file into the Alignment Explorer by clicking selecting the Data|Open|Retrieve Sequences from File menu command. Ex 1.1.2: Select the Edit|Select All menu command to select every site for all sequences in the alignment. Ex 1.1.3: Select the Alignment|Align by ClustalW menu command to align the selected sequences data using the ClustalW algorithm. 41
Ex 1.1.4: Save the current alignment session by selecting the Data|Save Session menu item. This will allow the current alignment session to be restored for future editing. Ex 1.1.5: Exit the Alignment Explorer by selecting the Data|Exit Alignment Explorer menu item. A message will appear asking if you would like to save the data to a MEGA file. Choose "YES," and then a "Save As" dialog box will appear. Enter hsp20_aligned.meg as the file name, and click the "Save" button. An input box will appear asking for a title for the data. Enter "HSP 20 Aligned by MEGA" as the title, and click the "OK" button. Another dialog box will appear asking you if the sequence data is protein coding. In this case, click "Yes." A final dialog box will appear asking you if you would like to open the data file in MEGA. Click "Yes." Now, we will examine how to send sequence data from the Internet (Web Explorer) to the Alignment Explorer. Ex 1.2.1: If the Alignment Explorer already contains sequence data, select the Data| Create new menu command to create a new alignment from Alignment Explorer window. Choose "YES" on the dialog box that appears to indicate that you are creating a DNA sequence. Ex 1.2.2: Activate the Web Explorer tab by selecting Web|Query Gene Banks from the menu. Ex 1.2.3: When the NCBI Entrez site is loaded, select either the nucleotide or protein database, enter a search term into the search box, and press the "GO" button. Ex 1.2.4: When the search results are displayed, select the specific search item and choose "Sequence" from the menu bar. Press the "Add to Alignment" button located to the left of the address box. This will display the Web Fetch dialog window. Ex 1.2.5: Click the box to the left of each accession number whose sequences information you would like to fetch from the web. When you are done, you can select accessions by pressing the "Fetch" button. Ex 1.2.6: When the status column indicates that all sequences are fetched, press the "Send to Alignment" button to send the fetched sequence data to the Alignment Explorer. Ex 1.2.7: Align the fetched data using the steps detailed in Ex 1.1.2 Ex 1.1.5. You may also open a trace file in the Trace Data Viewer/Editor and send it directly to the Alignment Explorer. You may also open a trace file in the Trace Data Viewer/Editor and send it directly to the Alignment Explorer. 4.5.3 Aligning coding sequences via protein sequences MEGA provides a convenient method for aligning coding sequences based on the alignment of protein sequences. In order to accomplish this you use the
42
Alignment Explorer to load a data file containing protein-coding sequences. If you click on the Translated Protein Sequences tab you will see that the proteincoding sequences are automatically translated into their respective protein sequence. With this tab active select the Alignment|Align by ClustalW menu item or click on the "W" tool bar icon to begin the alignment of the translated protein sequences. Once the alignment of the translated protein sequences completes, click on the DNA Sequences tab and youll find that Alignment Explorer automatically aligned the protein-coding sequences according to the aligned translated protein sequences. Any manual adjustments made to the translated protein sequence alignment will also be reflected in the protein-coding sequence tab. 4.5.4 CLUSTALW About CLUSTALW ClustalW is a widely used system for aligning any number of homologous nucleotide or protein sequences. For multi-sequence alignments, ClustalW uses progressive alignment methods. In these, the most similar sequences, that is, those with the best alignment score are aligned first. Then progressively more distant groups of sequences are aligned until a global alignment is obtained. This heuristic approach is necessary because finding the global optimal solution is prohibitive in both memory and time requirements. ClustalW performs very well in practice. The algorithm starts by computing a rough distance matrix between each pair of sequences based on pair-wise sequence alignment scores. These scores are computed using the pair-wise alignment parameters for DNA and protein sequences. Next, the algorithm uses the neighbor-joining method with midpoint rooting to create a guide tree, which is used to generate a global alignment. The guide tree serves as a rough template for clades that tend to share insertion and deletion features. This generally provides a close-to-optimal result, especially when the data set contains sequences with varied degrees of divergence, so the guide tree is less sensitive to noise. See: Higgins D., Thompson J., Gibson T. Thompson J. D., Higgins D. G., Gibson T. J. CLUSTAL W: improving the sensitivity of progressive multiple sequence alignment through sequence weighting, position-specific gap penalties and weight matrix choice. Nucleic Acids Res. 22:4673-4680. (1994) CLUSTALW Options (DNA) This dialog box displays a single tab containing a set of organized parameters that are used by ClustalW to align the DNA sequences. If you are aligning protein-coding sequences, please note that CLUSTALW will not respect the codon positions and may insert alignment gaps within codons. For aligning cDNA or sequence data containing codons, we recommend that you align the 43
translated protein sequences (see Aligning coding sequences via protein sequences). In this dialog box, you will see the following options: Parameters for Pair-wise Sequence Alignment Gap Opening Penalty: The penalty for opening a gap in the alignment. Increasing this value makes the gaps less frequent. Gap Extension Penalty: The penalty for extending a gap by one residue. Increasing this value will make the gaps shorter. Terminal gaps are not penalized. Parameters for Multiple Sequence Alignment Gap Opening Penalty: The penalty for opening a gap in the alignment. Increasing this value makes the gaps less frequent. Gap Extension Penalty: The penalty for extending a gap by one residue. Increasing this value will make the gaps shorter. Terminal gaps are not penalized. Common Parameters DNA Weight Matrix: The scores assigned to matches and mismatches (including IUB ambiguity codes). Transition Weight: Gives transitions a weight between 0 and 1. A weight of zero means that the transitions are scored as mismatches, while a weight of 1 gives the transitions the match score. For distantly-related DNA sequences, the weight should be near zero; for closely-related sequences, it can be useful to assign a higher score. Use Negative Matrix: Enabled negative weight matrix values will be used if they are found; otherwise the matrix will be automatically adjusted to all positive values. Delay Divergent Cutoff (%): Delays the alignment of the most distantly-related sequences until after the most closely-related sequences have been aligned. The setting shows the percent identity level required to delay the addition of a sequence. Sequences that is less identical than this level will be aligned later. Keep Predefined Gaps: When checked, alignment positions in which ANY of the sequences have a gap will be ignored. NOTE: All Definitions are derived from the CLUSTALW manual. CLUSTALW Options (Protein) This dialog box displays a single tab containing a set of organized parameters that are used by ClustalW to align DNA sequences. If you are aligning proteincoding sequences, please note that CLUSTALW will not respect the codon positions and may insert alignment gaps within codons. For aligning cDNA or sequence data containing codons, we recommend that you align the translated protein sequences (see Aligning coding sequences via protein sequences). In this dialog box, you will see the following options:
44
Parameters for Pair-wise Sequence Alignment Gap Opening Penalty: The penalty for opening a gap in the alignment. Increasing this value makes the gaps less frequent. Gap Extension Penalty: The penalty for extending a gap by one residue. Increasing this value will make the gaps shorter. Terminal gaps are not penalized. Parameters for Multiple Sequence Alignment Gap Opening Penalty: The penalty for opening a gap in the alignment. Increasing this value makes the gaps less frequent. Gap Extension Penalty: The penalty for extending a gap by one residue. Increasing this value will make the gaps shorter. Terminal gaps are not penalized. Common Parameters DNA Weight Matrix: The scores assigned to matches and mismatches (including IUB ambiguity codes). Residue-specific Penalties: Amino acid specific gap penalties that reduce or increase the gap opening penalties at each position or sequence in the alignment. For example, positions that are rich in glycine are more likely to have an adjacent gap than positions that are rich in valine. See the documentation for details. Hydrophilic Penalties: Used to increase the chances of a gap within a run (5 or more residues) of hydrophilic amino acids; these are likely to be loop or random coil regions in which gaps are more common. Gap Separation Distance: Tries to decrease the chances of gaps being too close to each other. Gaps that are less than this distance apart are penalized more than other gaps. This does not prevent close gaps; it makes them less frequent, promoting a block-like appearance of the alignment. Use Negative Matrix: When enabled negative weight matrix values will be used if they are found; otherwise the matrix will be automatically adjusted to all positive values. Delay Divergent Cutoff (%): Delays the alignment of the most distantly-related sequences until after the alignment of the most closely-related sequences. The setting shows the percent identity level required to delay the addition of a sequence; sequences that are less identical than this level will be aligned later. Keep Predefined Gaps: When checked, any alignment positions in which ANY of the sequences have a gap will be ignored. NOTE: All definitions are derived from CLUSTALW manual.
45
MEGA contains a fully functional Web Browser to assist users in sequence data retrieval and web exploration. The most important feature that differentiates this web browser from other browsers (e.g., Netscape or Internet Explorer) is the button. Pressing this button causes the MEGA web explorer to extract sequence data from the currently displayed web page and send it to the Alignment Explorer s alignment grid, where it will be inserted as new sequences. At present, the MEGA web browser can interpret data displayed in FASTA format or in the default format at the NCBI website. (You can ask the NCBI website to display the data in the FASTA format by using the Display option on the web page shown.) (We plan to enhance this functionality further in version 3.1.) Furthermore, the MEGA web browser provides a genomics database, exploration oriented interface for web searching. (In fact this is almost the same functionality as in the most recent versions of the Internet Explorer.) This causes the web browser window to navigate back to the web location found before the current site in the explorer location history. This causes the web browser window to navigate forward to the web location found after the current site in the explorer location history. This causes the web browser to terminate loading a web location. This causes the web browser to reload the current web location. This causes the web browser to extract sequence data from the current web page and send it to Alignment Builders alignment grid as new sequence rows. If the web explorer is unable to find properly formatted sequence data in the current web page a warning box will appear. Address The web location, or address field, is located in the second Field toolbar. This field contains the URL of the current web location as well as a pull down list of previously visited URLs. If a new URL is entered into the box and the Enter key is pressed, the web explorer will attempt to navigate to the entered URL. Links This toolbar provides shortcuts to a selection of websites. There are number of menus in the web browser, including Data, Edit, View, Links, Go, and Help. These menus provide access to routine functionalities, which are self-explanatory in use. Do BLAST Search
Alignment | Do BLAST Search Use this to launch the BLAST search in the MEGA Web Browser. The web-browser is displayed with the BLAST facility at the NCBI website.
46
Basic Functions This prepares Alignment Builder for a new alignment. Any sequence data currently loaded into Alignment Builder is discarded. This activates the Open File dialog window. It is used to send sequence data from a properly formatted file into Alignment Builder. This activates the Save Alignment Session dialog window. It may be used to save the current state of the Alignment Builder into a file so that it may be restored in the future. This causes nucleotide sequences currently loaded into Alignment Builder to be translated into their respective amino acid sequences. Web/Data Explorer Functions This displays the NCBI BLAST web site in the Web Explorer tab window. If a sequence in the sequence grid is selected prior to clicking this button, the Web Explorer will auto-fill the BLAST query window with the selected sequence data. This displays the default database (GenBank) in the Web Explorer tab window. This activates the Open Trace File dialog window, which may be used to open and view a sequencer file. The sequence data from the sequencer file then can be sent into Alignment Explorer. Alignment Functions This displays the ClustalW parameters dialog window, which is used to configure ClustalW and initiate the alignment of the selected sequence data. If you do not select sequence data prior to clicking this button, a message box will appear asking if you would like to select all of the currently loaded sequences. This marks or unmarks the currently selected single site in the alignment grid. Each sequence in the alignment may have only one site marked at a time. Modifications can be made to the alignment by marking two or more sites and then aligning them using the Align Marked Sites function. This button aligns marked sites. Two or more sites must be marked in order for this function to have an effect. Search Functions
47
This activates the Find Motif search box. When this box appears, it asks you to enter a motif sequence (a small subsequence of a larger sequence) as the search term. After the search term is entered, the Alignment Builder finds each occurrence of the search term and indicates it with yellow highlighting. For example, if you were to enter the motif "AGA" as the search term, then each occurrence of "AGA" across all sequences in the sequence grid would be highlighted in yellow. This searches towards the beginning of the current sequence for the first occurrence of the motif search term. If no motif search has been performed prior to clicking this button, the Find Motif search box will appear. This searches towards the end of the current sequence for the first occurrence of the motif search term. If no motif search has been performed prior to clicking this button, the Find Motif search box will appear. This locates the marked site in the current sequence. If no site has been marked, a warning box will appear. Editing Functions This undoes the last Alignment Builder action. This copies the current selection to the clipboard. It may be used to copy a single base, a block of bases, or entire sequences to the clipboard. This removes the current selection from the Alignment Builder and sends it to the clipboard. This function can affect a single base, a block of bases, or entire sequences. This pastes the contents of the clipboard into the Alignment Builder. If the clipboard contains a block of bases, it will be pasted into the builder starting at the point of the current selection. If the clipboard contains complete sequences they will be added to the current alignment. For example, if the contents of a FASTA file were copied to the clipboard from a web browser, it would be pasted into Alignment Builder as a new sequence in the alignment. This deletes a block of selected bases from the alignment grid. This deletes gap-only sites (sites containing a gap across all sequences in the alignment grid) from a selected block of bases. Sequence Data Insertion Functions This creates a new, empty sequence row in the alignment grid. A label and sequence data must be provided for this new row. This activates an Open File dialog box that allows for the selection of a sequence data file. Once a suitable sequence data file is selected, its contents will be imported into Alignment Builder as new sequence rows in the alignment grid.
48
Site Number display on the status bar Site # The Site # field indicates the site represented by the current selection. If the w/o Gaps radio button is selected, then the Alignment Builder will disregard the shifting affect of gaps when determining gap sites. If a block of sites are selected, then this field will contain the site # for the first site in the block. If an entire sequence is selected this field will contain the site # for the last site in the sequence.
Alignment Menu (in Alignment Explorer) This menu provides access to commands for editing the sequence data in the alignment grid. The commands are: Align by ClustalW: This option is used to align the DNA or protein sequence included in the current selection on the alignment grid. You will be prompted for the alignment parameters (DNA or Protein) to be used in ClustalW; to accept the parameters, press "OK". This initiates the ClustalW alignment system. Alignment Builder then aligns the current selection in the alignment grid using the accepted parameters. Mark/Unmark Site: This marks or unmarks a single site in the alignment grid. Each sequence in the alignment may only have one site marked at a time. Modifications can be made to the alignment by marking two or more sites and then aligning them using the Align Marked Sites function. Align Marked Sites: This aligns marked sites. Two or more sites in the alignment must be marked for this function to have an effect. Unmark All Sites: This item unmark all currently marked sites across all sequences in the alignment grid. Delete Gap-Only Sites: This item deletes gap-only sites (site columns containing gaps across all sequences) from the alignment grid. Auto-Fill Gaps: If this item is checked, then the Alignment Builder will ensure that all sequences in the alignment grid are the same length by padding shorter sequences with gaps at the end. Display Menu (in Alignment Explorer) This menu provides access to commands that control the display of toolbars in the alignment grid. The commands in this menu are: Toolbars: This contains a submenu of the toolbars found in Alignment Explorer. If an item is checked, then its toolbar will be visible within the Alignment Explorer window. Use Colors: If checked, Alignment Explorer displays each unique base using a unique color indicating the base type.
49
Background Color: If checked, then Alignment Explorer colors the background of each base with a unique color that represents the base type. Font: The Font dialog window can be used to select the font used by Alignment Explorer for displaying the sequence data in the alignment grid.
Edit Menu (in Alignment Explorer) This menu provides access to commands for editing the sequence data in the alignment grid. The commands in this menu are: Undo: This undoes the last Alignment Explorer action. Copy: This copies the current selection to the clipboard. It may be used to copy a single base, a block of bases, or entire sequences. Cut: This removes the current selection from the Alignment Explorer and sends it to the clipboard. This function can affect a single base, a block of bases, or entire sequences. Paste: This pastes the contents of the clipboard into the Alignment Explorer. If the clipboard contains a block of bases, they will be pasted into the builder, starting at the point of the current selection. If the clipboard contains complete sequences, they will be added to the current alignment. For example, if the contents of a FASTA file are copied from a web browser to the clipboard, they will be pasted into the Alignment Explorer as a new sequence in the alignment. Delete: This deletes a block of selected bases from the alignment grid. Delete Gaps: This deletes gaps from a selected block of bases. Insert Blank Sequence: This creates a new, empty sequence row in the alignment grid. A label and sequence data must be provided for this new row. Insert Sequence From File: This activates an Open File dialog box that allows for the selection of a sequence data file. Once a suitable sequence data file is selected, its contents will be imported into Alignment Explorer as new sequence rows in the alignment grid. Select Site(s): This selects the entire site column for each site within the current selection in the alignment grid. Select Sequences: This selects the entire sequence for each site within the current selection in the alignment grid. Select all: This selects all of the sites in the alignment grid. Allow Base Editing: If this item is checked, it changes the base values for all cells in the alignment grid. If it is not checked, then all bases in the alignment grid are treated as read-only.
Basic Functions This prepares Alignment Builder for a new alignment. Any
50
sequence data currently loaded into Alignment Builder is discarded. This activates the Open File dialog window. It is used to send sequence data from a properly formatted file into Alignment Builder. This activates the Save Alignment Session dialog window. It may be used to save the current state of the Alignment Builder into a file so that it may be restored in the future. This causes nucleotide sequences currently loaded into Alignment Builder to be translated into their respective amino acid sequences. Web/Data Explorer Functions This displays the NCBI BLAST web site in the Web Explorer tab window. If a sequence in the sequence grid is selected prior to clicking this button, the Web Explorer will auto-fill the BLAST query window with the selected sequence data. This displays the default database (GenBank) in the Web Explorer tab window. This activates the Open Trace File dialog window, which may be used to open and view a sequencer file. The sequence data from the sequencer file then can be sent into Alignment Explorer. Alignment Functions This displays the ClustalW parameters dialog window, which is used to configure ClustalW and initiate the alignment of the selected sequence data. If you do not select sequence data prior to clicking this button, a message box will appear asking if you would like to select all of the currently loaded sequences. This marks or unmarks the currently selected single site in the alignment grid. Each sequence in the alignment may have only one site marked at a time. Modifications can be made to the alignment by marking two or more sites and then aligning them using the Align Marked Sites function. This button aligns marked sites. Two or more sites must be marked in order for this function to have an effect. Search Functions This activates the Find Motif search box. When this box appears, it asks you to enter a motif sequence (a small subsequence of a larger sequence) as the search term. After the search term is entered, the Alignment Builder finds each occurrence of the search term and indicates it with yellow highlighting. For example, if you were to enter the motif "AGA" as the search term, then each occurrence of "AGA" across all sequences in the sequence grid would be highlighted in yellow. This searches towards the beginning of the current sequence for
51
the first occurrence of the motif search term. If no motif search has been performed prior to clicking this button, the Find Motif search box will appear. This searches towards the end of the current sequence for the first occurrence of the motif search term. If no motif search has been performed prior to clicking this button, the Find Motif search box will appear. This locates the marked site in the current sequence. If no site has been marked, a warning box will appear. Editing Functions This undoes the last Alignment Builder action. This copies the current selection to the clipboard. It may be used to copy a single base, a block of bases, or entire sequences to the clipboard. This removes the current selection from the Alignment Builder and sends it to the clipboard. This function can affect a single base, a block of bases, or entire sequences. This pastes the contents of the clipboard into the Alignment Builder. If the clipboard contains a block of bases, it will be pasted into the builder starting at the point of the current selection. If the clipboard contains complete sequences they will be added to the current alignment. For example, if the contents of a FASTA file were copied to the clipboard from a web browser, it would be pasted into Alignment Builder as a new sequence in the alignment. This deletes a block of selected bases from the alignment grid. This deletes gap-only sites (sites containing a gap across all sequences in the alignment grid) from a selected block of bases. Sequence Data Insertion Functions This creates a new, empty sequence row in the alignment grid. A label and sequence data must be provided for this new row. This activates an Open File dialog box that allows for the selection of a sequence data file. Once a suitable sequence data file is selected, its contents will be imported into Alignment Builder as new sequence rows in the alignment grid. Site Number display on the status bar Site # The Site # field indicates the site represented by the current selection. If the w/o Gaps radio button is selected, then the Alignment Builder will disregard the shifting affect of gaps when determining gap sites. If a block of sites are selected, then this field will contain the site # for the first site in the block. If an entire sequence is selected this field will contain the site # for the last site in the sequence.
52
Search Menu (in Alignment Explorer) This menu allows searching for sequence motifs and marked sites. The commands in this menu are: Find Motif: This activates the Find Motif search box. When this box appears, it asks you to enter a motif sequence (a small subsequence of a larger sequence) as the search term. After you enter the search term, the Alignment Explorer finds each occurrence of it and indicates it with yellow highlighting. For example, if you enter the motif "AGA" as the search term, then each occurrence of "AGA" across all sequences in the sequence grid would be highlighted in yellow. Find Next: This searches for the first occurrence of the motif search term towards the end of the current sequence. If no motif search has been performed prior to clicking this button, the Find Motif search box will appear. Find Previous: this search towards the beginning of the current sequence for the first occurrence of the motif search term. If no motif search has been performed prior to clicking this button, the Find Motif search box will appear. Find Marked Site: This locates the marked site in the current sequence. If no site has been marked for this sequence, a warning box will appear. Highlight Motif: If this item is checked, then all occurrences of the text search term (motif) are highlighted in the alignment grid.
Sequencer Menu (in Alignment Explorer) Edit Sequencer File: This item displays the Open File dialog box used to open a sequencer data file. Once opened, the sequencer data file is displayed in the Trace Data File Viewer/Editor. This editor allows you to view and edit trace data produced by the automated DNA sequencer. It reads and edits data in ABI and Staden file formats and the sequences displayed can be added directly into the Alignment Explorer or send to the Web Browser for conducting BLAST searches. Web Menu (in Alignment Explorer) This menu provides access to commands for querying GenBank and doing a BLAST search, as well as access to the MEGA web Browser. The commands in this menu are: Query Gene Banks: This item starts the Web Browser and accesses the NCBI home page (http://www.ncbi.nlm.nih.gov). Do BLAST Search: This item starts the Web Browser and accesses the NCBI BLAST query page. If you select a sequence in the alignment grid prior to selecting this item, the web browser will automatically copy the selected sequence data into the search field. Show Browser: This item will show the Web Browser.
53
Writing Comments
Comments can be placed anywhere in the data file as long as they are contained within a pair of square brackets [like this]. Nested comments are allowed [[like] this].
Key Words
MEGA supports a number of keywords, in addition to MEGA and TITLE, for writing instructions in the format and command statements. These key words can be written in
55
any combination of lower- and upper-case letters. For writing instructions, follow the style given in the examples along with the keyword description for different types of data.
A title statement may not occupy more than one line of text. It must not contain a semicolon inside the statement, although it must contain one at the end of the statement. Rules for Description Statement
A Description statement is written after the Title statement. It always begins with !Description and ends with a semicolon. #mega !Title This is an example title; !Description This is detailed information the data file; A description statement may occupy multiple lines of text. It must not contain a semicolon inside the statement, although it must contain one at the end of the statement.
56
sequence data is contained in the file. Based on the DataType setting, different types of keywords are valid. Keywords for Sequence Data Keywords for Distance Data Keywords for Tree Data
Symbols DNA/RNA A G C T U R Y M K S W H B V D N
Name Adenine Guanine Cytosine Thymine Uracil Purine Pyrimindine Strong Weak Not G Not A Not U/T Not C Ambiguous
57
Protein A C D E F G H I K L M N P Q R S T V W Y *
Alanine Cysteine Aspartic Acid Glutamic Acid Phenylalanine Glycine Histidine Isoleucine Lysine Leucine Methionine Asparagine Proline Glutamine Arginine Serine Threonine Valine Tryptophan Tyrosine Termination
Ala Cys Asp Glu Phe Gly His Ile Lys Leu Met Asn Pro Gln Arg Ser Thr Val Trp Tyr *
58
Property
Specifies whether a domain is protein coding. Exon and Coding are synonymous, as are Intron and Noncoding. End specifies that the domain with the given name ends at this point. Use dash (-) to identify insertion/deletions in sequence alignments Use period (.) to show identify with the first sequence. Synonymous with the identical keyword. Use a question mark (?) to indicate missing data. This instruction gives the name of the code table for the protein coding domains of the data
Property=cyt_b
Indel
single character
Indel = -
Identical
Identical = .
MatchChar
MatchChar = .
Missing
Missing = ?
CodeTable
CodeTable = Standard
Defining Genes and Domains Writing Command Statements for Defining Genes and Domains
The MEGA format easily can designate genes and domains within the molecular sequence data. In this format, attributes of different sites (and groups of sites, termed domains) are specified within the data "on the spot" rather than in an attributes block before or after the actual data, as is the case in some other data formats. An example of a three-sequence dataset written in MEGA format is shown below. The sequences consist of three genes named FirstGene, SecondGene, and ThirdGene for two groups of organisms Setup/Select Genes/Domain (Mammals and Birds). (Note that the genes and domains can also be defined interactively through a dialog box.)
59
!Gene=SecondGene Domain=Intron Property=Noncoding; #Human ATTCCCAGGGAATTCCCGGGGGGTTTAAGGCCCCTTTAAAGAAAGAT #Mouse GTAGCGCGCGTCGTCAGAGCTCCCAAGGGTAGCAGTCACAGAAAGAT #Chicken GTAAAAAAAAAAGTCAGAGCTCCCCCCAATATATATCACAGAAAGAT !Gene=ThirdGene Domain=Exon2 Property=Coding; #Human ATCTGCTCTCGAGTACTGATACAAATGACTTCTGCGTACAACTGA #Mouse ATCTGATCTCGTGTGCTGGTACGAATGATTTCTGCGTTCAACTGA #Chicken ATCTGCTCTCGAGTACTGCTACCAATGACTTCTGCGTACAACTGA
Gene Property
CodonStart
A number
CodonStar t=2
Defining Groups
60
!Gene=SecondGene Domain=Intron Property=Noncoding; #Human ATTCCCAGGGAATTCCCGGGGGGTTTAAGGCCCCTTTAAAGAAAGAT #Mouse GTAGCGCGCGTCGTCAGAGCTCCCAAGGGTAGCAGTCACAGAAAGAT #Chicken GTAAAAAAAAAAGTCAGAGCTCCCCCCAATATATATCACAGAAAGAT !Gene=ThirdGene Domain=Exon2 Property=Coding; #Human ATCTGCTCTCGAGTACTGATACAAATGACTTCTGCGTACAACTGA #Mouse ATCTGATCTCGTGTGCTGGTACGAATGATTTCTGCGTTCAACTGA #Chicken ATCTGCTCTCGAGTACTGCTACCAATGACTTCTGCGTACAACTGA
Labelling Individual Sites Site Label The individual sites in nucleotide or amino acid data can be labeled to construct non-contiguous sets of sites. The Setup Genes and Domains dialog can be used to assign or edit site labels, in addition to specifying them in the input data files. This is shown in the following example of three-sequences in which the sites in the Third Gene are labeled with a + mark. An underscore marks an absence of any labels.
!Gene=FirstGene Domain=Exon1 Property=Coding; #Human_{Mammal} ATGGTTTCTAGTCAGGTCACCATGATAGGTCTCAAT #Mouse_{Mammal} ATGGTTTCTAGTCAGGTCACCATGATAGGTCCCAAT #Chicken_{Aves} ATGGTTTCTAGTCAGCTCACCATGATAGGTCTCAAT
61
!Gene=SecondGene Domain=AnIntron Property=Noncoding; #Human ATTCCCAGGGAATTCCCGGGGGGTTTAAGGCCCCTTTAAAGAAAGAT #Mouse GTAGCGCGCGTCGTCAGAGCTCCCAAGGGTAGCAGTCACAGAAAGAT #Chicken GTAAAAAAAAAAGTCAGAGCTCCCCCCAATATATATCACAGAAAGAT !Gene=ThirdGene Domain=Exon2 Property=Coding; #Human ATCTGCTCTCGAGTACTGATACAAATGACTTCTGCGTACAACTGA #Mouse ATCTGATCTCGTGTGCTGGTACGAATGATTTCTGCGTTCAACTGA #Chicken ATCTGCTCTCGAGTACTGCTACCAATGACTTCTGCGTACAACTGA !Label +++__-+++-a-+++-L-+++-k-+++123+++-_-+++---+++;
Each site can be associated with only one label. A label can be a letter or a number. For analyses that require codons, MEGA includes only those codons in which all three positions are given the same label. This site labeling system facilitates the analysis of specific sites, as often is required for comparing sequences of regulatory elements, intron-splice sites, and antigen recognition sites in the genes of applications such as the Major Histocompatibility Complex. Labeled Sites Sites in a sequence alignment can be categorized and labeled with user-defined symbols. Each category is represented by a letter or a number. Each site can be assigned to only one category, although any combination of categories can be selected for analysis. Labeled sites work independently of and in addition to genes and domains, thus allowing complex subsets of sites to be defined easily. 5.1.4 Distance Input Data General Considerations (Distance Data Formats)
For a set of m sequences (or taxa), there are m(m-1)/2 pair-wise distances. These distances can be arranged either in the lower-left or in the upper-right triangular matrix. After writing the #mega,!Title,!Description, and !Format commands (some of which are optional), you then need to write all the taxa names (see below). Taxa names are followed by the distance matrix. An example of a matrix is: #one #two #three #four #five 1.0 2.0 3.0 3.0 2.5 1.3 4.0 4.6 3.6 4.2
62
In the above example, pair-wise distances are written in the upper triangular matrix (upper-right format). Two alternate distance matrix formats are: Lower-left matrix d12 d13 d23 d14 d24 d34 d15 d25 d35 Upper-right matrix d12 d13 d14 d23 d24 d34 d45
Property
Property=cyt_b
Indel
single character
Indel = -
Identical
single character
Identical = .
63
MatchChar
Synonymous with the identical keyword. Use a question mark (?) to indicate missing data. This instruction gives the name of the code table for the protein coding domains of the data
MatchChar = .
Missing
Missing = ?
CodeTable
CodeTable = Standard
!Gene=SecondGene Domain=Intron Property=Noncoding; #Human ATTCCCAGGGAATTCCCGGGGGGTTTAAGGCCCCTTTAAAGAAAGAT #Mouse GTAGCGCGCGTCGTCAGAGCTCCCAAGGGTAGCAGTCACAGAAAGAT #Chicken GTAAAAAAAAAAGTCAGAGCTCCCCCCAATATATATCACAGAAAGAT !Gene=ThirdGene Domain=Exon2 Property=Coding; #Human ATCTGCTCTCGAGTACTGATACAAATGACTTCTGCGTACAACTGA #Mouse ATCTGATCTCGTGTGCTGGTACGAATGATTTCTGCGTTCAACTGA #Chicken ATCTGCTCTCGAGTACTGCTACCAATGACTTCTGCGTACAACTGA
Setup/Select Taxa & Groups Data | Setup/Select Taxa & Groups This invokes the Setup/Select Taxa & Groups dialog box for including or excluding taxa, defining groups of taxa, and editing names of taxa and groups.
64
The following sections briefly describe each of these formats and how MEGA handles their conversion. COMMON FILE CONVERSION ATTRIBUTES The default input formats are determined by a files extension (e.g., a file with the extension of ".ig" is initially assumed to be in "IG" input format). However, you have the option to specify any format for any file; the file extension is simply used as an initial guide. Note that the specification of an incorrect file format most often results in an erroneous conversion or other unexpected error. Input file types can include any of the following characters in their sequence data: The letters: a-z,A-Z for DNA and protein sequences Peroid (.)
65
Depending on their context, all other characters encountered in input files are either ignored or are interpreted as specific non-sequence data, such as comments, headers, etc. The first line of all converted files is always: #Mega The second line of all converted file is always: !Title: <filename> where <filename> is the name of the input file. The third line of all converted files is blank. Many formats can specify the length of the sequences contained within them. The MEGA conversion utility ignores these data and does not check to see if the sequences are as long as they are purported to be.
66
Q9Y2J0_Has GQPDRQRKQEELTDEEKEIINRVIARAEKMEEMEQER-IGRLVDRLENM Q06846_RP3A_BOVIN GQPDRQRKQEELTDEEKEIINRVIARAEKMEEMEQER-IGRLVDRLENM JX0338_rabphilin-3A-mouse AQTDRQRKQEELTDEEKEIINRVIARAEKMEAMEQER-IGRLVDRLETM The CLUSTAL file above would be converted by MEGA into the following format: #mega Title: Bigrab2.aln #Q9Y2J0_Hsa ------------MTDTVFSNSSNRWMYPSDRPLQSNDKEQLQAGWSVHPG GQPDRQRKQEELTDEEKEIINRVIARAEKMEEMEQER--IGRLVDRLENM RKNVAGDGVNRCILCGEQLGMLGSACVVCEDCKKNVCTKCGVET-NNRLH #Q06846_RP3A_BOVIN ------------MTDTVFSSSSSRWMCPSDRPLQSNDKEQLQTGWSVHPS GQPDRQRKQEELTDEEKEIINRVIARAEKMEEMEQER--IGRLVDRLENM RKNVAGDGVNRCILCGEQLGMLGSACVVCEDCKKNVCTKCGVETSNNRPH #JX0338_rabphilin-3A-mouse ------------MTDTVVN----RWMYPGDGPLQSNDKEQLQAGWSVHPG AQTDRQRKQEELTDEEKEIINRVIARAEKMEAMEQER--IGRLVDRLETM RKNVAGDGVNRCILCGEQLGMLGSACVVCEDCKKNVCTKCGVETSNNRPH
67
The MEGA file converter looks for a line that begin with a greater-than sign (>), replaces it with a pound sign (#), takes the word following the pound sign as the sequence name, deletes the rest of the line, and takes the following lines (up to the next line beginning with a >) as the sequence data. The MEGA file above would convert as follows: #mega Title: infile.fasta #G019uabh ATACATCATAACACTACTTCCTACCCATAAGCTCCTTTTAACTTGTTAAAGTCTTGCTTG AATTAAAGACTTGTTTAAACACAAAAATTTAGAGTTTTACTCAACAAAAGTGATTGATTG ATTGATTGATTGATTGATGGTTTACAGTAGGACTTCATTCTAGTCATTATAGCTGCTGGC AGTATAACTGGCCAGCCTTTAATACATTGCTGCTTAGAGTCAAAGCATGTACTTAGAGTT GGTATGATTTATCTTTTTGGTCTTCTATAGCCTCCTTCCCCATCCCCATCAGTCTTAATC AGTCTTGTTACGTTATGACTAATCTTTGGGGATTGTGCAGAATGTTATTTTAGATAAGCA AAACGAGCAAAATGGGGAGTTACTTATATTTCTTTAAAGC #G028uaah CATAAGCTCCTTTTAACTTGTTAAAGTCTTGCTTGAATTAAAGACTTGTTTAAACACAAA ATTTAGACTTTTACTCAACAAAAGTGATTGATTGATTGATTGATTGATTGATGGTTTACA GTAGGACTTCATTCTAGTCATTATAGCTGCTGGCAGTATAACTGGCCAGCCTTTAATACA TTGCTGCTTAGAGTCAAAGCATGTACTTAGAGTTGGTATGATTTATCTTTTTGGTCTTCT ATAGCCTCCTTCCCCATCCCATCAGTCT
Length: 428 TDDVSKNGHT GHRGTAKSTA GKTKKPAVIN RANRGFLYID GSGNPEEGDL VEKWAKETQK LTLARA.ATA ...DAVRIER ..........
Mon Sep 25 17:34:20 MDT 2000 PPTNASTPPY VRALAAMLPP IPVPVVDLPL EVNLLEDHLV RPQLLDRFGL LQRKIKQAQR LAALEGRNEV AVEEVLVP.. ........ PFVAIVGQAE IKAVAGCPYS GATEDRVCGT DVLLDVAASG HARITTITDV RLPEVILPDP TVQDVRRIAV .......... LKLALLLCVV CAPDRTAGLC LDIERALTQG VNVVEREGVS SERVEIVKRR VLYKIAELCV LALRHRLRKD ..........
Check:
The "Check" tag near the end of a line signifies the first line in a new sequence expression. The name of the sequence is obtained from the preceding line; the following lines, up to the next blank line, are accepted as the sequence. For each line in the sequence, the leading digits are stripped off, and the rest of the line is used. The following shows a conversion of the above sequence.
68
#mega Title: infile.gcg #Chloroflex MSKEHVQTIA TDDVSKNGHT NPTIGGVMVM GHRGTAKSTA DQCRALEQQS GKTKKPAVIN VQAFAPGLLA RANRGFLYID VRHPARFVLV GSGNPEEGDL REYDADPFAF VEKWAKETQK KLEVDGHRGE LTLARA.ATA PLETQD.... ...DAVRIER .......... ..........
69
Name: G019uabh Len: 400 Check: 0 Weight: 1.00 Name: G028uaah Len: 268 Check: 1.00 Name: G022uabh Len: 257 Check: 1.00 Name: G023uabh Len: 347 Check: 1.00 Name: G006uaah Len: 240 Check: 1.00 // G019uabh ACTTGTTAAA G028uaah AAGACTTGTT G022uabh ATCAATCCTG G023uabh CATAAAATAA G006uaah ATATGCTTTG G019uabh AGAGTTTTAC G028uaah ATTGATTGAT G022uabh TTCACTATCC G023uabh CTTATGTTTA G006uaah TCAGCTTAAT G019uabh TTTACAGTAG G028uaah TTATAGCTGC G022uabh CTACCCATAA G023uabh AATCCTCTAC G006uaah GTAGAAAATG G019uabh GCCAGCCTTT G028uaah GAGTCAAAGC G022uabh TTGTTTAAAC G023uabh GAAATAAAAT G006uaah
0 0 0 0
ATACATCATA ACACTACTTC CTACCCATAA GCTCCTTTTA CATAAGCTCC TTTTAACTTG TTAAAGTCTT GCTTGAATTA TATTTTAGAG ACCCAAGTTT TTGACCTTTT CCATGTTTAC AATAAATACC AAAAAAATAG TATATCTACA TAGAATTTCA ACATAAAATA AACTGTTTTC TATGTGAAAA TTAACCTANN GTCTTGCTTG AATTAAAGAC TTGTTTAAAC ACAAAAATTT TAAACACAAA ATTTAGACTT TTACTCAACA AAAGTGATTG TAGGTGATTG GGCAGCCATT TAAGTATTAT TATAGACATT ACTGTTTTCT ATGTGAAAAT TAACCTAAAA ATATGCTTTG CTTATGTTTA AGATGTCATG CTTTTTATCA GTTGAGGAGT TCAACAAAAG TGATTGATTG ATTGATTGAT TGATTGATGG TGATTGATTG ATGGTTTACA GTAGGACTTC ATTCTAGTCA CATTAAAACC CTTTATGCCC ATACATCATA ACACTACTTC AGATGTCATG CTTTTTATCA GTTGAGGAGT TCAGCTTAAT AATCCTCTAA GATCTTAAAC AAATAGGAAA AAAACTAAAA GACTTCATTC TAGTCATTAT AGCTGCTGGC AGTATAACTG TGGCAGTATA ACTGGCCAGC CTTTAATACA TTGCTGCTTA GCTCCTTTTA ACTTGTTAAA GTCTTGCTTG AATTAAAGAC GATCTTAAAC AAATAGGAAA AAAACTAAAA GTAGAAAATG GAAATAAAAT GTCAAAGCAT TTCTACCACT CAGAATTGAT
70
CTTATAACAT G019uabh GGTATGATTT G028uaah ATAGCCTCCT G022uabh TTGATTGATT G023uabh GAAATGCTTT G006uaah G019uabh AGTCTTAATC G028uaah G022uabh G023uabh GTTTTTGCTT G019uabh AATGTTATTT G023uabh ACGTTAC G019uabh TCTTTAAAGC
AATACATTGC TGCTTAGAGT CAAAGCATGT ACTTAGAGTT ATGTACTTAG AGTTGGTATG ATTTATCTTT TTGGTCTTCT ACAAAATTTA GACTTTTACT CAACAAAAGT GATTGATTGA GTCAAAGCAT TTCTACCACT CAGAATTGAT CTTATAACAT GAAATGCTTT TTAAAAGAAA ATATTAAAGT TAAACTCCCC ATCTTTTTGG TCTTCTATAG CCTCCTTCCC CATCCCCATC TCCCCATCCC ATCAGTCT GATTGAT TTAAAAGAAA ATATTAAAGT TAAACTCCCC TATTTTGCTC AGTCTTGTTA CGTTATGACT AATCTTTGGG GATTGTGCAG ATCTAAAATA CATTCTGCAC AATCCCCAAA GATTGATCAT TAGATAAGCA AAACGAGCAA AATGGGGAGT TACTTATATT
The MEGA format converter "unravels" the interleaved data by extracting each line beginning with the first name, then those beginning with the second name, and so on, ultimately producing a corresponding file that looks like this: #mega Title: thisfile.msf #G019uabh ATACATCATA GTCTTGCTTG TCAACAAAAG GACTTCATTC AATACATTGC ATCTTTTTGG AGTCTTGTTA TAGATAAGCA #G028uaah CATAAGCTCC TAAACACAAA TGATTGATTG TGGCAGTATA ATGTACTTAG TCCCCATCCC
#G022uabh TATTTTAGAG ACCCAAGTTT TTGACCTTTT CCATGTTTAC ATCAATCCTG TAGGTGATTG GGCAGCCATT TAAGTATTAT TATAGACATT TTCACTATCC
71
CATTAAAACC CTTTATGCCC ATACATCATA ACACTACTTC CTACCCATAA GCTCCTTTTA ACTTGTTAAA GTCTTGCTTG AATTAAAGAC TTGTTTAAAC ACAAAATTTA GACTTTTACT CAACAAAAGT GATTGATTGA TTGATTGATT GATTGAT #G023uabh AATAAATACC ACTGTTTTCT AGATGTCATG GATCTTAAAC GTCAAAGCAT TTAAAAGAAA ATCTAAAATA #G006uaah ACATAAAATA CTTATGTTTA AATCCTCTAA GAAATAAAAT GAAATGCTTT
Each group begins with a line starting with a greater-than symbol (>). This line is ignored. The first word in the following line (e.g., Chloroflex above) is treated as the name of the sequence; the rest of that line is ignored Subsequent lines are taken as the sequence. This example would be converted to the MEGA file format as follows: #mega !Title: filename #Chloroflex MSKEHVQTIA TDDVSKNGHT PPTNASTPPY PFVAIVGQAE LKLALLLCVV NPTIGGVMVM GHRGTAKSTA VRALAAMLPP IKAVAGCPYS CAPDRTAGLC
72
73
continuation of the identified sequence and begins in the same position as in the first group. The following might be observed at the beginning of a PHYLIP data file: 2 2000 I G019uabh ACTTGTTAAA G028uaah AAGACTTGTT
GTCTTGCTTG AATTAAAGAC TTGTTTAAAC ACAAAAATTT AGAGTTTTAC TAAACACAAA ATTTAGACTT TTACTCAACA AAAGTGATTG ATTGATTGAT TCAACAAAAG TGATTGATTG ATTGATTGAT TGATTGATGG TTTACAGTAG TGATTGATTG ATGGTTTACA GTAGGACTTC ATTCTAGTCA TTATAGCTGC MEGA would convert this data as follows: #mega Title: cap-data.phylip #G019uabh ATACATCATA GTCTTGCTTG TCAACAAAAG #G028uaah CATAAGCTCC TAAACACAAA TGATTGATTG
ACACTACTTC CTACCCATAA GCTCCTTTTA ACTTGTTAAA AATTAAAGAC TTGTTTAAAC ACAAAAATTT AGAGTTTTAC TGATTGATTG ATTGATTGAT TGATTGATGG TTTACAGTAG TTTTAACTTG TTAAAGTCTT GCTTGAATTA AAGACTTGTT ATTTAGACTT TTACTCAACA AAAGTGATTG ATTGATTGAT ATGGTTTACA GTAGGACTTC ATTCTAGTCA TTATAGCTGC
74
CATAAGCTCC TTTTAACTTG TTAAAGTCTT GCTTGAATTA TAAACACAAA ATTTAGACTT TTACTCAACA AAAGTGATTG TGATTGATTG ATGGTTTACA GTAGGACTTC ATTCTAGTCA
TTATAGCTGC TGGCAGTATA ACTGGCCAGC CTTTAATACA TTGCTGCTTA GAGTCAAAGC ATGTACTTAG AGTTGGTATG ATTTATCTTT TTGGTCTTCT This file would be converted to MEGA format as follows: #mega Title: infile.phylip2 #G019uabh ATACATCATA GTCTTGCTTG TCAACAAAAG GACTTCATTC AATACATTGC #G028uaah CATAAGCTCC TAAACACAAA TGATTGATTG TGGCAGTATA ATGTACTTAG
75
181 C A G A A T T G A T C T T A T A A C A T G A A A T G C T T T 211 T T A A A A G A A A A T A T T A A A G T T A A A C T C C C C The MEGA format converter looks for the "ENTRY" tag and treats the following string as the sequence name, e.g., G006uaah above. The remaining lines have their digits and spaces removed; any non-sequence characters also are deleted. MEGA would convert the above sequence as follows: #mega Title: filename.pir #G006uaah ACATAAAATAAACTGTTTTCTATGTGAAAA TTAACCTANNATATGCTTTGCTTATGTTTA AGATGTCATGCTTTTTATCAGTTGAGGAGT TCAGCTTAATAATCCTCTAAGATCTTAAAC AAATAGGAAAAAAACTAAAAGTAGAAAATG GAAATAAAATGTCAAAGCATTTCTACCACT CAGAATTGATCTTATAACATGAAATGCTTT TTAAAAGAAAATATTAAAGTTAAACTCCCC
76
<name>G019uabh</name> <seq-data>ATACATCATAACACTAC. . .</seq-data> If it finds these tags, it uses the text between the <name>. . .</name> tags as the sequence name, and the text between the <seq-data>. . .</seq-data> tags as the sequence data corresponding to that name. The conversion of the above XML block into MEGA format would look like this: #Mega Title: filename.xml #G019uabh ATACATCATAACACTACTTCCTACCCATAAGCTCCTTTTAACTTGTTAAAGTCTTGCTTGAATT AAAGACTTGTTTAAACACAAAAATTTAGAGTTTTACTCAACAAAAGTGATTGATTGATTGATTGA TTGATTGATGGTT TACAGTAGGACTTCATTCTAGTCATTATAGCTGCTGGCAGTATAACTGGCCAGCCTTTAATACAT TGCTGCTTAGAGT
77
CUA CUG CCU CCC CCA CCG CAU CAC CAA CAG CGU CGC CGA CGG
L L P P P P H H Q Q R R R R
L L P P P P H H Q Q R R R R
L L P P P P H H Q Q R R R R
T T P P P P H H Q Q R R R R
GUA GUG GCU GCC GCA GCG GAU GAC GAA GAG GGU GGC GGA GGG
V V A A A A D D E E G G G G
V V A A A A D D E E G G G G
V V A A A A D D E E G G G G
V V A A A A D D E E G G G G
78
UCA (S) 1 2 UCG (S) 1 2 UAU (Y) 1 2 UAC (Y) 1 2 UAA (*) 0 3 UAG (*) 0 3 UGU (C) 0.5 2.5 UGC (C) 0.5 2.5 UGA (*) 0 3 UGG 0 3 (W) CUU (L) 1 2 CUC (L) 1 2 CUA (L) 1.333 1.667
0 0 0 0 0 0 0 0 0 0 0 0 2
0 0 0 0 0 0 0 0 0 0 0 0 0
4 4 2 2 0 0 2 2 0 0 4 4 4
79
present on the middle command panel. Buttons Add Delete Ungroup Close Help Description Creates a new group. Deletes the currently selected group. Any taxa that were assigned to the group will become freestanding. Makes all the taxa in the selected group freestanding, but does not remove the group from the list. Closes the dialog box. Brings up help regarding the dialog box.
How to perform functions: Function Creating a new group Deleting a group Adding taxa to a group Removing a taxon from a group Include/Exclude taxa or groups Description Click on the Add button. Click on the highlighted name of the group and type in a new name. Select the group and click the Delete button. Any taxa that were assigned to this group will become freestanding. Drag-and-drop the taxon on the desired group or select one or more taxa in the Ungrouped Taxa window and click on the left arrow button on the middle command panel. Click on the taxon and drag-and-drop it into a group (or outside all groups). Or, select the taxon and click on the right arrow button on the middle command panel. Click the checkbox next to the group or taxa name.
80
View Statistics
Displays the highlighted genetic code in a printable format. Displays the number of synonymous and non-synonymous sites for the codons of the highlighted genetic code following the Nei-Gojobori (1986) method. The degeneracy values for the first, second, and third codon positions are displayed following Li et al. (1985).
General Utilities : This brings up the Exporting Sequence Data dialog box, which contains options to control how MEGA writes the output data. Color: This brings up a color palette selection box with which you can choose the color to be displayed in the highlighted sites. : This brings up the dialog box for setting up and selecting domains and genes. : This brings up the dialog box for setting up, editing, and selecting taxa and groups of taxa. : This toggle replaces the nucleotide (amino acid) at a site with the identical symbol (e.g. a dot) if the site contains the same nucleotide (amino acid). Highlighting Sites
C: If this button is pressed, then all constant sites will be highlighted. A count of the highlighted sites will be displayed on the status bar. V: If this button is pressed, then all variable sites will be highlighted. 81
Pi: If this button is pressed, then all parsimony-informative sites will be highlighted. A count of the highlighted sites will be displayed on the status bar. S: If this button is pressed, then all singleton sites will be highlighted. A count of the highlighted sites will be displayed on the status bar. 0: If this button is pressed, then sites will be highlighted only if they are zero-fold degenerate sites in all sequences displayed. A count of highlighted sites will be displayed on the status bar. (This button is available only if the dataset contains protein coding DNA sequences). 2: If this button is pressed, then sites will be highlighted only if they are two-fold degenerate sites in all sequences displayed. A count of highlighted sites will be displayed on the status bar. (This button is available only if the dataset contains protein coding DNA sequences). 4: If this button is pressed, then sites will be highlighted only if they are four-fold degenerate sites in all sequences displayed. A count of highlighted sites will be displayed on the status bar. (This button is available only if the dataset contains protein coding DNA sequences).
: This button provides the facility to translate codons in the sequence data into amino acid sequences and back. All protein-coding regions will be automatically identified and translated for display. When the translated sequence is already displayed, then issuing this command displays the original nucleotide sequences (including all coding and non-coding regions). Depending on the data displayed (translated or nucleotide), relevant menu options in the Sequence Data Explorer become enabled. Note that the translated/untranslated status in this data explorer does not have any impact on the options for analysis available in MEGA (e.g., Distances or Phylogeny menus), as MEGA provides all possible options for your dataset at all times. The 2-Dimensional Data Grid Fixed Row: This is the first row in the data grid. It is used to display the nucleotides (or amino acids) in the first sequence when you have chosen to show their identity using a special character. For protein coding regions, it also clearly marks the first, second, and the third codon positions. Fixed Column: This is the first and the leftmost column in the data grid. It is always visible, even when you are scrolling through sites. The column contains the sequence names and an associated check box. You can check or uncheck this box to include or exclude a sequence from analysis. Also in this column, you can drag-and-drop sequences to sort them. Rest of the Grid: Cells to the right of and below the first row contain the nucleotides or amino acids of the input data. Note that all cells are drawn
82
in light color if they contain data corresponding to unselected sequences or genes or domains. Status Bar This section displays the location of the focused site and the total sequence length. It also shows the site label, if any, and a count of the highlighted sites. Data Menu
This allows you to explore the active data set, and establish various data attributes, and data subset options.
Data Menu (in Sequence Data Explorer) This menu provides commands for working with selected data in the Sequence Data Explorer The commands in this menu are: Write Data to File Brings up the Exporting Sequence Data dialog box. Translate/Untranslate Translates protein-coding nucleotide sequences into protein sequences, and back to nucleotide sequences. Brings up the Select Genetic Code dialog box, in which you can select, edit or add a genetic code table.
Setup/Select Genes and Brings up the Sequence Data Organizer, in which Domains you can define and edit genes and domains. Setup/Select Taxa and Brings up the Select/Edit Taxa and Groups Groups dialog, in which you can edit taxa and define groups of taxa. Quit Data Viewer Takes the user back to the main interface.
Translate/Un-translate (in Sequence Data Explorer) Data | Translate/Un-translate This command is available only if the data contain protein-coding nucleotide sequences. It automatically extracts all protein-coding domains for translation and displays the corresponding protein sequence. If the translated sequence is already displayed, then issuing this command displays the original nucleotide sequences, including all coding and non-coding regions. Depending on the data displayed (translated or nucleotide), relevant menu options in the Sequence Data Explorer are enabled. However, translated and un-translated status does not have any impact on the analytical options available in MEGA (e.g., Distances or 83
Phylogeny menus), as MEGA provides all possible options for your dataset at all times. Select Genetic Code Table (in Sequence Data Explorer) Data | Select Genetic Code Table Select Genetic Code Table, can be invoked from within the Data menu in Sequence Data Explorer, and is also available in the main interface directly in the Data Menu. Setup/Select Taxa & Groups (in Sequence Data Explorer) Data | Setup/Select Taxa & Groups Setup/Select Taxa & Groups, can be invoked from within the Data menu in Sequence Data Explorer, and is also available in the main interface directly in the Data Menu. Setup/Select Genes & Domains (in Sequence Data Explorer) Data | Setup/Select Genes & Domains Setup/Select Genes & Domains, can be invoked from within the Data menu in Sequence Data Explorer, and is also available in the main interface directly in the Data Menu. Export Data (in Sequence Data Explorer) Data | Export Data The Exporting Sequence Data dialog box first displays an edit box for entering a title for the sequence data being exported. The default name is the original name of the data set, if there was one. Below the title is a space for entering a brief description of the data set being exported. Next is the option for determining the format of the data set being exported; MEGA currently allows the user to export the data in MEGA, PAUP 3.0 and PAUP 4.0 (Nexus, Interleaved in both cases), and PHYLIP 3.0 (Interleaved). tA the end of each line, is "Writing site numbers." The three options available are to not write any number, to write one for each site, or to write the site number of the last site. Other options in this dialog box include the number of sites per line, which codon position(s) is to be used and whether non-coding regions should be included, and whether the output is to be interleaved. For missing or ambiguous data and alignment gaps, there are four options: include all such data, exclude all such data, exclude or include sites with missing or ambiguous data only, and exclude sites with alignment gaps only. Quit Data Viewer Data | Quit Data Viewer 84
This command closes the Sequence Data Explorer, and takes the user back to main interface. Display Menu Data Menu (in Sequence Data Explorer) This menu provides commands for working with selected data in the Sequence Data Explorer The commands in this menu are: Write Data to File Brings up the Exporting Sequence Data dialog box. Translate/Untranslate Translates protein-coding nucleotide sequences into protein sequences, and back to nucleotide sequences. Brings up the Select Genetic Code dialog box, in which you can select, edit or add a genetic code table.
Setup/Select Genes and Brings up the Sequence Data Organizer, in Domains which you can define and edit genes and domains. Setup/Select Taxa and Brings up the Select/Edit Taxa and Groups Groups dialog, in which you can edit taxa and define groups of taxa. Quit Data Viewer Restore Input Order Display | Restore Input Order Choosing this restores the order in Sequence Data Explorer to that in the input text file. Show Only Selected Sequences Display | Show only Selected Sequences The check boxes in the left column of the display grid can be used to select or deselect sequences for analysis. Subsequent use of the "Show Only Selected Sequences" option in the Display menu of Sequence Data Explorer hides all the deselected sequences and displays only the selected ones. Color Cells Display | Color cells This command colors individual cells in the two-dimensional display grid 85 Takes the user back to the main interface.
according to the nucleotide or amino acid it contains. A list of default colors, based on the biochemical properties of the residues, is given below. In a future version, these colors will be customizable by the user. For DNA sequences: Symbo l Color A Yellow G Fuchsia C Olive T Green U Green For amino acid sequences: Symbo Symbo l Color l A Yellow M C Olive N D Aqua P E Aqua Q F Yellow R G Fuchsi S a H Teal T I Yellow V K Red W L Yellow Y
Color Yellow Green Blue Green Red Green Green Yellow Green Lime
Use Identical Symbol Display | Use Identical Symbol Data that contain multiple aligned sequences may be easier to view if, when the nucleotide (amino acid) is the same as that in the corresponding site in the first sequence, the nucleotide (amino acid) is replaced by a dot. Choosing this option again brings back the nucleotide (amino acid) single-letter codes. Show Sequence Names Display | Show Sequence Names This option displays the full sequence names in Sequence Data Explorer Show Group Names Display | Show Group Names This option displays the full group names in Sequence Data Explorer if the
86
sequences have been grouped in Select/Edit Taxa Groups Change Font... Display | Change Font This command brings up the Change Font dialog box, which allows you to change the display font, including font type, style and size. Options to strikeout or underline selected parts of the sequences are also available. There is also an option for using different scripts, although the only option currently available is "Western". Finally the "Sample" window displays the effects of your choices Sort Sequences Display | Sort Sequences The sequences in the data set can be sorted based on several options: sequence name, group name, group and sequence names, or as per the order in the Select/Edit Taxa Groups dialog box. Sort Sequences by Group Name Display | Sort Sequences | By Group Name Sequences that have been grouped in Select/Edit Taxa Groups can be sorted by the alphabetical order of group names or numerical order of group ID numbers. If the group names contain both a name and a number, the numerical order will be nested within the alphabetical order. Sort Sequences by Group and Sequence Names Display | Sort Sequences | By Group and Sequence Names Sequences that have been grouped in Select/Edit Taxa Groups can be sorted by the alphabetical order of group names or the numerical order of group ID numbers. If the group names contain both a name and a number, the numerical order is nested within the alphabetical order. The sequences can be further arranged by sorting the sequence names within the group names. Sort Sequences As per Taxa/Group Organizer Display | Sort Sequences | As per Taxa/Group Organizer The sequence/group order seen in Select/Edit Taxa Groups is initially the same as the order in the input text file. However, this order can be changed by dragging-and-dropping. Choose this option if you wish to see the data in the same order in the Sequence Data Explorer as in Select/Edit Taxa Groups. Sort Sequences By Sequence Name Display | Sort Sequences | By Sequence Name 87
The sequences are sorted by the alphabetical order of sequence names or the numerical order of sequence ID numbers. If the sequence names contain both a name and a number, then the sorting is done with the numerical order nested within the alphabetical order. Highlight Menu Highlight Menu (in Sequence Data Explorer) This menu can be used to highlight certain types of sites. The options are constant sites, variable sites, parsimony-informative sites, singleton sites, 0-fold, 2-fold and 4-fold degenerate sites. Highlight Conserved Sites Highlight | Conserved Sites Use this command to highlight constant sites Highlight Variable Sites Highlight | Variable Sites Use this command to highlight variable sites sites. Highlight Singleton Sites Highlight | Singleton Sites Use this command to highlight singleton sites. Highlight Parsimony Informative Sites Highlight | Parsim-Info Sites Use this command to highlight parsimony-informative sites. Highlight 0-fold Degenerate Sites Highlight | 0-fold Degenerate Sites Use this command to highlight 0-fold degenerate sites. Highlight 2-fold Degenerate Sites Highlight | 2-fold Degenerate Sites Use this command to highlight 2-fold degenerate sites. The command is visible only if the data consists of nucleotide sequences. Highlight 4-fold Degenerate Sites Highlight | 4-fold Degenerate Sites
88
Use this command to highlight 4-fold degenerate sites. The command is visible only if the data consists of nucleotide sequences. Statistics Menu Statistics Menu (in Sequence Data Explorer) Various summary statistics of the sequences can be computed and displayed using this menu. The commands are: Nucleotide Composition. Nucleotide Pair Frequencies. Codon Usage. Amino Acid Composition. Use All Selected Sites. Use only Highlighted Sites. Sites can be selected according to various criteria (see Highlight Sites), and analysis can be performed only on the chosen subset of sites. Nucleotide Composition Statistics | Nucleotide Composition This command is visible only if the data consist of nucleotide sequences. MEGA computes the base frequencies for each sequence as well as an overall average. These will be displayed by domain in a Text Editor domain (if the domains have been defined in Setup/Select Genes & Domains). Nucleotide Pair Frequencies Statistics | Nucleotide Pair Frequencies This command is visible only if the data consists of nucleotide sequences. There are two options available: one in which the nucleotide acid pairs are counted bidirectionally site-by-site for the two sequences (giving rise to 16 different nucleotide pairs), the other, in which the pairs are counted unidirectionally (10 nucleotide pairs). MEGA will compute the frequencies of these quantities for each sequence as well as an overall average. They will be displayed in a Text Editor domain by domain (if domains have been defined in Setup/Select Genes & Domains). Codon Usage Statistics | Codon Usage This command is visible only if the data contains protein-coding nucleotide sequences. MEGA 4 computes the percent codon usage and the RCSU values for each codon for all sequences included in the dataset. Results will be displayed in a Text Editor domain (if domains have been defined in Setup/Select Genes & Domains).
89
Amino Acid Composition Statistics | Amino acid Composition This command is visible only if the data consists of amino acid sequences or if the translated protein coding nucleotide sequences are displayed. MEGA will compute the amino acid frequencies for each sequence as well as an overall average, which will be displayed in a Text Editor domain (if domains have been defined in Setup/Select Genes & Domains). Use All Selected Sites Statistics | Use All Selected Sites Analysis is conducted on all sites in the sequences, irrespective of whether any sites have been labeled or highlighted. Use only Highlighted Sites Statistics | Use only Highlighted Sites Sites can be selected according to various criteria (see Highlight Sites), and analyses will be performed only on the chosen subset of sites. All statistical attributes will be based on these sites. 5.4.2 Distance Data Explorer Distance Data Explorer The Distance Data Explorer shows the pair-wise distance data. This explorer is flexible and it provides useful functionalities for computing within group, among group, and overall averages, as well as facilities for selecting data subsets. This explorer consists of a number of regions as follows: Menu Bar File menu Display menu Average menu. Help: This item brings up the help file. Tool Bar The tool bar provides quick access to a number of menu items.
General Utilities : This icon brings up the Options dialog box to export the distance matrix as a text file with options to control how MEGA writes the output data. : This button brings up the dialog box for setting up, editing, and selecting taxa and groups of taxa. Distance Display Precision
90
: With each click of this button, the precision of the distance display is decreased by one decimal place. : With each click of this button, the precision of the distance display is decreased by one decimal place.
Column Sizer: This is a slider that can be used to increase or decrease the width of the columns that show the pair-wise distances. The 2-Dimensional Data Grid This grid displays the pair-wise distances between all the sequences in the data in the form of a lower or upper triangular matrix. The names of the sequences and groups are the row-headers; the column headers are numbered from 1 to m, m being the number of sequences. There is a column sizer button for the rowheaders, so you can increase or decrease the column size to accommodate the full name of the sequences and groups.
Fixed Row: This is the first row in the data grid that displays the column number. Fixed Column: This is the first and the leftmost column in the data grid and contains taxa names. Even if you scroll past the initial screen this column will always be visible. To include a taxon in the data set for analysis, check the associated box. In this column, you also can drag-and-drop taxa names to sort them in the desired manner.
Rest of the Grid: The cells to the right of the first column and below the first row contain the nucleotides or amino acids of the input data. Note that all cells containing data corresponding to unselected sequences or genes/domains are drawn in a light color. Status bar The status bar shows the sequence pair corresponding to the position of the cursor when the cursor is on any distance value in the display.
File Menu (in Distance Data Explorer) The File menu consists of three commands:
Select & Edit Taxa/Groups: This brings up a dialog box to categorize the taxa into groups. Export/Print Distances: This brings up a dialog box for writing pair-wise distances as a text file, with a choice of several formats. Quit Viewer: This closes the Distance Data Explorer.
Display Menu (in Distance Data Explorer) The Display menu consists of four main commands:
Show Only Selected Taxa: This is a toggle, showing a matrix of all or only
91
selected taxa.
Sort Taxa: This provides a submenu for sorting the order of taxa in one of three ways: by input order, by taxon name or by group name. Show Group Names: This is a toggle for displaying or hiding the group name next to the name of each taxon, when available. Change Font: This brings up the dialog box, which allows you to choose the type and size of the font used to display the distance values.
Average Menu (in Distance Data Explorer) This menu is used for the computation of average values using the selected taxa. The following averaging options are available: Overall: This computes and displays the overall average. Within groups: This is enabled only if at least one group is defined. For each group, an arithmetic average is computed for all valid pair-wise comparisons and results are displayed in the Distance Matrix Explorer. All incalculable withingroup averages are shown with a red "n/c". Between groups: This is enabled only if at least two groups of taxa are defined. For each between group averages, an arithmetic average is computed for all valid inter-group pair-wise comparisons and results are displayed in the Distance Matrix Explorer. All incalculable within group averages are shown with a red "n/c". Net Between Groups: This computes net average distances between groups of taxa and is enabled only if at least two groups of taxa with at least two taxa each are defined. The net average distance between two groups is given by dA = dXY (dX - dY)/2 where, dXY is the average distance between groups X and Y, and dX and dY are the mean within-group distances. All incalculable within group averages are shown with a red "n/c". Options dialog box At the top of the options dialog box is an option for the output format (Publication and MEGA) with the type of information that is output (distances) mentioned beneath. Below this is the option for outputting the distance data as a lower left triangular matrix or an upper right triangular matrix. On the right are options for specifying the number of decimal places for the pair-wise distances in the output, and the maximum number of distances per line in the matrix. In addition there are three buttons, one to print or save the output, one to quit the Options dialog box without exporting the data (Cancel), and the third to bring up the help file (this file). The Print/Save button brings up the Distances Display Box, where the distances are displayed as specified, with various options to edit, print and save the output.
92
The Text Editor contains a menu bar, a toolbar, and a status bar. The Menu bar Description Menu File menu The File Menu contains the functions that are most commonly used to open, save, rename, print, and close files. (Although there is no separate "rename" function available, you can rename a file by choosing the Save As menu item and giving the file a different name before you save it.)
93
Edit menu
The Edit Menu contains functions that are commonly used to manipulate blocks of text. Many of the edit menu items interact with the Windows Clipboard, which is a hidden window that allows various selections to be copied and pasted across documents and applications. The Search Menu has several functions that allow you to perform searches and replacements of text strings. You can also jump directly to a specific line number in the file. The Display Menu contains functions that affect the visual display of files in the edit windows. The Utilities Menu contains several functions that make this editor especially useful for working with files containing molecular sequence data (note that the MEGA editor does not try to understand the contained data, it simply operates on the text, assuming that the user knows what (s)he is doing.
Search menu
Toolbar The Toolbar contains shortcuts to some frequently used menu commands. Status Bar The Status bar is positioned at the bottom of the editor window. It shows the position of the cursor (line number and position in the line), whether the file has been edited, and the status of some keyboard keys (CAPS, NUM, and SCROLL lock). Hotkeys and Shortcut keys Many menu items have a hotkey and/or a shortcut key. These are special key combinations that are helpful for people who are more comfortable using a keyboard than the mouse. Hotkeys are identified by an underscore character in the name of the menu item, e.g., "File", "New". These allow you to hold down the Alt-key, which is usually found next to the space bar on the keyboard, then hit the underlined letter to produce the same action as if you clicked that name with the mouse. We show this using the notation <Alt>+key e.g., the hotkey for the file menu item is shown as <Alt>+F. Be sure that you depress both keys together, holding the <Alt> key down a little bit longer than the letter key. (Some people try hitting both keys simultaneously, as if theyre hitting two keys on a piano keyboard. Quite often, this approach does not produce the desired results.) For instance, you could create a new file by clicking the mouse on the "File" menu item, then clicking on the "New" item beneath it. Using hotkeys, you could type <Alt>+F followed by <Alt>+N. Or, more simply, while youre holding down the <Alt> key, hit the F key followed by the N key, then release the <Alt> key. You might notice that several menu items, e.g., the New Item on the File menu, show something to the right that looks like Ctrl+N. This is called a Shortcut key sequence. Whereas executing a command with hotkeys often requires several keystrokes, shortcut keys can do the same thing with just one
94
keystroke. Shortcut keys work the same as hotkeys, using the <Ctrl> key instead of the <Alt> key. To create a new file, for example, you can hold down the <Ctrl> key and hit the N key, which is shown as <Ctrl>+N here. (In the menus, this appears simply as Ctrl+N.) Not all menu items have associated shortcut keys because there are only 26 shortcut keys, one for each letter of the alphabet. Hotkeys, in contrast, are localized to each menu and submenu. For hotkeys to work, the menu item must be visible whereas shortcut keys work at any time. For instance, if you are typing data into a text file and want to create a note in a new window, you may simply hit the shortcut key sequence, <Ctrl>+N to generate a new window. After you type the note, you can hit <Ctrl>+S to save it, give it a file name, hit the enter key [this part doesnt make sense]; then you can hit the <Alt>+F+C hotkey sequence to close the file (there is no shortcut key for closing a file).
Using Text Editor File Menu New (in Text Editor) File | New Use this command to create a new file in the Text Editor. Open (in Text Editor) File | Open Use this command to open an existing file in the Text Editor. Reopen (in Text Editor) File | Reopen Choose this command to reopen a recently closed text file from the mostrecently-used-files list. When you close a text file in the Text Editor, it is added to the Reopen list. Select All (in Text Editor) Edit | Select All This is used to select (highlight) everything in the displayed file. Go to Line (in Text Editor) Edit | Go to Line # This opens a small dialog box that allows you to enter a number indicating the line to which you want to move.
95
Show Line Numbers (in Text Editor) Display | Show Line Numbers This item can be checked (on) or un-checked (off) to show whether line numbers are displayed next to the lines. Word Wrap (in Text Editor) Display | Word Wrap This item can be checked (on) or un-checked (off) to show whether lines in the edit window are automatically wrapped around based on the current windows width. Save (in Text Editor) File | Save This allows you to save the file currently being edited. Save As (in Text Editor) File | Save As This command brings up the Save As dialog box, which allows you to choose the directory, the filename and extension, and the type of file you wish to save. To make a file suitable for loading as data in MEGA, you should save the file in MEGA format (it is a plain ASCII text file). If there is already another file with the same name, it will be overwritten Print (in Text Editor) File | Print This command will print the currently displayed file to the selected printer. Close File (in Text Editor) File | Close File This closes the current file. Exit Editor (in Text Editor) File | Exit Editor This closes the currently open file. If the file was modified, but the modifications have not been saved, MEGA will ask whether to discard the changes. Note that this command exits the Text Editor only, not MEGA. Delete (in Text Editor)
96
Edit | Delete This deletes the selected (highlighted) text. It is NOT copied to the clipboard. Edit Menu Cut (in Text Editor) Edit | Cut This command places a copy of the selected text on the Windows clipboard, removing the original string. To paste the contents on the clipboard, use the Paste command. Copy (in Text Editor) Edit | Copy This places a copy of the selected text on the Windows clipboard, leaving the original string untouched. To paste the contents on the clipboard, use the Paste command. Paste (in Text Editor) Edit | Paste This inserts the most recently copied text present on the Windows clipboard. Undo (in Text Editor) Edit | Undo Choose this command to undo your most recent action. Repeated use of this command will undo each action, starting with the most recent and going to the oldest. It has unlimited depth. Font (in Text Editor) Display | Set Font Choose this command to activate a dialog box with which you can change the display font used by the Text Editor. Since an ASCII text file does not have a font attribute, it simply contains the text in the file. Therefore the change in the font only affects the display. The new font is remembered by MEGA as your preferred display font for the Text Editor. Search Menu Find (in Text Editor) Search | Find Choose this command to display the Find Text dialog box.
97
Find Again (in Text Editor) Search | Find Again Choose this to repeat the last Find command. Replace (in Text Editor) Search | Replace This brings up a Search and Replace dialog box, which allows you to replace a text string in the file currently being edited.
98
present on the middle command panel. Buttons Add Delete Ungroup Close Help Description Creates a new group. Deletes the currently selected group. Any taxa that were assigned to the group will become freestanding. Makes all the taxa in the selected group freestanding, but does not remove the group from the list. Closes the dialog box. Brings up help regarding the dialog box.
How to perform functions: Function Creating a new group Deleting a group Adding taxa to a group Removing a taxon from a group Include/Exclude taxa or groups Description Click on the Add button. Click on the highlighted name of the group and type in a new name. Select the group and click the Delete button. Any taxa that were assigned to this group will become freestanding. Drag-and-drop the taxon on the desired group or select one or more taxa in the Ungrouped Taxa window and click on the left arrow button on the middle command panel. Click on the taxon and drag-and-drop it into a group (or outside all groups). Or, select the taxon and click on the right arrow button on the middle command panel. Click the checkbox next to the group or taxa name.
5.6.2 Groups of taxa A group of taxa is a set of one or more taxa. Members of a group can be specified in the input data file, and created and edited in the Setup Taxa and Groups dialog. Groups of taxa often are constructed based on their evolutionary relatedness. For example, sequences may be grouped based on the geographic origin of the source individual, or sequences from a multi-gene family may be arranged into groups consisting of orthologous sequences. 5.6.3 Data Subset Selection Sequence Data Subset Selection Any subset of sequence data can be selected for analysis using the options in the Data menu. You may: 99
1. Select Taxa (sequences) or Groups of taxa through the Setup/Select Taxa & Groups dialog box, 2. Choose Domains and Genes through the Setup/Select Genes & Domains dialog box, Items 1 and 2 lead to the construction of a primary data subset, which is maintained until it is modified in the two dialog boxes mentioned in the above items or in the Sequence Data Explorer. 3. Select any combination of Codon Positions to use through the Analysis Preferences/Options dialog box from the Data | Select Preferences menu item in the main interface. 4. Choose to include only the Labeled Sites through the Data | Select Preferences menu item. 5. Decide to enforce Complete-Deletion or Pair-wise-Deletion of the missing data and alignment gaps. Items 3, 4, and 5 provide the second level of data subset options. You are given relevant choices immediately prior to the start of the analysis. Therefore, these choices are secondary in nature and are specific to the currently requested analysis. The Analysis Preferences dialog box remembers them for your convenience and provides them as a default the next time you conduct an analysis that utilizes those options.
100
6 Part IV: Evolutionary Analysis 6.1 Computing Basic Statistical Quantities for Sequence Data
6.1.1 Basic Sequence Statistics
In the study of molecular evolution, it often is necessary to know some basic statistical quantities, such as nucleotide frequencies, codon frequencies, and transition/transversion ratios. The statistical quantities that can be computed by MEGA are discussed in this section.
Nucleotide Pair Frequencies Statistics | Nucleotide Pair Frequencies This command is visible only if the data consists of nucleotide sequences. There are two options available: one in which the nucleotide acid pairs are counted bidirectionally site-by-site for the two sequences (giving rise to 16 different nucleotide pairs), the other, in which the pairs are counted unidirectionally (10 nucleotide pairs). MEGA will compute the frequencies of these quantities for each sequence as well as an overall average. They will be displayed in a Text Editor domain by domain (if domains have been defined in Setup/Select Genes & Domains). Codon Usage Statistics | Codon Usage This command is visible only if the data contains protein-coding nucleotide sequences. MEGA 4 computes the percent codon usage and the RCSU values for each codon for all sequences included in the dataset. Results will be displayed in a Text Editor domain (if domains have been defined in Setup/Select Genes & Domains). 6.1.3 Pattern Menu
This menu provides access to the test for examining the substitution pattern homogeneity between sequences (Kumar and Gadagkar 2001) and computing the two
101
statistics related to this test (pair-wise sequence composition distance and the disparity index) (Kumar and Gadagkar 2001).
102
with Pattern Heterogeneity Between Lineages with Rate Variation and Pattern Heterogeneity Log-Det Method with Pattern Heterogeneity Between Lineages Maximum Composite Likelihood Model with Rate Uniformity and Pattern Homogeneity with Rate Variation Among Sites with Pattern Heterogeneity Between Lineages with Rate Variation and Pattern Heterogeneity
Syn-Non-synonymous
Sequences are compared codon-by-codon. These distances can only be computed for protein-coding sequences or domains. Nei-Gojobori Method Modified Nei-Gojobori Method Li-Wu-Luo Method Pamilo-Bianchi-Li Method Kumar Method
Amino Acid
Amino acid sequences are compared residue-by-residue. These distances can be computed for protein sequences and protein-coding nucleotide sequences. In the latter case, protein-coding nucleotide sequences are automatically translated using the selected genetic code table. No. of differences p-distance Poisson Model with Rate Uniformily Among Sites with Rate Variation Among Sites Equal Input Model with Rate Uniformity and Pattern Homogeneity with Rate Variation Among Sites with Pattern Heterogeneity Between Lineages with Rate Variation and Pattern Heterogeneity Dayhoff and JTT Models with Rate Uniformity Among Sites with Rate Variation Among Sites
103
are using the pair-wise deletion option for handling gaps and missing data, it is important to realize that this count does not normalize the number of differences based on the number of valid sites compared, if the sequences contain alignment gaps. Therefore, we recommend that if you use this distance you use the complete-deletion option. For this distance, MEGA provides facilities for computing the following quantities: d: Transitions + Transversions: Number of different nucleotide sites. s: Transitions only: Number of nucleotide sites with transitional differences. v: Transversions only: Number of nucleotide sites with transversional differences. R = s/v: Transition/transversions ratio. L: No of valid common sites: Number of compared sites. Formulas for computing these quantities and their variances are as follows. Var(d) = Var(s) = Var(v) = R= Var(R) = where and P and Q are the proportion of sites showing transitional and transversional differences, respectively. See also Nei and Kumar (2000), page 33.
p-distance (Nucleotide)
This distance is the proportion (p) of nucleotide sites at which two sequences being compared are different. It is obtained by dividing the number of nucleotide differences by the total number of nucleotides compared. It does not make any correction for multiple substitutions at the same site, substitution rate biases (for example, differences in the transitional and transversional rates), or differences in evolutionary rates among sites. MEGA provides facilities for computing following p-distances and related quantities: d: Transitions + Transversions : Proportion of nucleotide sites that are different. s: Transitions only : Proportion of nucleotide sites with transitional differences. v: Transversions only : Proportion of nucleotide sites with transversional differences. R = s/v : Transition/transversions ratio. L: No of valid common sites: Number of sites compared. Formulas for computing these quantities are as follows: Quantity Formula Variance , s, v, , , ,
104
R,
where and P and Q are the proportion of sites showing transitional and transversional differences, respectively. See also Nei and Kumar (2000), page 33.
Jukes-Cantor distance
In the Jukes and Cantor (1969) model, the rate of nucleotide substitution is the same for all pairs of the four nucleotides A, T, C, and G. As is shown below, the multiple hit correction equation for this model produces a maximum likelihood estimate of the number of nucleotide substitutions between two sequences. It assumes an equality of substitution rates among sites (see the related gamma distance), equal nucleotide frequencies, and it does not correct for higher rate of transitional substitutions as compared to transversional substitutions. The Jukes-Cantor model
MEGA provides facilities for computing the following quantities: d: Transitions + Transversions : Number of nucleotide substitutions per site. L: No of valid common sites: Number of sites compared. Formulas for computing these quantities are as follows: Distance where p is the proportion of sites with different nucleotides. Variance See also Nei and Kumar (2000), page 36.
Tajima-Nei distance
In real data, nucleotide frequencies often deviate substantially from 0.25. In this case the Tajima-Nei distance (Tajima and Nei 1984) gives a better estimate of the number of nucleotide substitutions than the Jukes-Cantor distance. Note that this assumes an equality of substitution rates among sites and between transitional and transversional
105
MEGA provides facilities for computing the following quantities for this method: d: Transitions + Transversions : Number of nucleotide substitutions per site. L: No of valid common sites: Number of sites compared. Formulas for computing these quantities are as follows: Distance where p is the proportion of sites with different nucleotides and
where xij is the relative frequency of the nucleotide pair i and j, gis are the nucleotide frequencies. Variance
106
Description Number of nucleotide substitutions per site. Number of transitional substitutions per site. Number of transversional substitutions per site. Transition/transversions ratio.
L: No of valid common Number of sites compared. sites Formulas for computing these quantities are as follows: Distances
where P and Q are the frequencies of sites with transitional and transversional differences respectively, and
Variances
where
107
MEGA 4 provides facilities for computing the following quantities: Description Quantity d: Transitions & Transversions s: Transitions only v: Transversions only R = s /v L: No of valid common sites Number of nucleotide substitutions per site. Number of transitional substitutions per site. Number of transversional substitutions per site. Transition/transversions ratio. Number of sites compared.
where P and Q are the proportion of sites with transitional and transversional differences respectively, and
Variances
108
where
Tamura-Nei distance
The Tamura-Nei model (1993) corrects for multiple hits, taking into account the differences in substitution rate between nucleotides and the inequality of nucleotide frequencies. It distinguishes between transitional substitution rates between purines and transversional substitution rates between pyrimidines. It also assumes equality of substitution rates among sites (see related gamma model). The Tamura-Nei model
MEGA 4 provides facilities for computing the following quantities for this method: Description Quantity d: Transitions & Transversions s: Transitions only v: Transversions only R = s /v L: No of valid common sites Number of nucleotide substitutions per site. Number of transitional substitutions per site. Number of transversional substitutions per site. Transition/transversions ratio. Number of sites compared.
109
where P1 and P2 are the proportions of transitional differences between nucleotides A and G, and between T and C, respectively, Q is the proportion of transversional differences, gA, gC, gG, gT, are the respective frequencies of A, C, G and T, gR = gA + gG, gY, = gT + gC, and
Variances
where
110
where p is the proportion of different amino acid sites, a is the gamma parameter, gi is the frequency of amino acid i, and
Variance
111
all pairs of the four nucleotides A, T, C, and G. The multiple hit correction equation for this model, which is given below, produces a maximum likelihood estimate of the number of nucleotide substitutions between two sequences, while relaxing the assumption that all sites are evolving at the same rate. However, it assumes equal nucleotide frequencies and does not correct for higher rate of transitional substitutions as compared to transversional substitutions. If the rate variation among sites is modeled using the Gamma distribution, you will need to provide a gamma parameter (a) for computing this distance. The Jukes-Cantor model
MEGA provides facilities for computing the following p-distances and related quantities: d: Transitions + Transversions : Number of nucleotide substitutions per site. L: No of valid common sites: Number of sites compared. The formulas for computing these quantities are as follows: Distance where p is the proportion of sites with different nucleotides and a is the gamma parameter. Variance See also Nei and Kumar (2000), page 36 and estimating gamma parameter.
112
Quantity d: Transitions + Transversions s: Transitions only v: Transversions only R = s /v L: No of valid common sites
Description Number of nucleotide substitutions per site. Number of transitional substitutions per site. Number of transversional substitutions per site. Transition/transversions ratio. Number of sites compared.
where P and Q are the respective total frequencies of transition type pairs and transversion type pairs, a is the gamma parameter, and
Variances
where
See also Nei and Kumar (2000), page 44 and estimating gamma parameter.
113
MEGA provides facilities for computing the following quantities for this method: d: Transitions + Transversions : Number of nucleotide substitutions per site. L: No of valid common sites: Number of sites compared. The formulas for computing these quantities are as follows: Distance where p is the proportion of sites with different nucleotides, a is the gamma parameter, and
where xij is the relative frequency of the nucleotide pair i and j, gis are the nucleotide frequencies. Variance
114
MEGA 4 provides facilities for computing the following quantities for this method: Description Quantity d: Transitions & Transversions s: Transitions only v: Transversions only R = s /v L: No of valid common sites Number of nucleotide substitutions per site. Number of transitional substitutions per site. Number of transversional substitutions per site. Transition/transversions ratio. Number of sites compared.
where P1 and P2 are the proportions of transitional differences between nucleotides A and G, and between T and C, respectively, Q is the proportion of transversional differences, gA, gC, gG, gT, are the respective frequencies of A, C, G and T, gR = gA + gG, gY, = gT + gC, a is the gamma parameter and
Variances
115
where
See also Nei and Kumar (2000), page 45 and estimating gamma parameter.
MEGA 4 provides facilities for computing the following quantities: Description Quantity d: Transitions & Transversions s: Transitions only v: Transversions only R = s /v Number of nucleotide substitutions per site. Number of transitional substitutions per site. Number of transversional substitutions per site. Transition/transversions ratio.
116
where P and Q are the proportion of sites with transitional and transversional differences, respectively, a is the gamma parameter, and
Variances
where
117
MEGA provides facilities for computing the following quantities for this method: d: Transitions + Transversions : Number of nucleotide substitutions per site. L: No of valid common sites: Number of sites compared. Formulas for computing these quantities are as follows: Distance where p is the proportion of sites with different nucleotides and
where xij is the relative frequency of the nucleotide pair i and j, gis are the nucleotide frequencies. Variance can be estimated by the bootstrap method.
118
MEGA 4 provides facilities for computing the following quantities: Description Quantity d: Transitions & Transversions s: Transitions only v: Transversions only R = s /v L: No of valid common sites Number of nucleotide substitutions per site. Number of transitional substitutions per site. Number of transversional substitutions per site. Transition/transversions ratio. Number of sites compared.
where P and Q are the proportion of sites with transitional and transversional differences, respectively, and
119
MEGA 4 provides facilities for computing the following quantities for this method: Description Quantity d: Transitions & Transversions s: Transitions only v: Transversions only R = s /v L: No of valid common sites Number of nucleotide substitutions per site. Number of transitional substitutions per site. Number of transversional substitutions per site. Transition/transversions ratio. Number of sites compared.
where P1 and P2 are the proportions of transitional differences between nucleotides A and G, and between T and C, respectively, Q is the proportion of transversional differences, gXA, gXC, gXG, gXT, are the respective frequencies of A, C, G and T of sequence X, gXR = gXA + gXG and gXY = gXT + gXC, gA, gC, gG, gT, gR, and gY are the average frequencies of the pair of sequences, and
120
Gamma Rates Equal Input Model (Gamma rates and Heterogeneous Patterns)
In real data, amino acid frequencies usually vary among different kind of amino acids. Therefore, the correction based on the equal input model gives a better estimate of the number of amino acid substitutions than the Poisson correction distance. If you are computing the rate variation among sites using the Gamma distribution, you will need to provide a gamma parameter (a). When the amino acid frequencies are different between the sequences, the modified formula (Tamura and Kumar 2002) relaxes the estimation bias. MEGA provides facilities for computing the following quantities: Quantity Description d: distance Number of amino acid substitutions per site. L: No of valid common Number of sites compared. sites Formulas used are: Distance
where p is the proportion of different amino acid sites, a is the gamma parameter, gXi is the frequency of amino acid i for sequence X, gi is the average frequency for the pair of the sequences, and
121
MEGA provides facilities for computing the following quantities for this method: d: Transitions + Transversions : Number of nucleotide substitutions per site. L: No of valid common sites: Number of sites compared. The formulas for computing these quantities are as follows: Distance where p is the proportion of sites with different nucleotides, a is the gamma parameter, and
where xij is the relative frequency of the nucleotide pair i and j, gis are the nucleotide frequencies. Variance can be estimated by the bootstrap method.
122
into account the rate substitution differences between nucleotides and the inequality of nucleotide frequencies. In this distance, evolutionary rates among sites are modeled using the gamma distribution. You will need to provide a gamma parameter for computing this distance. When the nucleotide frequencies between the sequences are different, the modified formula (Tamura and Kumar 2002) relaxes the assumption of the substitution pattern homogeneity. The Tamura-Nei model
MEGA 4 provides facilities for computing the following quantities for this method: Quantity d: Transitions & Transversions s: Transitions only v: Transversions only R = s /v L: No of valid common sites Description Number of nucleotide substitutions per site. Number of transitional substitutions per site. Number of transversional substitutions per site. Transition/transversions ratio. Number of sites compared.
where P1 and P2 are the proportions of transitional differences between nucleotides A and G, and between T and C, respectively, Q is the proportion of transversional differences, gXA, gXC, gXG, gXT, are the respective frequencies of A, C, G and T of sequence X, gXR = gXA + gXG and gXY = gXT + gXC, gA, gC, gG, gT, gR, and gY are the average frequencies of the pair of sequences, a is the gamma parameter and
123
MEGA 4 provides facilities for computing the following quantities: Description Quantity d: Transitions & Transversions s: Transitions only v: Transversions only R = s /v L: No of valid common sites Number of nucleotide substitutions per site. Number of transitional substitutions per site. Number of transversional substitutions per site. Transition/transversion ratio. Number of sites compared.
124
where P and Q are the proportion of sites with transitional and transversional differences, respectively, a is the gamma parameter, and
125
Variance
Variance
is the number of amino acids that are different between two aligned where sequences. See also Nei and Kumar (2000), page 18.
126
Variance
Variance
127
where A denotes the diagonal matrix of the equilibrium amino acid frequencies for Q. From this equation, the evolutionary distance d = 2tQ can be computed iteratively by a maximum-likelihood method. The eigen values for the PAM and JTT matrices required in this computation were obtained from the program source code of PHYLIP version 3.6 (Felsenstein et al. 1993-2001). MEGA provides facilities for computing the following quantities: Quantity Description d: distance Number of amino acid substitutions per site. L: No of valid common Number of sites compared. sites The variance of d can be estimated by the bootstrap method.
128
the inequality of the substitution rates among sites. For this purpose, you will need to provide the gamma shape parameter (a). For estimating the Dayhoff distance, use a = 2.25 (see Nei and Kumar [2000], page 21 for details). For computing Grishins distance, use a = 0.65. 23 (see Nei and Kumar [2000], page 23 for details) MEGA provides facilities to compute the following quantities: Quantity Description d: distance Number of amino acid substitutions per site. L: No of valid common Number of sites compared. sites Formulas used are: Quantity Formula
Variance
See also Nei and Kumar (2000), page 23 and estimating gamma parameter.
129
130
Nei-Gojobori Method
This method computes the numbers of synonymous and non-synonymous substitutions and the numbers of potentially synonymous and potentially non-synonymous sites (Nei and Gojobori 1986). Based on these estimates, MEGA can be asked to produce the following quantities: Number of differences (Sd or Nd) These are simple counts of the number of synonymous (Sd) and nonsynonymous (Nd) differences. To compare these two numbers, you must use the p-distance because the number of potential synonymous sites is much smaller than the number of non-synonymous sites. p-distance (pS or pN) The count of the number of synonymous differences (Sd) is normalized using the possible number of synonymous sites (S). A similar computation can be made for non-synonymous differences. Jukes-Cantor correction (dS or dN) The p-distances computed above can be corrected to account for multiple substitutions at the same site. Difference between synonymous and non-synonymous distances MEGA 4 can compute differences between the synonymous and nonsynonymous distances. These statistics are useful in conducting tests for selection. Number of Sites (S or N) The numbers of potential synonymous and non-synonymous sites can be computed using this option. For each pair of sequences, the average number of synonymous or non-synonymous sites is reported. The formulas for computing these quantities are: Quantity Formula Variance
131
one way: transitional and transversional substitutions are no longer assumed to occur with the same frequency. Thus the user is requested to provide the Transition/Transversion (R) ratio. When R = 0.5, this method becomes identical to the Nei-Gojobori method. When R > 0.5, the number of synonymous sites is less than estimated using Nei-Gojobori method and consequently, the number of non-synonymous sites will be larger than estimated with the original Nei-Gojobori (Nei and Gojobori 1986) approach. Number of differences (Sd or Nd) These are counts of the numbers of synonymous (Sd) and non-synonymous (Nd) differences. To compare these two numbers you must use the p-distance because the number of potential synonymous sites is much smaller than the number of non-synonymous sites. p-distance (pS or pN) The count of the number of synonymous differences (Sd) is normalized using the number of potential synonymous sites (S). A similar computation can be made for non-synonymous differences. Jukes-Cantor correction (dS or dN) The p-distances computed above can be corrected to account for multiple substitutions at the same site. Difference between synonymous and non-synonymous distances MEGA 4 can compute differences between synonymous and non-synonymous distances. These statistics are useful when conducting tests for selection. Number of Sites (S or N) Numbers of potentially synonymous and non-synonymous sites can be computed using this option. For each pair of sequences, the average number of synonymous or non-synonymous sites is reported. The formulas for computing these quantities are: Quantit y Formula Variance
132
Pamilo-Bianchi-Li Method
This method (Pamilo and Bianchi 1993; Li 1993) is a modification of Li, Wu and Luo's method. The only difference concerns the allocation of 2-fold sites to synonymous and non-synonymous categories. Rather than assuming an equal transition and transversion rate, the rate is inferred from the observed number of transitions and transversions at the 4-fold degenerate sites. Based on this information, the following quantities can be estimated: Synonymous distance This is the number of synonymous substitutions per synonymous site. Non-synonymous distance This is the number of non-synonymous substitutions per non-synonymous site. Substitutions at the 4-fold degenerate sites (d4) This is the number of substitutions per 4-fold degenerate site; it is useful for measuring the rate of neutral evolution. Substitutions at the 0-fold degenerate sites (d0) This is the number of substitutions per 0-fold degenerate site; it is useful for measuring the rate of amino acid sequence evolution. Number of 4-fold degenerate sites(L4) The estimate of the number of 4-fold degenerate sites, computed by averaging the number of 4-fold degenerate sites in the two sequences, compared. Number of 0-fold degenerate sites (L0) The estimate of the number of 0-fold degenerate sites, computed by averaging the number of 0-fold degenerate sites in the two sequences, compared. Difference between synonymous and non-synonymous distances (D) This computes the differences between the synonymous and non-synonymous distances. These statistics are useful for conducting tests of selection. The formulas for computing these quantities are: Quantity Formula Variance
d4
133
d0 D Ai Bi Here, are the number of 0-fold, 2-fold and 4-fold degenerate sites, respectively. , and , where , , ,
Pi and Qi are the proportions of i-fold degenerate sites that show transitional and transversional differences, respectively.
Kumar Method
This method is a modification of the Pamilo-Bianchi-Li and Comeron (1995) methods and is able to handle some problematic degeneracy class assignments (see a detailed description below). It computes the following quantities: Synonymous distance This is the number of synonymous substitutions per synonymous site. Non-synonymous distance This is the number of non-synonymous substitutions per non-synonymous site. Substitutions at the 4-fold degenerate sites This is the number of substitutions per 4-fold degenerate site. It is useful for measuring the rate of neutral evolution. Substitutions at the 0-fold degenerate sites This is the number of substitutions per 0-fold degenerate site. It is useful for measuring the rate of amino acid sequence evolution.
134
Number of 4-fold degenerate sites This is the estimate of the number of 4-fold degenerate sites, computed by averaging the number of 4-fold degenerate sites in the two sequences, compared. Number of 0-fold degenerate sites This is the estimate of the number of 0-fold degenerate sites, computed by averaging the number of 0-fold degenerate sites in the two sequences, compared. Difference between synonymous and non-synonymous distances This computes the differences between the synonymous and non-synonymous distances. These statistics are useful for conducting tests of selection. Kumars modification of the PBL method: The treatment of arginine and isoleucine codons in the Li-Wu-Luo and the PamiloBianchi-Li methods is arbitrary, which sometimes creates a problem because the arginine codons occur quite frequently. Comeron (1995) addressed this problem by dividing the 2-fold degenerate sites into two groups: 2S-fold and 2V-fold. The 2S-fold refers to sites in which the transitional change is synonymous and the two transversional changes are non-synonymous, whereas the 2V-fold represents sites in which the transitional change is non-synonymous and the transversional changes are synonymous. Although these definitions help in correcting some of the inaccurate classifications of synonymous and non-synonymous sites (e.g., methionine codons), they do not solve the problem completely. For example, consider mutations in the first nucleotide position of the arginine codon: CGG produces TGG (Trp), AGG (Arg), or GGG (Gly). The transitional change (C to T) results in a non-synonymous change. Of the two transversional substitutions, one (C to A) results in a synonymous change, while the other (C to G) results in a non-synonymous change. Therefore, this nucleotide site is neither a 2S-fold nor a 2V-fold site. Thus, the first position of three arginine codons (CGU, CGC, and CGA) and the third position of two isoleucine codons (ATT and ATC) cannot be assigned to any of the Comeron (1995) categories. For this reason, Comeron (personal communication) used a more complicated classification of codons when he wrote his computer program. For example, the first position of arginine codon CGG was assigned to a 2V-fold site with a probability of one-third and to a 0-fold site with a probability of two-thirds. Similar assignments are used by W.-H. Li (personal communication) in his computer program. Since the nucleotide site assignments discussed above are quite arbitrary and may not apply to all known genetic code tables, Kumar developed another method that uses the PBL method for any genetic code table. In this version, nucleotide sites are first classified into 0-fold, 2-fold, and 4-fold degenerate sites. The 2-fold degenerate sites are further subdivided into simple 2-fold and complex 2-fold degenerate sites. Simple 2-fold sites are those at which the transitional change results in a synonymous substitution and the two transversional changes result in non-synonymous substitutions. All other 2-fold sites, including those for the three isoleucine codons, belong to the complex 2-fold site category. If we use this definition, all nucleotide sites can be classified into the five groups shown in the following table.
135
0-fold L0
4-fold L4
s0 v0
s2 V2
s2S v2S
s4 v4
Here, L0, L2S, L2C, and L4 are the numbers of 0-fold, simple 2-fold, complex 2-fold, and 4fold degenerate sites, respectively. Once this table is filled using the observed counts for a given pair of sequences, we compute the proportions of transitional (Pi) and transversional (Qi) differences for the ifold degenerate site in the following way:
From these quantities, we compute the Ai and Bi as in the PBL method. Then using L2 = L2C + L2S, we apply the formulas for the PBL method. See also Nei and Kumar (2000), page 64.
136
Include Sites These are options for handling gaps or missing data, including or excluding codon positions, and restricting the analysis to labeled sites, if applicable. Gaps and Missing Data You may choose to remove all sites containing alignment gaps and missing information before the calculation begins (Complete-deletion option). Alternatively, you may choose to retain all such sites initially, excluding them as necessary in the pair-wise distance estimation (Pair-wise-deletion option). Codon Positions Click on the ellipses or the lime square, for the option of selecting any combination of 1st, 2nd, 3rd, and non-coding positions for analysis. This option is available only if the nucleotide sequences contain protein-coding regions and you have selected a nucleotide-by-nucleotide analysis. Labeled Sites This option is available only if some or all of the sites have associated labels. By clicking on the ellipses, you will be provided with the option of including sites with selected labels. If you choose to include only labeled sites, then these sites will be the first extracted from the data. Then all other options mentioned above will be enforced. Note that labels associated with all three positions in the codon must be included for a full codon to be incorporated in the analysis. Substitution Model In this set of options, you choose the various attributes of the substitution models. Model Here you select a stochastic model for estimating evolutionary distance by clicking on the ellipses to the right of the currently selected model (click on the lime square to select this row first). This will reveal a menu containing many different distance methods and models. Substitutions to Include Depending on the distance model or method selected, the evolutionary distance can be teased into two or more components. By clicking on the drop-down button (first click on the lime square to select this row), you will be provided with a list of components relevant to the chosen model. Transition/Transversion Ratio This option will be visible if the chosen model requires you to provide a value for the Transition/Transversion ratio (R). Pattern among Lineages This option becomes available if the selected model has formulas that allow the relaxation of the assumption of homogeneity of substitution patterns among lineages. Rates among Sites This option becomes available if the selected distance model has formulas that allow rate variation among sites. If you choose gamma-distributed rates, then the Gamma parameter option becomes visible.
137
Model You can select a stochastic model for estimating evolutionary distances by clicking on the ellipses to the right of the currently selected model (click on the lime square to select this row first). This will reveal a menu containing many different distance methods/models. Transition/Transversion Ratio This option will be visible if the chosen model requires you to provide a value for the Transition/Transversion ratio (R). Pattern among Lineages This option becomes available if the distance model you have selected has formulas that allow the relaxation of the assumption of homogeneity of substitution patterns among lineages. Rates among Sites This option becomes available if the distance model you have selected has formulas that allow rate variation among sites. If you choose gamma distributed rates, then the Gamma parameter option becomes visible.
Parsimony methods, and Likelihood methods. These methods are explained in Swofford et al. 1996, Li (1997), Page and Holmes (1998), and Nei and Kumar (2000). 6.3.2 NJ/UPGMA Methods Analysis Preferences (NJ/UPGMA)
In this dialog box, you can view and select desired options in the Options Summary. Options are organized in logical sections. A lime square in the right cell of a row indicates that you have a choice for that attribute. The three primary sets of options available in this dialog box are: Phylogeny Test and Options To assess the reliability of a phylogenetic tree, MEGA provides two different types of tests: the Bootstrap test and the Interior branch test. Both of these tests use the bootstrap re-sampling strategy, so you need to enter the number of replicates and a starting random seed. For a given data set applicable tests and the phylogeny inference method are enabled. Include Sites These are options for handling gaps and missing data, including or excluding codon positions, and restricting the analysis to labeled sites, if applicable. Gaps and Missing Data You may choose to remove all sites containing alignment gaps and missinginformation before the calculation begins using the Complete-deletion option. Alternatively, you may choose to retain all such sites initially, excluding them as necessary using the Pair-wise-deletion option. Codon Positions By clicking on the ellipses or the lime square, you may select any combination of 1st, 2nd, 3rd, and non-coding positions for analysis. This option is available only if the nucleotide sequences contain protein-coding regions and you have selected a nucleotide-by-nucleotide analysis. Labeled Sites This option is available only if there are labels associated with some or all of the sites in the data. By clicking on the ellipses, you will have the option of including sites with selected labels. If you chose to include only labeled sites, then these sites will be first extracted from the data and all other options mentioned above will be enforced. Note that labels associated with all three positions in the codon must be included for a full codon in the analysis. Substitution Model In this set of options, you can choose various attributes of the substitution models for DNA and protein sequences. Model By clicking on the ellipses to the right of the currently selected model, you may select a stochastic model (method) for estimating evolutionary distance (click on the lime square to select this row first). This will reveal a menu containing many different distance methods and models. Substitutions to Include Depending on the distance model or method selected, the evolutionary distance
139
can be teased into two or more components. By clicking on the drop-down button (first click on the lime square to select this row), you will be provided with a list of components relevant to the chosen model. Transition/Transversion Ratio This option will be visible if the chosen model requires you to provide a value for the Transition/Transversion ratio (R). Pattern among Lineages This option becomes available if the selected model has formulas that allow the relaxation of the assumption of homogeneity of substitution patterns among lineages. Rates among Sites This option becomes available if the selected distance model has formulas that allow rate variation among sites. If you choose gamma-distributed rates, then the Gamma parameter option becomes visible.
6.3.3 Minimum Evolution Method Minimum Evolution In the ME method, distance measures that correct for multiple hits at the same sites are used, and a topology showing the smallest value of the sum of all branches (S) is chosen as an estimate of the correct tree. However, the construction of a minimum evolution tree is time-consuming because, in principle, the S values for all topologies must be evaluated. The number of possible topologies (unrooted trees) rapidly increases with the number of taxa so it becomes very difficult to examine all topologies. In this case, one may use the neighbor-joining method. While the NJ tree is usually the same as the ME tree, when the number of taxa is small the difference between the NJ and ME trees can be substantial (reviewed in Nei and Kumar 2000). In this case if a long DNA or amino acid sequence is used, the ME tree is preferable. When the number of nucleotides or amino acids used is relatively small, the NJ method generates the correct topology more often than does the ME method (Nei et al. 1998, Takahashi and Nei 2000). In MEGA, we have provided the close-neighborinterchange search to examine the neighborhood of the NJ tree to find the potential ME tree. Analysis Preferences (Minimum Evolution)
In this dialog box you can select and view desired options in the Options Summary. Options are organized in logical sections. A lime square in the right cell of a row indicates that you have a choice for that particular attribute. The primary sets of options available in this dialog box are: Tree Inference Phylogeny Test and Options To assess the reliability of a phylogenetic tree, MEGA provides two different types of tests: the Bootstrap test and the Interior branch test. Both of these tests
140
use the bootstrap re-sampling strategy, so you need to enter the number of replicates and a starting random seed. For a given data set, applicable tests and the phylogeny inference method are enabled. Search Options This sets the extensiveness of the heuristic search for the Minimum Evolution (ME) tree. MEGA employs the Close-Neighbor-Interchange (CNI) algorithm for finding the ME tree. It is a branch swapping method, which begins with an initial NJ tree. Include Sites These are options for handling gaps and missing data, including or excluding codon positions, and restricting the analysis to labeled sites, if applicable. Gaps and Missing Data You may choose to remove all sites containing alignment gaps and missing information before the calculation begins using Complete-deletion option. Alternatively, you may choose to retain all such sites initially, excluding them as necessary using the (Pair-wise-deletion option). Codon Positions By clicking on the ellipses or the lime square, you may select any combination of 1st, 2nd, 3rd, and non-coding positions for analysis. This option is available only if the nucleotide sequences contain protein-coding regions and you have selected a nucleotide-by-nucleotide analysis. Labeled Sites This option is available only if there are labels associated with some or all of the sites in the data. By clicking on the ellipses, you will have the option of including sites with selected labels. If you chose to include only labeled sites, then these sites will be first extracted from the data and all other options mentioned above will be enforced. Note that labels associated with all three positions in the codon must be included for a full codon in the analysis. Substitution Model In this set of options, you can choose various attributes of the substitution models for DNA and protein sequences. Model By clicking on the ellipses to the right of the currently selected model, you may select a stochastic model for estimating evolutionary distance (click on the lime square to select this row first). This will reveal a menu containing many different distance methods and models. Substitutions to Include Depending on the distance model or method selected, the evolutionary distance can be teased into two or more components. By clicking on the drop-down button (first click on the lime square to select this row), you will be provided with a list of components relevant to the chosen model. Transition/Transversion Ratio This option will be visible if the chosen model requires you to provide a value for the Transition/Transversion ratio (R). Pattern among Lineages This option becomes available if the selected model has formulas that allow the relaxation of the assumption of homogeneity of substitution patterns among
141
lineages. Rates among Sites This option becomes available if the selected distance model has formulas that allow rate variation among sites. If you choose gamma-distributed rates, then the Gamma parameter option becomes visible.
6.3.4 Maximum Parsimony (MP) Method Branch-and-Bound algorithm The branch-and-bound algorithm is used to find all the MP trees. It guarantees to find all the MP trees without conducting an exhaustive search. MEGA also employs the Max-mini branch-and-bound search, which is described in detail in Kumar et al. (1993) and Nei and Kumar (2000, page 123). Alignment Gaps and Sites with Missing Information In MEGA, gap sites are ignored in the MP analysis, but there are two different ways to treat these sites. One is to delete all of these sites from data analysis. This option, called the Complete-Deletion option, is generally desirable because different regions of DNA or amino acid sequences often evolve under different evolutionary forces. However, if the number of nucleotides (or amino acids) involved in a gap is small and gaps are distributed more or less randomly, you may include all such sites and treat them as missing data. Therefore, gaps and missing data are never used in computing tree lengths in MEGA 4. Consensus Tree The MP method produces many equally parsimonious trees. Choosing this command produces a composite tree that is a consensus among all such trees, for example, either as a strict consensus, in which all conflicting branching patterns among the trees are resolved by making those nodes multifurcating or as a Majority-Rule consensus, in which conflicting branching patterns are resolved by selecting the pattern seen in more than 50% of the trees. (Details are given in Nei and Kumar [2000], page 130). Analysis Preferences (Maximum Parsimony)
This dialog box contains four overlapping pages, with each page marked by Tabs running across the top. You can go to any page by simply clicking on the Tab. Each tab page organizes a set of logically related options. Information from all the pages is used in the requested analysis, so it is important that you examine the options selected in each tab before pressing OK to proceed with analysis. Phylogeny Test and Options To assess the reliability of the MP trees, MEGA provides the bootstrap test. You need to enter the number of replicates and a starting random seed for this test.
142
Search Options Use this to select between the branch-and-bound and the heuristic (closeneighbor interchange) searches. For the branch-and-bound search, an optimized Max-mini branch-and-bound algorithm is used. While this algorithm is guaranteed to find all the MP trees, a branch-and-bound search often is too time consuming for more than 15 sequences, although this number varies from data set to data set. Alternatively, you may use the heuristic search (Close-NeighborInterchange)., a branch swapping method that begins with a given initial tree. You may automatically obtain a set of initial trees by using the Min-mini algorithm with a given search factor. Alternatively, you can use the random addition option to produce the initial trees. Include Sites This provides options for handling gaps and missing data in the analysis, specifying inclusion and exclusion of codon positions, and restricting the analysis to only some types of labeled sites (if applicable). Gaps and Missing Data You may choose to remove all sites containing alignment gaps and missinginformation before the parsimony analysis begins using the Complete-deletion option. Alternatively, you may choose to retain all such sites. In this case, all missing-information and alignment gap sites are treated as missing data in the calculation of tree length. Codon Positions By clicking on the ellipses (or the lime square), you may select any combination of 1st, 2nd, 3rd, and non-coding positions for analysis. This option is available only if the nucleotide sequences contain protein-coding regions. If they do, you can choose between the analysis of nucleotide sequences or translated protein sequences. If you choose the latter, MEGA will translate all protein-coding regions into amino acid sequences and conduct the protein sequence parsimony analysis. Labeled Sites This option is available only if there are labels associated with some or all of the sites in the data. By clicking on the ellipses, you will have the option of including sites with selected labels. If you choose to include only labeled sites, then these sites will be the first extracted from the data and all other options mentioned above will be enforced. Note that labels associated with all three positions in the codon must be included for a full codon to be incorporated in the analysis.
Heuristic Search Min-mini algorithm This is a heuristic search algorithm for finding the MP tree, and is somewhat similar to the branch-and bound search method. However, in this algorithm, many trees that are unlikely to have a small local tree length are eliminated from the computation of their L values. Thus while the algorithm speeds up the search for the MP tree, as compared to the branch-and-bound search, the final tree or trees may not be the true MP tree(s). The user can specify a search factor to control the extensiveness of the search and MEGA adds the user specified search factor to the current local upper bound. Of course, the larger the search factor, the slower the search, since many more trees will be examined. 143
(See also Nei & Kumar (2000), pages 122, 125) Close-Neighbor-Interchange (CNI) In any method, examining all possible topologies is very time consuming. This algorithm reduces the time spent searching by first producing a temporary tree, (e.g., an NJ tree when an ME tree is being sought), and then examining all of the topologies that are different from this temporary tree by a topological distance of dT = 2 and 4. If this is repeated many times, and all the topologies previously examined are avoided, one can usually obtain the tree being sought. For the MP method, the CNI search can start with a tree generated by the random addition of sequences. This process can be repeated multiple times to find the MP tree. See Nei & Kumar (2000) for details. 6.3.5 Statistical Tests of a Tree Obtained General Comments on Statistical Tests There are two different types of methods for testing the reliability of an obtained tree. One is to test the topological difference between the tree and its closely related tree by using a certain quantity, for example, the sum of all branch lengths in the minimum evolution method. This type of test examines the reliability of every interior branch of the tree, and is generally a conservative test as compared to other tests included in MEGA. The other type of test examines the reliability of each interior branch whether or not it is significantly different from 0. If a particular interior branch is not significantly different from 0, we cannot exclude the possibility of a trifurcation of the associated branches or that the other types of bifurcating trees can be generated by changing the splitting order of the three branches involved. Therefore, in MEGA we implement the bootstrap procedure for estimating the standard error of the interior branch and test the deviation of the branch length from 0 (Dopazo 1994). The third type of test is the bootstrap test, in which the reliability of a given branch pattern is ascertained by examining the frequency of its occurrence in a large number of trees, each based on the re-sampled dataset. Details of these procedures are given in Nei and Kumar (2000, chapter 9). Condensed Trees When several interior branches of a phylogenetic tree have low statistical support (PC or PB) values, it often is useful to produce a multi-furcating tree by assuming that all interior branches have a branch length equal to 0. We call this multifurcating tree a condensed tree. In MEGA, condensed trees can be produced for any level of PC or PB value. For example, if there are several branches with PC or PB values of less than 50%, a condensed tree with the 50% PC or PB level will
144
have a multi-furcating tree with all its branch lengths reduced to 0. Since branches of low significance are eliminated to form a condensed tree, this tree emphasizes the reliable portions of branching patterns. However, this tree has one drawback. Since some branches are reduced to 0, it is difficult to draw a tree with proper branch lengths for the remaining portion. Therefore we give our attention only to the topology so the branch lengths of a condensed tree in MEGA are not proportional to the number of nucleotide or amino acid substitutions. Note that, although they may look similar, condensed trees are different from the consensus trees mentioned earlier. A consensus tree is produced from many equally parsimonious trees, whereas a condensed tree is merely a simplified version of a tree. A condensed tree can be produced for any type of tree (NJ, ME, UPGMA, MP, or maximum-likelihood tree). See also Nei and Kumar (2000) page 175. Interior Branch Tests Interior Branch Test of Phylogeny
Phylogeny | Interior Branch Test of Phylogeny A t-test, which is computed using the bootstrap procedure, is constructed based on the interior branch length and its standard error and is available only for the NJ and Minimum Evolution trees. MEGA shows the confidence probability in the Tree Explorer; if this value is greater than 95% for a given branch, then the inferred length for that branch is considered significantly positive. See Nei and Kumar (2000) (chapter 9) for further details.
145
146
transitions, only transversions, or both. If the data is protein coding, then you can choose to analyze translated sequences or any combination of codon positions by clicking on the Data for Analysis button. See Nei and Kumar (2000) (page 193-196) for further description and an example.
6.3.7 Handling Missing Data and Alignment Gaps Alignment Gaps and Sites with Missing Information
Gaps often are inserted during the alignment of homologous regions of sequences and represent deletions or insertions (indels). They introduce some complications in distance estimation. Furthermore, sites with missing information sometimes result from experimental difficulties; they present the same alignment problems as gaps. In the following discussion, both of these situations are treated in the same way. In MEGA, there are two ways to treat gaps. One is to delete all of these sites from the data analysis. This option, called the Complete-Deletion, is generally desirable because different regions of DNA or amino acid sequences evolve under different evolutionary forces. The second method is relevant if the number of nucleotides involved in a gap is small and if the gaps are distributed more or less randomly. In that case it may be possible to compute a distance for each pair of sequences, ignoring only those gaps that are involved in the comparison; this option is called Pair-wise-Deletion. The following table illustrates the effect of these options on distance estimation with the following three sequences: 1 10 20 seq1 A-AC-GGAT-AGGA-ATAAA seq2 AT-CC?GATAA?GAAAAC-A seq3 ATTCC-GA?TACGATA-AGA Total sites = 20. Here, the alignment gaps are indicated with a hyphen (-) and the missing information sites are denoted by a question mark (?). Complete-Deletion and Pair-wise-Deletion options Differences/Compariso ns Sequence Data (1,2) (1,3) (2,3) Option 1/10 0/10 1/10 Complete 1. A C GA A GA A A A deletion 2. A C GA A GA A C A 3. Pair-wise Deletion 1. 2. A C GA A GA A A A 2/12 3/13 3/14
A-AC-GGAT-AGGA-ATAAA AT-CC?GATAA?GAAAAC-A
3. ATTCC-GA?TACGATA-AGA In the above table, the number of compared sites varies with pair-wise comparisons in the Pair-wise-Deletion option, but remains the same for pair-wise comparisons in the Complete-Deletion option. In this data set, more information can be obtained by using the Pair-wise-Deletion option. In practice, however, different regions of nucleotide or amino acid sequences often evolve differently, in which case, the Complete-Deletion option is preferable.
147
Alignment Gaps and Sites with Missing Information In MEGA, gap sites are ignored in the MP analysis, but there are two different ways to treat these sites. One is to delete all of these sites from data analysis. This option, called the Complete-Deletion option, is generally desirable because different regions of DNA or amino acid sequences often evolve under different evolutionary forces. However, if the number of nucleotides (or amino acids) involved in a gap is small and gaps are distributed more or less randomly, you may include all such sites and treat them as missing data. Therefore, gaps and missing data are never used in computing tree lengths in MEGA 4. Include Sites Option
With this command you can set the options for handling gaps and missing data in the analysis, such as including or excluding codon positions, and restricting the analysis to only some types of labeled sites, if applicable. Gaps and Missing Data You may choose to remove all sites containing alignment gaps and missing information before the parsimony analysis begins (Complete-deletion option). Alternatively, you may choose to retain all such sites. In this case, all missing-information and alignment gap sites are treated as missing data in the calculation of tree length. Codon Positions By clicking on the ellipses (revealed by clicking on the lime-colored square), you will be provided with the option of selecting any combination of 1st, 2nd, 3rd, and non-coding positions for analysis. This option is available only if the nucleotide sequences contain protein-coding regions. If it does, you can choose between the analysis of nucleotide sequences or translated protein sequences. If the latter is chosen, MEGA will translate all protein-coding regions into amino acid sequences and conduct the protein sequence parsimony analysis. Labeled Sites This option is available only if you have labels associated with some or all of the sites in the data. By clicking on the ellipses, you will be provided with the option of including sites with selected labels. If you choose to include only labeled sites, then these sites will be the first extracted from the data. Then all other options mentioned above will be enforced. Note that labels associated with all three positions in the codon must be included for a full codon to be incorporated in the analysis.
148
occurred in the gene sequences. For a pair of sequences, this is done by first estimating the number of synonymous substitutions per synonymous site (dS) and the number of non-synonymous substitutions per non-synonymous site (dN), and their variances: Var(dS) and Var(dN), respectively. With this information, we can test the null hypothesis that H0: dN = dS using a Z-test: Z = (dN - dS) / SQRT(Var(dS) + Var(dN)) The level of significance at which the null hypothesis is rejected depends on the alternative hypothesis (HA). H0: dN = dS HA: (a) dN dS (test of neutrality). (b) (c) dN > d S dN < dS (positive selection). (purifying selection).
For alternative hypotheses (b) and (c), we use a one-tailed test and for (a) we use a twotailed test. These three tests can be conducted directly for pairs of sequences, overall sequences, or within groups of sequences. For testing for selection in a pair-wise manner, you can compute the variance of (dN - dS) by using either the analytical formulas or the bootstrap re-sampling method. For data sets containing more than two sequences, you can compute the average number of synonymous substitutions and the average number of non-synonymous substitutions to conduct a Z-test in manner similar to the one mentioned above. The variance of the difference between these two quantities is estimated by the bootstrap method (Nei and Kumar [2000], page 56).
149
sequences, overall sequences, or within groups of sequences. For testing for selection in a pair-wise manner, you can compute the variance of (dN - dS) by using either the analytical formulas or the bootstrap resampling method. For data sets containing more than two sequences, you can compute the average number of synonymous substitutions and the average number of nonsynonymous substitutions to conduct a Z-test in a manner similar to the one mentioned above. The variance of the difference between these two quantities can be estimated by the bootstrap method (Nei and Kumar [2000], page 56). Analysis Scope Use this option to specify whether to conduct an analysis for sequence pairs, an overall average, or within sequence groups (if sequence groups are specified). Std. Err. Computation by Depending on the scope of the analysis (pair-wise versus other), you may compute standard errors using analytical formulas or the bootstrap method. Whenever standard errors are estimated by the bootstrap method, you will be prompted for the number of bootstrap replicates and a random number seed. When the selected test involves the computation of average distance, only the bootstrap method is available for computing standard errors. Include Sites These are options for handling gaps and missing data and restricting the analysis to labeled sites, if applicable. Gaps and Missing Data You may choose to remove all sites containing alignment gaps and missing information before the calculation begins (Complete-deletion option). Alternatively, you may choose to retain all such sites initially, excluding them as necessary in the pair-wise distance estimation (Pair-wise-deletion option). Labeled Sites This option is available only if there are labels associated with some or all of the sites in the data. By clicking on the ellipses, you will have the option of including sites with selected labels. If you chose to include only labeled sites, they will be first extracted from the data and all of the other options mentioned above will be enforced. Note that labels associated with all three positions in the codon must be included for a full codon in the analysis. Substitution Model In this set of options, you can choose various attributes of the substitution models for DNA and protein sequences. Model By clicking on the ellipses to the right of the currently selected model, you may select a stochastic model for estimating evolutionary distance (click on the lime square to select this row first). This will reveal a menu containing many different distance methods and models. Transition/Transversion Ratio This option will be visible if the chosen model requires you to provide a value for the Transition/Transversion ratio (R).
150
When the numbers of codons or the total numbers of synonymous and/or nonsynonymous substitutions are small, the large sample Z-test is too liberal in rejecting the null hypothesis. In these cases, tests of selection can be conducted to examine the null hypothesis of the neutral evolution. Only the Nei-Gojobori and Modified Nei-Gojobori methods can be used for this test because it requires the direct computation of the numbers of synonymous and non-synonymous differences, and the number of synonymous and non-synonymous sites. It should be used only when sequences show a small number of differences. To conduct Fishers Exact Test, you need to specify two specific options: Analysis Test Hypothesis This tests for positive selection (dN > dS) and can only be computed for sequence pairs. Include Sites These options handle gaps and missing data and restrict the analysis to labeled sites, if applicable. Gaps and Missing Data You may choose to remove all sites containing alignment gaps and missing information before the calculation begins by using the Complete-deletion option. Alternatively, you may choose to retain all such sites initially, excluding them as necessary using the Pair-wise-deletion option. Labeled Sites This option is available only if there are labels associated with some or all of the sites in the data. By clicking on the ellipses, you will have the option of including sites with selected labels. If you chose to include only labeled sites, then these sites first will be extracted from the data then all other options mentioned above will be enforced. Note that labels associated with all three positions in the codon must be included for a full codon in the analysis. Substitution Model In this set of options, you choose various attributes of the substitution models for DNA and protein sequences. Model By clicking on the ellipses to the right of the currently selected model, you may select a stochastic model for estimating evolutionary distance (click on the lime square to select this row first). This will reveal a menu containing two different options: the original or modified Nei & Gojobori methods. Transition/Transversion Ratio This option will be visible if the chosen model requires you to provide a value for the Transition/Transversion ratio (R).
151
Calculate Use this to specify whether to compute Composition Distance , Disparity Index, or to test the homogeneity of evolutionary patterns. If the test is selected, MEGA will conduct the Monte-Carlo analysis, for which you need to provide the number of replicates and a starting random seed. Include Sites These are options for handling gaps and missing data, including or excluding codon positions, and restricting the analysis to labeled sites (if applicable). Gaps and Missing Data You may choose to remove all sites containing alignment gaps and missing information before the calculation begins by using the Complete-deletion option. Alternatively, you may choose to retain all such sites initially, excluding them as necessary by using the Pair-wise-deletion option. Codon Positions By clicking on the ellipses or the lime square, you may select any combination of 1st, 2nd, 3rd, and non-coding positions for analysis. This option is available only if the nucleotide sequences contain protein-coding regions and you have selected a nucleotide-by-nucleotide analysis. If they do, you also can choose between the analysis of nucleotide sequences or translated protein sequences. If the latter is chosen, MEGA will translate all protein-coding regions into amino acid sequences and conduct the protein sequence analysis. Labeled Sites This option is available only if there are labels associated with some or all of the sites in the data. By clicking on the ellipses, you will have the option of including sites with selected labels. If you chose to include only labeled sites, then these sites first will be extracted from the data and all other options mentioned above will be enforced. Note that labels associated with all three positions in the codon must be included for a full codon in the analysis.
152
7 Part V: Visualizing and Exploring Data and Results 7.1 Distance Matrix Explorer
7.1.1 Distance Matrix Explorer
The Distance Matrix Explorer is used to display results from the pair-wise distance calculations. It is an intelligent viewer with the flexibility of altering display modes and functionalities and for computing within groups, among groups, and overall averages. This explorer consists of a number of regions as follows: Menu Bar File Menu Display Menu Average Menu Help: This button brings up the help file. Tool Bar The tool bar provides quick access to a number of menu items.
General Utilities Lower-left Triangle button: Click this icon to display pair-wise distances in the lower-left matrix. If standard errors (or other statistics) are shown, they will be displayed in the upper-right. Upper-right Triangle button: Click this icon to display pair-wise distances in the upper-right matrix. If standard errors (or other statistics) also are shown, they will be displayed in the lower-left. (A, B): This button is an on-off switch to write or hide the name of the highlighted taxa pair. The taxa pair is displayed in the status bar below. Distance Display Precision
: This decreases the precision of the distance display by one decimal place with each click of the button. : This increases the precision of the distance display by one decimal place with each click of the button.
Column Sizer: This is a slider that increases or decreases the width of the columns showing the pair-wise distances. The 2-Dimensional Data Grid This grid displays the pair-wise distances between taxa (or within groups etc.) in the form of a lower or upper triangular matrix. The taxa names are the row-headers; the column headers are numbered from 1 to m, with m being the number of taxa. There is a column sizer for the row-headers, so that you can increase or decrease the column size to accommodate the full name of the sequences or groups.
Fixed Row: This is the first row in the data grid and displays the column number. Fixed Column: This is the first and leftmost column in the data grid. This column is
153
always visible even if you scroll past the initial screen. It contains taxa names and an associated check box. To include or exclude taxa from analysis, you can check or uncheck this box. In this column, you can drag-and-drop taxa names to sort them.
Rest of the Grid: Cells to the right of the first column and below the first row contain the nucleotides or amino acids of the input data. Note that all cells are drawn in light color if they contain data corresponding to unselected sequences or genes and domains. Status bar The left sub-panel shows the name of the statistic for the currently selected value. In the next panel, the status bar shows the taxa-pair name for the selected value.
Show Pair Name: This is a toggle to write or hide the name of the taxa pair highlighted, which is displayed in the status bar below. Sort Taxa: This provides a submenu for sorting the order of taxa in one of three ways: by input order, by taxon name or by group name. Show Names: This is a toggle for displaying or hiding the taxa name. Show Group Names: This is a toggle for displaying or hiding the group name next to the name of each taxon, when available. Change Font: This brings up the dialog box that allows you to choose the type and size of the font for displaying the distance values.
154
Show Input Data Title: This displays the title of the input data. Show Analysis Description: This displays various options used to calculate the quantities displayed in the Matrix Explorer. Export/Print Distances: This brings up a dialog box for writing pair-wise distances as a text file, with a choice of several formats. Quit Viewer: This exits the Distance Data Explorer.
General Utilities : This brings up the Exporting Sequence Data dialog box, which contains options to control how MEGA writes the output data. Color: This brings up a color palette selection box with which you can choose the color to be displayed in the highlighted sites. : This brings up the dialog box for setting up and selecting domains and genes. : This brings up the dialog box for setting up, editing, and selecting taxa and groups of taxa. : This toggle replaces the nucleotide (amino acid) at a site with the identical symbol (e.g. a dot) if the site contains the same nucleotide 155
(amino acid).
Highlighting Sites C: If this button is pressed, then all constant sites will be highlighted. A count of the highlighted sites will be displayed on the status bar. V: If this button is pressed, then all variable sites will be highlighted. A count of the highlighted sites will be displayed on the status bar. Pi: If this button is pressed, then all parsimony-informative sites will be highlighted. A count of the highlighted sites will be displayed on the status bar. S: If this button is pressed, then all singleton sites will be highlighted. A count of the highlighted sites will be displayed on the status bar. 0: If this button is pressed, then sites will be highlighted only if they are zero-fold degenerate sites in all sequences displayed. A count of highlighted sites will be displayed on the status bar. (This button is available only if the dataset contains protein coding DNA sequences). 2: If this button is pressed, then sites will be highlighted only if they are two-fold degenerate sites in all sequences displayed. A count of highlighted sites will be displayed on the status bar. (This button is available only if the dataset contains protein coding DNA sequences). 4: If this button is pressed, then sites will be highlighted only if they are four-fold degenerate sites in all sequences displayed. A count of highlighted sites will be displayed on the status bar. (This button is available only if the dataset contains protein coding DNA sequences).
: This button provides the facility to translate codons in the sequence data into amino acid sequences and back. All protein-coding regions will be automatically identified and translated for display. When the translated sequence is already displayed, then issuing this command displays the original nucleotide sequences (including all coding and non-coding regions). Depending on the data displayed (translated or nucleotide), relevant menu options in the Sequence Data Explorer become enabled. Note that the translated/untranslated status in this data explorer does not have any impact on the options for analysis available in MEGA (e.g., Distances or Phylogeny menus), as MEGA provides all possible options for your dataset at all times. The 2-Dimensional Data Grid Fixed Row: This is the first row in the data grid. It is used to display the nucleotides (or amino acids) in the first sequence when you have chosen to show their identity using a special character. For protein coding regions, it also clearly marks the first, second, and the third codon positions. Fixed Column: This is the first and the leftmost column in the data grid. It
156
is always visible, even when you are scrolling through sites. The column contains the sequence names and an associated check box. You can check or uncheck this box to include or exclude a sequence from analysis. Also in this column, you can drag-and-drop sequences to sort them. Rest of the Grid: Cells to the right of and below the first row contain the nucleotides or amino acids of the input data. Note that all cells are drawn in light color if they contain data corresponding to unselected sequences or genes or domains. Status Bar This section displays the location of the focused site and the total sequence length. It also shows the site label, if any, and a count of the highlighted sites. 7.2.1 Data Menu Data Menu
This allows you to explore the active data set, and establish various data attributes, and data subset options.
Data Menu (in Sequence Data Explorer) This menu provides commands for working with selected data in the Sequence Data Explorer The commands in this menu are: Write Data to File Brings up the Exporting Sequence Data dialog box. Translate/Untranslate Translates protein-coding nucleotide sequences into protein sequences, and back to nucleotide sequences. Brings up the Select Genetic Code dialog box, in which you can select, edit or add a genetic code table. Brings up the Sequence Data Organizer, in which you can define and edit genes and domains. Brings up the Select/Edit Taxa and Groups dialog, in which you can edit taxa and define groups of taxa. Takes the user back to the main interface.
Select Genetic Code Table Setup/Select Genes and Domains Setup/Select Taxa and Groups Quit Data Viewer
157
Translate/Untranslate (in Sequence Data Explorer) Data | Translate/Untranslate This command is available only if the data contain protein-coding nucleotide sequences. It automatically extracts all protein-coding domains for translation and displays the corresponding protein sequence. If the translated sequence is already displayed, then issuing this command displays the original nucleotide sequences, including all coding and non-coding regions. Depending on the data displayed (translated or nucleotide), relevant menu options in the Sequence Data Explorer are enabled. However, translated and un-translated status does not have any impact on the analytical options available in MEGA (e.g., Distances or Phylogeny menus), as MEGA provides all possible options for your dataset at all times. Select Genetic Code Table (in Sequence Data Explorer) Data | Select Genetic Code Table Select Genetic Code Table, can be invoked from within the Data menu in Sequence Data Explorer, and is also available in the main interface directly in the Data Menu. Setup/Select Taxa & Groups (in Sequence Data Explorer) Data | Setup/Select Taxa & Groups Setup/Select Taxa & Groups, can be invoked from within the Data menu in Sequence Data Explorer, and is also available in the main interface directly in the Data Menu. Setup/Select Genes & Domains (in Sequence Data Explorer) Data | Setup/Select Genes & Domains Setup/Select Genes & Domains, can be invoked from within the Data menu in Sequence Data Explorer, and is also available in the main interface directly in the Data Menu. Export Data (in Sequence Data Explorer) Data | Export Data The Exporting Sequence Data dialog box first displays an edit box for entering a title for the sequence data being exported. The default name is the original name of the data set, if there was one. Below the title is a space for entering a brief description of the data set being exported. Next is the option for determining the format of the data set being exported; MEGA currently allows the user to export the data in MEGA, PAUP 3.0 and PAUP 4.0 (Nexus, Interleaved in both cases), and PHYLIP 3.0 (Interleaved). tA the end of each line, is "Writing site numbers." The three options available are to 158
not write any number, to write one for each site, or to write the site number of the last site. Other options in this dialog box include the number of sites per line, which codon position(s) is to be used and whether non-coding regions should be included, and whether the output is to be interleaved. For missing or ambiguous data and alignment gaps, there are four options: include all such data, exclude all such data, exclude or include sites with missing or ambiguous data only, and exclude sites with alignment gaps only. Quit Data Viewer Data | Quit Data Viewer This command closes the Sequence Data Explorer, and takes the user back to main interface. 7.2.2 Display Menu Data Menu (in Sequence Data Explorer) This menu provides commands for working with selected data in the Sequence Data Explorer The commands in this menu are: Write Data to File Brings up the Exporting Sequence Data dialog box. Translate/Untranslate Translates protein-coding nucleotide sequences into protein sequences, and back to nucleotide sequences. Brings up the Select Genetic Code dialog box, in which you can select, edit or add a genetic code table. Brings up the Sequence Data Organizer, in which you can define and edit genes and domains. Brings up the Select/Edit Taxa and Groups dialog, in which you can edit taxa and define groups of taxa. Takes the user back to the main interface.
Select Genetic Code Table Setup/Select Genes and Domains Setup/Select Taxa and Groups Quit Data Viewer Restore Input Order
Display | Restore Input Order Choosing this restores the order in Sequence Data Explorer to that in the input text file.
159
Show Only Selected Sequences Display | Show only Selected Sequences The check boxes in the left column of the display grid can be used to select or deselect sequences for analysis. Subsequent use of the "Show Only Selected Sequences" option in the Display menu of Sequence Data Explorer hides all the deselected sequences and displays only the selected ones. Color Cells Display | Color cells This command colors individual cells in the two-dimensional display grid according to the nucleotide or amino acid it contains. A list of default colors, based on the biochemical properties of the residues, is given below. In a future version, these colors will be customizable by the user. For DNA sequences: Symbo l Color A Yellow G Fuchsia C Olive T Green U Green For amino acid sequences: Symbo Symbo l Color l A Yellow M C Olive N D Aqua P E Aqua Q F Yellow R G Fuchsi S a H Teal T I Yellow V K Red W L Yellow Y
Color Yellow Green Blue Green Red Green Green Yellow Green Lime
Use Identical Symbol Display | Use Identical Symbol Data that contain multiple aligned sequences may be easier to view if, when the nucleotide (amino acid) is the same as that in the corresponding site in the first
160
sequence, the nucleotide (amino acid) is replaced by a dot. Choosing this option again brings back the nucleotide (amino acid) single-letter codes. Show Sequence Names Display | Show Sequence Names This option displays the full sequence names in Sequence Data Explorer Show Group Names Display | Show Group Names This option displays the full group names in Sequence Data Explorer if the sequences have been grouped in Select/Edit Taxa Groups Change Font... Display | Change Font This command brings up the Change Font dialog box, which allows you to change the display font, including font type, style and size. Options to strikeout or underline selected parts of the sequences are also available. There is also an option for using different scripts, although the only option currently available is "Western". Finally the "Sample" window displays the effects of your choices Sort Sequences Display | Sort Sequences The sequences in the data set can be sorted based on several options: sequence name, group name, group and sequence names, or as per the order in the Select/Edit Taxa Groups dialog box. Sort Sequences by Group Name Display | Sort Sequences | By Group Name Sequences that have been grouped in Select/Edit Taxa Groups can be sorted by the alphabetical order of group names or numerical order of group ID numbers. If the group names contain both a name and a number, the numerical order will be nested within the alphabetical order. Sort Sequences by Group and Sequence Names Display | Sort Sequences | By Group and Sequence Names Sequences that have been grouped in Select/Edit Taxa Groups can be sorted by the alphabetical order of group names or the numerical order of group ID numbers. If the group names contain both a name and a number, the numerical order is nested within the alphabetical order. The sequences can be further arranged by sorting the sequence names within the group names. 161
Sort Sequences As per Taxa/Group Organizer Display | Sort Sequences | As per Taxa/Group Organizer The sequence/group order seen in Select/Edit Taxa Groups is initially the same as the order in the input text file. However, this order can be changed by dragging-and-dropping. Choose this option if you wish to see the data in the same order in the Sequence Data Explorer as in Select/Edit Taxa Groups. Sort Sequences By Sequence Name Display | Sort Sequences | By Sequence Name The sequences are sorted by the alphabetical order of sequence names or the numerical order of sequence ID numbers. If the sequence names contain both a name and a number, then the sorting is done with the numerical order nested within the alphabetical order. 7.2.3 Highlight Menu Highlight Menu (in Sequence Data Explorer) This menu can be used to highlight certain types of sites. The options are constant sites, variable sites, parsimony-informative sites, singleton sites, 0-fold, 2-fold and 4-fold degenerate sites. Highlight Conserved Sites Highlight | Conserved Sites Use this command to highlight constant sites Highlight Variable Sites Highlight | Variable Sites Use this command to highlight variable sites sites. Highlight Singleton Sites Highlight | Singleton Sites Use this command to highlight singleton sites. Highlight Parsimony Informative Sites Highlight | Parsim-Info Sites Use this command to highlight parsimony-informative sites.
162
Highlight 0-fold Degenerate Sites Highlight | 0-fold Degenerate Sites Use this command to highlight 0-fold degenerate sites. Highlight 2-fold Degenerate Sites Highlight | 2-fold Degenerate Sites Use this command to highlight 2-fold degenerate sites. The command is visible only if the data consists of nucleotide sequences. Highlight 4-fold Degenerate Sites Highlight | 4-fold Degenerate Sites Use this command to highlight 4-fold degenerate sites. The command is visible only if the data consists of nucleotide sequences. 7.2.4 Statistics Menu Statistics Menu (in Sequence Data Explorer) Various summary statistics of the sequences can be computed and displayed using this menu. The commands are: Nucleotide Composition. Nucleotide Pair Frequencies. Codon Usage. Amino Acid Composition. Use All Selected Sites. Use only Highlighted Sites. Sites can be selected according to various criteria (see Highlight Sites), and analysis can be performed only on the chosen subset of sites. Nucleotide Composition Statistics | Nucleotide Composition This command is visible only if the data consist of nucleotide sequences. MEGA computes the base frequencies for each sequence as well as an overall average. These will be displayed by domain in a Text Editor domain (if the domains have been defined in Setup/Select Genes & Domains). Nucleotide Pair Frequencies Statistics | Nucleotide Pair Frequencies This command is visible only if the data consists of nucleotide sequences. There are two options available: one in which the nucleotide acid pairs are counted bidirectionally site-by-site for the two sequences (giving rise to 16 different
163
nucleotide pairs), the other, in which the pairs are counted unidirectionally (10 nucleotide pairs). MEGA will compute the frequencies of these quantities for each sequence as well as an overall average. They will be displayed in a Text Editor domain by domain (if domains have been defined in Setup/Select Genes & Domains). Codon Usage Statistics | Codon Usage This command is visible only if the data contains protein-coding nucleotide sequences. MEGA 4 computes the percent codon usage and the RCSU values for each codon for all sequences included in the dataset. Results will be displayed in a Text Editor domain (if domains have been defined in Setup/Select Genes & Domains). Amino Acid Composition Statistics | Amino acid Composition This command is visible only if the data consists of amino acid sequences or if the translated protein coding nucleotide sequences are displayed. MEGA will compute the amino acid frequencies for each sequence as well as an overall average, which will be displayed in a Text Editor domain (if domains have been defined in Setup/Select Genes & Domains). Use All Selected Sites Statistics | Use All Selected Sites Analysis is conducted on all sites in the sequences, irrespective of whether any sites have been labeled or highlighted. Use only Highlighted Sites Statistics | Use only Highlighted Sites Sites can be selected according to various criteria (see Highlight Sites), and analyses will be performed only on the chosen subset of sites. All statistical attributes will be based on these sites.
File Menu Image Menu Sub-tree Menu View Menu Compute Menu 7.3.2 Information Box The information box in the Tree Explorer lists the various statistical attributes of the displayed tree with the branch or node highlighted. It usually contains multiple tabs. General: This reminds the user of the number of taxa (and groups, if any) and of the strategy used to deal with gaps and missing data. Tree: This contains information about the type of tree rooted/unrooted, and the sum of branch lengths, SBL, or the tree-length. In addition, information about the total number of trees and the tree number of the current tree is displayed. Branch: In the Tree Explorer window you may click on a branch or on a node of the tree. If you click on a branch, this tab displays its location in terms of the two nodes it connects. (Leaf taxa are numbered in the order in which they appear in the input data file.) This window also displays the length of the selected branch. If you click on a node, the internal identification number of that node is displayed.
7.3.3 File Menu (in Tree Explorer) This menu has the following options: Save Current Session: This brings up the Save As dialog box and saves all the information currently held by the Tree Explorer to a file in a binary format. This feature allows you to retrieve the current Tree Explorer session for tree manipulation and printing. Export Current Tree (Newick): This writes the topology of the current tree in the MEGA tree format to a specified file. Note that only the branching pattern is stored. Export All Trees (Newick): This writes the topologies of all trees in the MEGA tree format to a specified file. Note that only the branching pattern is stored. Show Information: This brings up the Information dialog box. Print: This brings up the Print dialog box and prints the current tree in the displayed size; if the displayed tree is larger than the page size, it will be printed on multiple pages. Print in a sheet: This brings up the Print dialog box and prints the current tree, after restricting the size of the printed tree to one sheet. The current tree also can be printed using the button on the toolbar. Printer Setup: This allows the user to setup the printer. Exit Tree Explorer: This exits the Tree Explorer.
165
7.3.4 Image Menu (in Tree Explorer) The image menu contains three options: Copy to Clipboard: This copies the tree image to the clipboard, which can also be done by simultaneously pressing Ctrl and C keys. You then can paste the copied image into any other Windows application (e.g., PowerPoint and Word). Save as Enhanced metafile: This option saves the image as an enhanced windows metafile (.EMF). It brings up the Save As dialog box to specify the filename. Save as TIFF: This option saves the tree image as Tagged Image File Format (TIFF) with 400dpi resolution and without LZW compression. TIFF is a popular raster graphics format widely supported by image-manipulation software such as Adobe Photoshop. Note that one cannot edit each tree part in this format as in the cases of EMF and PDF, while the graphics quality and cross-platform compatibility are better. Also, users should notice that the file size is much larger than EMF and PDF and it usually becomes tens or hundreds of mega bytes. It brings up the Save As dialog box to specify the filename. Loan Taxon Images: This option automatically associates images to each taxon. To use it, you will be prompted for the directory where the bitmap images (in BMP format) reside. For each taxon, the image file must have a BMP extension and the filename must be identical to the taxon name displayed in the Tree Explorer. All of the valid images that are found will be retrieved and displayed. 7.3.5 Subtree Menu (in Tree Explorer) This menu contains the tree manipulation options Swap, Flip and Compress/Expand. In addition, by clicking on the corresponding items in the menu (for which there are tool buttons on the left), you can specify the root of the tree, and display a subtree (a portion of the tree defined by a given internal branch) in a separate window. Choosing Divergence Time transforms the cursor to an arrow below which is the icon associated with the divergence time option. To obtain the evolutionary rate of a specific lineage, you should point the cursor to that branch and click. On the other hand, if you are interested in the average evolutionary rate of a cluster of two or more taxa, then you should click at the node at the common ancestor of the cluster. Either way, MEGA brings up the Divergence Time dialog box, which displays the evolutionary rate information for a given divergence time. Many of these functionalities are also available through tools in the toolbar on the left side of the displayed tree. 7.3.6 Subtree Drawing Options (in Tree Explorer)
This dialog box provides choices options for changing various visual attributes for the selected subtree. If the Overwrite Downstream option is checked, any subtree drawing
166
options that have been applied to downstream nodes within the current subtree will be overwritten. Property Tab:
Name/Caption: This section allows you to provide an alphanumeric caption for the selected node. Node/Subtree Marker: This section provides elements for changing the shape and color of the selected subtree node marker. If the Apply to Taxon Markers option is checked, the selected shape and color options will be applied to all taxon markers contained within the subtree. Branch Line: This section provides various drawing options that will be applied to the branch lines of the selected subtree. Display Tab: Display Caption: If checked, the node caption, if set within the Property Tab, will be displayed. Display Bracket: If checked, this item will display a bracket that encompasses the selected subtree using the configured bracket drawing options. Display Taxon Names: If checked, the taxon names attributed to the leaf nodes will be displayed. Display Node Markers: If checked, any node markers that were configured within the Property Tab will be displayed. Display Taxon Markers: If checked, any taxon markers that were configured within the Property Tab will be displayed. Compress Subtree: If checked, the selected subtree will be compressed and rendered as a graphical vector according to the configured drawing options. Image Tab: Display Image: If checked, the Tree Explorer will display an image, if loaded, at the configured position relative to the subtree node caption text. 7.3.7 Cutoff Values Tab In this tab, you can specify a cut-off level for the condensed or consensus trees. Appropriate options become available depending on the trees displayed. 7.3.8 Divergence Time Dialog Box This dialog box allows the user to specify the evolutionary rate for constructing linearized trees. This can be done by providing the evolutionary rate directly or by providing the divergence time for the given node. 7.3.9 View Menu (in Tree Explorer) This menu brings up several viewing options: Topology only: This displays the tree in the form of relationships among the taxa, ignoring the branch lengths. Root on Midpoint: This roots the tree on the midpoint of the longest path 167
between two taxa. Arrange Taxa: This allows you to arrange the taxa in the tree based on the order of taxa in the input data file or to produce a tree that looks "balanced." Tree/Branch Style: This allows you to select the display of the tree in one of three styles: Traditional, Radiation, or Circle. For Traditional, there are three additional options: Rectangular, Straight or Curved. Show/Hide: This allows you to display or hide the following information: taxon label, taxon marker, statistics (e.g., bootstrap values), branch lengths, or scale bar. Fonts: This allows you to choose features such as font type and size for information, including the taxon label, statistics, and scale bar. Options: This brings up the Option dialog box, which provides control over various aspects of the tree drawing, including individual branches, the taxon names, and the scale bar.
7.3.10 Options dialog box (in Tree Explorer) Through this dialog box, you can specify various drawing attributes for the tree. All options are organized in five tabs. Tree Branch Labels Scale Cutoff 7.3.11 Tree tab (in Options dialog box) This allows you to manipulate aspects of the tree, depending on the style you used to draw the tree. For instance, if you used the traditional rectangular style, then you can manipulate the taxon separation distance, branch length, or tree width, in the number of pixels. This tab also contains a schematic of a tree illustrating these features.
7.3.12 Branch tab (in Options dialog box) This tab has options for the following aspects of the tree: Line Width: This allows the user to choose the width of the lines. Display Statistics/Frequency: This presents the options to Hide or Show the statistics and frequency, to choose the font, or to alter the placement of the numbers by manipulating the horizontal and vertical positions. Display Branch Length: This presents the option to Show the branch length or Hide it if it is shorter than a specified length, to alter the placement of the written branch lengths, and to choose the number of decimal places for writing the 168
Display Taxon Names: Presents the option to show (checked) or hide (unchecked) the label and to choose the font. Display Markers: Allows you to draw small symbols along with or instead of taxa names in the tree. Two combo boxes and a list allow you to select the marker graphics and its color. 7.3.14 Scale Bar tab (in Options dialog box) This tab has options: Line Width: This drop-down menu allows you to choose the width of the line and the font size used in the scale bar. Show Distance Scale. This allows you to show or hide the scale bar distance, to enter the unit used and to choose its length and the interval between tick marks. Show Time Scale: This presents the option of showing or hiding the divergence time in the scale bar, and to enter the units used. You also can determine the interval between two major ticks and two minor ticks. To activate this option the divergence time for a node or the evolutionary rate must be given.
7.3.15 Compute Menu (in Tree Explorer) This performs various tree computations, including Condensed tree, Linearized tree, and Consensus tree, and allows you to estimate the divergence time for each node using the molecular clock.
one view. However, it offers two views of DNA sequence data: the DNA Sequences grid and the Translated Protein Sequences grid. These two views are present in alignment grids in the two tabs with each grid displaying the sequence data for the current alignment. Each row represents a single sequence and each column represents a site. A "*" character is used to indicate site columns, exhibiting consensus across all sequences. An entire sequence may be selected by clicking on the gray sequence label cell found to the left of the sequence data. An entire site may be selected by clicking on the gray cell found above the site column. The alignment grid has the ability to assign a unique color to each unique nucleotide or amino acid and it can display a background color for each cell in the grid. This behavior can be controlled from the Display menu item found in the main menu. Please note that when the ClustalW alignment algorithm is initiated, it only will align the sites currently selected in the alignment grids. Multiple sites may be selected by clicking and then dragging the mouse within the grid. Note that all of the manual or automatic alignment procedures carried out in the Protein Sequences grid will be imposed on the corresponding DNA sequences as soon as you flip to the DNA sequence grid. Even more importantly, the Alignment Explorer provides unlimited UNDO capabilities. 7.4.2 Creating Multiple Sequence Alignments In this example, we will create an alignment from protein sequence data that will be imported into the alignment editor using different methods. Ex 1.0.1: Start MEGA by double-clicking on the MEGA desktop icon, or by using the Windows start-menu to click on the MEGA icon located in the programs folder. Ex 1.0.2: Launch the Alignment Explorer by selecting the Alignment|Alignment Explorer/CLUSTAL menu command. In order to align sequences contained in a Sequence Data File, do the following: Ex 1.1.1: Add unaligned sequences from the hsp20.fas example file into the Alignment Explorer by clicking selecting the Data|Open|Retrieve Sequences from File menu command. Ex 1.1.2: Select the Edit|Select All menu command to select every site for all sequences in the alignment. Ex 1.1.3: Select the Alignment|Align by ClustalW menu command to align the selected sequences data using the ClustalW algorithm. Ex 1.1.4: Save the current alignment session by selecting the Data|Save Session menu item. This will allow the current alignment session to be restored for future editing. Ex 1.1.5: Exit the Alignment Explorer by selecting the Data|Exit Alignment Explorer menu item. A message will appear asking if you would like to save the data to a MEGA file. Choose "YES," and then a "Save As" dialog box will appear. Enter hsp20_aligned.meg as the file name, and click the "Save" button. An input box will appear asking for a title for the data. Enter "HSP 20 Aligned by MEGA" as the title, and click the "OK" button. Another dialog box will appear asking you if the sequence data is protein coding. In this case, click "Yes." A final dialog box
170
will appear asking you if you would like to open the data file in MEGA. Click "Yes." Now, we will examine how to send sequence data from the Internet (Web Explorer) to the Alignment Explorer. Ex 1.2.1: If the Alignment Explorer already contains sequence data, select the Data| Create new menu command to create a new alignment from Alignment Explorer window. Choose "YES" on the dialog box that appears to indicate that you are creating a DNA sequence. Ex 1.2.2: Activate the Web Explorer tab by selecting Web|Query Gene Banks from the menu. Ex 1.2.3: When the NCBI Entrez site is loaded, select either the nucleotide or protein database, enter a search term into the search box, and press the "GO" button. Ex 1.2.4: When the search results are displayed, select the specific search item and choose "Sequence" from the menu bar. Press the "Add to Alignment" button located to the left of the address box. This will display the Web Fetch dialog window. Ex 1.2.5: Click the box to the left of each accession number whose sequences information you would like to fetch from the web. When you are done, you can select accessions by pressing the "Fetch" button. Ex 1.2.6: When the status column indicates that all sequences are fetched, press the "Send to Alignment" button to send the fetched sequence data to the Alignment Explorer. Ex 1.2.7: Align the fetched data using the steps detailed in Ex 1.1.2 Ex 1.1.5. You may also open a trace file in the Trace Data Viewer/Editor and send it directly to the Alignment Explorer. 7.4.3 Aligning coding sequences via protein sequences MEGA provides a convenient method for aligning coding sequences based on the alignment of protein sequences. In order to accomplish this you use the Alignment Explorer to load a data file containing protein-coding sequences. If you click on the Translated Protein Sequences tab you will see that the proteincoding sequences are automatically translated into their respective protein sequence. With this tab active select the Alignment|Align by ClustalW menu item or click on the "W" tool bar icon to begin the alignment of the translated protein sequences. Once the alignment of the translated protein sequences completes, click on the DNA Sequences tab and youll find that Alignment Explorer automatically aligned the protein-coding sequences according to the aligned translated protein sequences. Any manual adjustments made to the translated protein sequence alignment will also be reflected in the protein-coding sequence tab.
171
Basic Functions This prepares Alignment Builder for a new alignment. Any sequence data currently loaded into Alignment Builder is discarded. This activates the Open File dialog window. It is used to send sequence data from a properly formatted file into Alignment Builder. This activates the Save Alignment Session dialog window. It may be used to save the current state of the Alignment Builder into a file so that it may be restored in the future. This causes nucleotide sequences currently loaded into Alignment Builder to be translated into their respective amino acid sequences. Web/Data Explorer Functions This displays the NCBI BLAST web site in the Web Explorer tab window. If a sequence in the sequence grid is selected prior to clicking this button, the Web Explorer will auto-fill the BLAST query window with the selected sequence data. This displays the default database (GenBank) in the Web Explorer tab window. This activates the Open Trace File dialog window, which may be used to open and view a sequencer file. The sequence data from the sequencer file then can be sent into Alignment Explorer. Alignment Functions This displays the ClustalW parameters dialog window, which is used to configure ClustalW and initiate the alignment of the selected sequence data. If you do not select sequence data prior to clicking this button, a message box will appear asking if you would like to select all of the currently loaded sequences. This marks or unmarks the currently selected single site in the alignment grid. Each sequence in the alignment may have only one site marked at a time. Modifications can be made to the alignment by marking two or more sites and then aligning them using the Align Marked Sites function. This button aligns marked sites. Two or more sites must be marked in order for this function to have an effect. Search Functions This activates the Find Motif search box. When this box appears, it asks you to enter a motif sequence (a small subsequence of a larger sequence) as the search term. After the search term is 172
entered, the Alignment Builder finds each occurrence of the search term and indicates it with yellow highlighting. For example, if you were to enter the motif "AGA" as the search term, then each occurrence of "AGA" across all sequences in the sequence grid would be highlighted in yellow. This searches towards the beginning of the current sequence for the first occurrence of the motif search term. If no motif search has been performed prior to clicking this button, the Find Motif search box will appear. This searches towards the end of the current sequence for the first occurrence of the motif search term. If no motif search has been performed prior to clicking this button, the Find Motif search box will appear. This locates the marked site in the current sequence. If no site has been marked, a warning box will appear. Editing Functions This undoes the last Alignment Builder action. This copies the current selection to the clipboard. It may be used to copy a single base, a block of bases, or entire sequences to the clipboard. This removes the current selection from the Alignment Builder and sends it to the clipboard. This function can affect a single base, a block of bases, or entire sequences. This pastes the contents of the clipboard into the Alignment Builder. If the clipboard contains a block of bases, it will be pasted into the builder starting at the point of the current selection. If the clipboard contains complete sequences they will be added to the current alignment. For example, if the contents of a FASTA file were copied to the clipboard from a web browser, it would be pasted into Alignment Builder as a new sequence in the alignment. This deletes a block of selected bases from the alignment grid. This deletes gap-only sites (sites containing a gap across all sequences in the alignment grid) from a selected block of bases. Sequence Data Insertion Functions This creates a new, empty sequence row in the alignment grid. A label and sequence data must be provided for this new row. This activates an Open File dialog box that allows for the selection of a sequence data file. Once a suitable sequence data file is selected, its contents will be imported into Alignment Builder as new sequence rows in the alignment grid. Site Number display on the status bar Site # The Site # field indicates the site represented by the current
173
selection. If the w/o Gaps radio button is selected, then the Alignment Builder will disregard the shifting affect of gaps when determining gap sites. If a block of sites are selected, then this field will contain the site # for the first site in the block. If an entire sequence is selected this field will contain the site # for the last site in the sequence.
7.4.4 Menu Items Alignment Menu (in Alignment Explorer) This menu provides access to commands for editing the sequence data in the alignment grid. The commands are: Align by ClustalW: This option is used to align the DNA or protein sequence included in the current selection on the alignment grid. You will be prompted for the alignment parameters (DNA or Protein) to be used in ClustalW; to accept the parameters, press "OK". This initiates the ClustalW alignment system. Alignment Builder then aligns the current selection in the alignment grid using the accepted parameters. Mark/Unmark Site: This marks or unmarks a single site in the alignment grid. Each sequence in the alignment may only have one site marked at a time. Modifications can be made to the alignment by marking two or more sites and then aligning them using the Align Marked Sites function. Align Marked Sites: This aligns marked sites. Two or more sites in the alignment must be marked for this function to have an effect. Unmark All Sites: This item unmark all currently marked sites across all sequences in the alignment grid. Delete Gap-Only Sites: This item deletes gap-only sites (site columns containing gaps across all sequences) from the alignment grid. Auto-Fill Gaps: If this item is checked, then the Alignment Builder will ensure that all sequences in the alignment grid are the same length by padding shorter sequences with gaps at the end. Display Menu (in Alignment Explorer) This menu provides access to commands that control the display of toolbars in the alignment grid. The commands in this menu are: Toolbars: This contains a submenu of the toolbars found in Alignment Explorer. If an item is checked, then its toolbar will be visible within the Alignment Explorer window. Use Colors: If checked, Alignment Explorer displays each unique base using a unique color indicating the base type. Background Color: If checked, then Alignment Explorer colors the background 174
of each base with a unique color that represents the base type. Font: The Font dialog window can be used to select the font used by Alignment Explorer for displaying the sequence data in the alignment grid.
Edit Menu (in Alignment Explorer) This menu provides access to commands for editing the sequence data in the alignment grid. The commands in this menu are: Undo: This undoes the last Alignment Explorer action. Copy: This copies the current selection to the clipboard. It may be used to copy a single base, a block of bases, or entire sequences. Cut: This removes the current selection from the Alignment Explorer and sends it to the clipboard. This function can affect a single base, a block of bases, or entire sequences. Paste: This pastes the contents of the clipboard into the Alignment Explorer. If the clipboard contains a block of bases, they will be pasted into the builder, starting at the point of the current selection. If the clipboard contains complete sequences, they will be added to the current alignment. For example, if the contents of a FASTA file are copied from a web browser to the clipboard, they will be pasted into the Alignment Explorer as a new sequence in the alignment. Delete: This deletes a block of selected bases from the alignment grid. Delete Gaps: This deletes gaps from a selected block of bases. Insert Blank Sequence: This creates a new, empty sequence row in the alignment grid. A label and sequence data must be provided for this new row. Insert Sequence From File: This activates an Open File dialog box that allows for the selection of a sequence data file. Once a suitable sequence data file is selected, its contents will be imported into Alignment Explorer as new sequence rows in the alignment grid. Select Site(s): This selects the entire site column for each site within the current selection in the alignment grid. Select Sequences: This selects the entire sequence for each site within the current selection in the alignment grid. Select all: This selects all of the sites in the alignment grid. Allow Base Editing: If this item is checked, it changes the base values for all cells in the alignment grid. If it is not checked, then all bases in the alignment grid are treated as read-only.
175
Basic Functions This prepares Alignment Builder for a new alignment. Any sequence data currently loaded into Alignment Builder is discarded. This activates the Open File dialog window. It is used to send sequence data from a properly formatted file into Alignment Builder. This activates the Save Alignment Session dialog window. It may be used to save the current state of the Alignment Builder into a file so that it may be restored in the future. This causes nucleotide sequences currently loaded into Alignment Builder to be translated into their respective amino acid sequences. Web/Data Explorer Functions This displays the NCBI BLAST web site in the Web Explorer tab window. If a sequence in the sequence grid is selected prior to clicking this button, the Web Explorer will auto-fill the BLAST query window with the selected sequence data. This displays the default database (GenBank) in the Web Explorer tab window. This activates the Open Trace File dialog window, which may be used to open and view a sequencer file. The sequence data from the sequencer file then can be sent into Alignment Explorer. Alignment Functions This displays the ClustalW parameters dialog window, which is used to configure ClustalW and initiate the alignment of the selected sequence data. If you do not select sequence data prior to clicking this button, a message box will appear asking if you would like to select all of the currently loaded sequences. This marks or unmarks the currently selected single site in the alignment grid. Each sequence in the alignment may have only one site marked at a time. Modifications can be made to the alignment by marking two or more sites and then aligning them using the Align Marked Sites function. This button aligns marked sites. Two or more sites must be marked in order for this function to have an effect. Search Functions This activates the Find Motif search box. When this box appears, it asks you to enter a motif sequence (a small subsequence of a larger sequence) as the search term. After the search term is
176
entered, the Alignment Builder finds each occurrence of the search term and indicates it with yellow highlighting. For example, if you were to enter the motif "AGA" as the search term, then each occurrence of "AGA" across all sequences in the sequence grid would be highlighted in yellow. This searches towards the beginning of the current sequence for the first occurrence of the motif search term. If no motif search has been performed prior to clicking this button, the Find Motif search box will appear. This searches towards the end of the current sequence for the first occurrence of the motif search term. If no motif search has been performed prior to clicking this button, the Find Motif search box will appear. This locates the marked site in the current sequence. If no site has been marked, a warning box will appear. Editing Functions This undoes the last Alignment Builder action. This copies the current selection to the clipboard. It may be used to copy a single base, a block of bases, or entire sequences to the clipboard. This removes the current selection from the Alignment Builder and sends it to the clipboard. This function can affect a single base, a block of bases, or entire sequences. This pastes the contents of the clipboard into the Alignment Builder. If the clipboard contains a block of bases, it will be pasted into the builder starting at the point of the current selection. If the clipboard contains complete sequences they will be added to the current alignment. For example, if the contents of a FASTA file were copied to the clipboard from a web browser, it would be pasted into Alignment Builder as a new sequence in the alignment. This deletes a block of selected bases from the alignment grid. This deletes gap-only sites (sites containing a gap across all sequences in the alignment grid) from a selected block of bases. Sequence Data Insertion Functions This creates a new, empty sequence row in the alignment grid. A label and sequence data must be provided for this new row. This activates an Open File dialog box that allows for the selection of a sequence data file. Once a suitable sequence data file is selected, its contents will be imported into Alignment Builder as new sequence rows in the alignment grid. Site Number display on the status bar Site # The Site # field indicates the site represented by the current
177
selection. If the w/o Gaps radio button is selected, then the Alignment Builder will disregard the shifting affect of gaps when determining gap sites. If a block of sites are selected, then this field will contain the site # for the first site in the block. If an entire sequence is selected this field will contain the site # for the last site in the sequence.
Search Menu (in Alignment Explorer) This menu allows searching for sequence motifs and marked sites. The commands in this menu are: Find Motif: This activates the Find Motif search box. When this box appears, it asks you to enter a motif sequence (a small subsequence of a larger sequence) as the search term. After you enter the search term, the Alignment Explorer finds each occurrence of it and indicates it with yellow highlighting. For example, if you enter the motif "AGA" as the search term, then each occurrence of "AGA" across all sequences in the sequence grid would be highlighted in yellow. Find Next: This searches for the first occurrence of the motif search term towards the end of the current sequence. If no motif search has been performed prior to clicking this button, the Find Motif search box will appear. Find Previous: this search towards the beginning of the current sequence for the first occurrence of the motif search term. If no motif search has been performed prior to clicking this button, the Find Motif search box will appear. Find Marked Site: This locates the marked site in the current sequence. If no site has been marked for this sequence, a warning box will appear. Highlight Motif: If this item is checked, then all occurrences of the text search term (motif) are highlighted in the alignment grid.
Sequencer Menu (in Alignment Explorer) Edit Sequencer File: This item displays the Open File dialog box used to open a sequencer data file. Once opened, the sequencer data file is displayed in the Trace Data File Viewer/Editor. This editor allows you to view and edit trace data produced by the automated DNA sequencer. It reads and edits data in ABI and Staden file formats and the sequences displayed can be added directly into the Alignment Explorer or send to the Web Browser for conducting BLAST searches. Web Menu (in Alignment Explorer) This menu provides access to commands for querying GenBank and doing a BLAST search, as well as access to the MEGA web Browser. The commands in this menu are: Query Gene Banks: This item starts the Web Browser and accesses the NCBI home page (http://www.ncbi.nlm.nih.gov).
178
Do BLAST Search: This item starts the Web Browser and accesses the NCBI BLAST query page. If you select a sequence in the alignment grid prior to selecting this item, the web browser will automatically copy the selected sequence data into the search field. Show Browser: This item will show the Web Browser.
179
8.1.3 Get more information about the codon based Z-test for selection
The codon based Z-test for selection can be done in two places. First, you can use the Tests | Codon Based tests of selection | Z-test (large sample) option to find the probability that the null hypothesis will be rejected, in addition to the actual value of the Z-statistic. Alternatively, if you want to know the difference between s and n (synonymous and non-synonymous substitutions and their variance, you can go to the Distances | Pair-wise menu option and in the distance computation dialog, select an appropriate method (e.g., Nei-Gojobori method) and then choose s-n (or n-s depending on your need) from the Substitutions to include menu. Also, you can choose to compute standard error.
8.1.4 Menus in MEGA are so short; where are all the options?
Our aim in developing the objectively driven user-interface of MEGA has been a clutterfree work environment that asks the user for information on a need-to-know basis Although this modular analytical tool looks simple, behind each menu item is a wide range of useful options and tools that come with enhancements that are designed to reduce the amount of time needed for mundane non-technical tasks. Consider, for example, the Sequence Data Explorer. This unique module is hidden away when you don't want it but is always working behind the scenes. It allows you to view the data in various ways, export data subsets, and compute many important basic statistical quantities. Another interesting module is the Genetic Code selector, which allows you to choose the depth at which you wish to work with a code table. With it you can select a desired code table, add new data to and edit the existing code table, view the selected code table in a conventional format, compute the degeneracy for each site in every codon, and compute the number of potentially synonymous and non-synonymous sites
181
for each codon. In addition, you can always find help by checking the help index.
182
Appendix
Toolbar This contains shortcuts to some frequently used menu commands, such as those in the Data menu. Data Description window This displays a summary of the currently active data set.
File Data
183
Open Data
File | Open Data Choose this command to load a data file for analysis. A dialog box will appear to allow you to give the data file name. MEGA will first read the data file to check if it contains the Format command (see MEGA format), which specifies certain attributes of the input data (e.g., type of data). If MEGA does not find sufficient information in the format command, it will request the necessary information through an Input Data Format dialog. If you attempt to open a dataset from a file and MEGA detects inconsistencies or errors in the format, it will open the file in the text editor, allowing you to make changes in the text file so that it conforms to the MEGA format. Once a data file is opened successfully, the Open Data command will be disabled, some of the files basic attributes will be displayed the bottom of the main window. To enable the Open Data command, close the currently active data using the File | Close Data command. Open dialog box Use the open dialog box to load new data into MEGA for analysis. Property Look In Files Description Lists the current directory. Use the drop-down list to select a different drive or directory. Displays all files in the current directory matching the wildcards given in File Name or the file type in Files Of Type. You can display a list of files (default) or you can show details for each file. Enter the data file name you want to load or type in the wildcards to use as filters. Choose the type of data file you want to open. At present MEGA allows you to load in MEGA format files only, which should usually have the .MEG extension. Click this button to move you directory level up from the current directory. Click this button to create a new subdirectory in the current directory. Click this button to view a list of files and directories in the current directory. Click this button to view a list of files and directories along with time stamp, size, and attribute information.
184
Appendix
Open Data
File | Open Data Choose this command to load a data file for analysis. A dialog box will appear to allow you to give the data file name. MEGA will first read the data file to check if it contains the Format command (see MEGA format), which specifies certain attributes of the input data (e.g., type of data). If MEGA does not find sufficient information in the format command, it will request the necessary information through an Input Data Format dialog. If you attempt to open a dataset from a file and MEGA detects inconsistencies or errors in the format, it will open the file in the text editor, allowing you to make changes in the text file so that it conforms to the MEGA format. Once a data file is opened successfully, the Open Data command will be disabled, some of the files basic attributes will be displayed the bottom of the main window. To enable the Open Data command, close the currently active data using the File | Close Data command. Open dialog box Use the open dialog box to load new data into MEGA for analysis. Property Look In Files Description Lists the current directory. Use the drop-down list to select a different drive or directory. Displays all files in the current directory matching the wildcards given in File Name or the file type in Files Of Type. You can display a list of files (default) or you can show details for each file. Enter the data file name you want to load or type in the wildcards to use as filters. Choose the type of data file you want to open. At present MEGA allows you to load in MEGA format files only, which should usually have the .MEG extension. Click this button to move you directory level up from the current directory. Click this button to create a new subdirectory in the current directory. Click this button to view a list of files and directories in the current directory. Click this button to view a list of files and directories along with time stamp, size, and attribute information.
Reopen Data
File | Reopen Data This reopens a recently closed data file from the submenu, which shows the names of the five most recently used data files.
185
Open Data
File | Open Data Choose this command to load a data file for analysis. A dialog box will appear to allow you to give the data file name. MEGA will first read the data file to check if it contains the Format command (see MEGA format), which specifies certain attributes of the input data (e.g., type of data). If MEGA does not find sufficient information in the format command, it will request the necessary information through an Input Data Format dialog. If you attempt to open a dataset from a file and MEGA detects inconsistencies or errors in the format, it will open the file in the text editor, allowing you to make changes in the text file so that it conforms to the MEGA format. Once a data file is opened successfully, the Open Data command will be disabled, some of the files basic attributes will be displayed the bottom of the main window. To enable the Open Data command, close the currently active data using the File | Close Data command. Open dialog box Use the open dialog box to load new data into MEGA for analysis. Property Look In Files Description Lists the current directory. Use the drop-down list to select a different drive or directory. Displays all files in the current directory matching the wildcards given in File Name or the file type in Files Of Type. You can display a list of files (default) or you can show details for each file. Enter the data file name you want to load or type in the wildcards to use as filters. Choose the type of data file you want to open. At present MEGA allows you to load in MEGA format files only, which should usually have the .MEG extension. Click this button to move you directory level up from the current directory. Click this button to create a new subdirectory in the current directory. Click this button to view a list of files and directories in the current directory. Click this button to view a list of files and directories along with time stamp, size, and attribute information.
Exit
File | Exit This command closes the currently active data file and all other windows. If you want to save changes to the data set displayed on the screen, before issuing this command you must choose File | Export Data and Print or Save. Note that MEGA does not
186
Appendix
automatically save changes made to active data to the original data file.
Printer Setup
File | Printer Setup Choose this command to change the properties of your printer.
Toolbar This contains shortcuts to some frequently used menu commands, such as those in the Data menu. Data Description window This displays a summary of the currently active data set.
Data Menu
187
Data Menu
This allows you to explore the active data set, and establish various data attributes, and data subset options.
Data Explorer
Data | Data Explorer Data Explorers used to view the currently active data set, calculate its basic statistical attributes, export it in formats compatible with other programs, and define subsets for analysis. Depending on the currently active data type, one of the following explorers will be available: Data Type DNA, RNA, Protein sequences Evolutionary divergence Explorer Sequence Data Explorer Distance Data Explorer
188
Appendix
Middle Command Panel: This resides between the above-mentioned two sub-windows and contains a splitter on its right edge. You can grab the splitter and move it to change the proportion of the space taken by the two sub-windows. In this panel left and right arrow buttons are used to add or remove taxa from the groups. Clicking the hand-witha-pencil icon with a highlighted taxon or group name will allow you to edit that name. Lower Command Panel: In the lower part of the Select/Edit Taxa/Groups window are buttons that are used to add and/or delete groups. The + and buttons are also present on the middle command panel. Buttons Add Delete Description Creates a new group. Deletes the currently selected group. Any taxa that were assigned to the group will become freestanding. Makes all the taxa in the selected group freestanding, but does not remove the group from the list. Closes the dialog box. Brings up help regarding the dialog box.
How to perform functions: Function Creating a new group Deleting a group Description Click on the Add button. Click on the highlighted name of the group and type in a new name. Select the group and click the Delete button. Any taxa that were assigned to this group will become freestanding. Drag-and-drop the taxon on the desired group or select one or more taxa in the Ungrouped Taxa window and click on the left arrow button on the middle command panel. Click on the taxon and drag-and-drop it into a group (or outside all groups). Or, select the taxon and click on the right arrow button on the middle command panel. Click the checkbox next to the group or taxa name.
189
Use this menu item to specify the codon positions you would like to include in the nucleotide sequence analysis. You can include any combination of 1st, 2nd, 3rd positions and non-coding sites. The specified options are used only if you conduct a nucleotideby-nucleotide site analysis. If relevant, you will be given this choice in the dialog box that appears in response to a requested analysis (e.g., distance computation or phylogenetic reconstruction). Thus, you have the flexibility to select or change appropriate options at the time of the analysis.
190
Appendix
present on the middle command panel. Buttons Add Delete Ungroup Close Help Description Creates a new group. Deletes the currently selected group. Any taxa that were assigned to the group will become freestanding. Makes all the taxa in the selected group freestanding, but does not remove the group from the list. Closes the dialog box. Brings up help regarding the dialog box.
How to perform functions: Function Creating a new group Deleting a group Adding taxa to a group Removing a taxon from a group Include/Exclude taxa or groups Description Click on the Add button. Click on the highlighted name of the group and type in a new name. Select the group and click the Delete button. Any taxa that were assigned to this group will become freestanding. Drag-and-drop the taxon on the desired group or select one or more taxa in the Ungrouped Taxa window and click on the left arrow button on the middle command panel. Click on the taxon and drag-and-drop it into a group (or outside all groups). Or, select the taxon and click on the right arrow button on the middle command panel. Click the checkbox next to the group or taxa name.
Select Preferences
Data | Select Preferences This submenu specifies (1) how the alignment gaps and missing data will be handled, (2) which codon positions will be used, and (3) whether to restrict the analysis to the sites with selected labels. One or more of these options may be disabled depending on the attributes of the data set. For instance, the selection of codon positions is not valid
191
when amino acid sequence data is being analyzed. These options also are available in the Options dialog box that appears in response to a requested analysis (e.g., distance computation or phylogenetic reconstruction). Thus, you have the flexibility to select and change appropriate options at the time of the analysis.
Distances Menu
Use this menu to compute: pair-wise and average distances between sequences; within, between, and net average distances among groups; and sequence diversity statistics for data from multiple populations.
Choose Model
Distances | Choose Model Choose this to select a specific model of change for computing distances. The model also can be chosen or changed in the dialog box that appears when you request an analysis, such as distance computation or phylogenetic reconstruction.
Compute Pair-wise
Distances | Compute Pair-wise Choose this to compute the distances and standard errors between pairs of taxa. A Select Distance Options dialog, in which you can choose the desired distance estimation method and other relevant options, will appear.
192
Appendix
and subpopulation diversities that are useful in molecular population genetics studies. First, you define a group, using a population of sequences. Unlike the generic averages of within group, between group, and net between group distances calculated using other commands in the Distances menu, formulas used in the following commands are those used specifically in population genetics analyses. The commands are: Mean Diversity within Subpopulations In a subpopulation, the mean diversity is defined as where is the frequency of i-th sequence in the sample from subpopulation i, and q is the number of different sequences in this subpopulation. Mean Diversity for Entire Population For the entire population, the mean diversity is defined as , where is the estimate of average frequency of the i-th allele in the entire population, and q is the number of different sequences in the entire sample. Mean Interpopulational Diversity The estimate of inter-populational diversity is given by . Coefficient of Differentiation The estimate of the proportion of interpopulational diversity is given by .
Phylogeny Menu
193
Phylogeny Menu
Use the Phylogeny menu to construct phylogenetic trees, infer their reliability using the bootstrap and interior branch tests, conduct molecular clock tests, and view previously constructed trees.
194
Appendix
the display of Newick format trees containing branch lengths as well as bootstrap or other counts (note that the Newick formats do not contain the total number of bootstrap replications conducted).
Construct Phylogeny Neighbor-Joining (NJ) Method This method (Saitou and Nei 1987) is a simplified version of the minimum evolution (ME) method (Rzhetsky and Nei 1992). The ME method uses distance measures that correct for multiple hits at the same sites; it chooses a topology showing the smallest value of the sum of all branches (S) as an estimate of the correct tree. However, construction of an ME tree is time-consuming because, in principle, the S values for all topologies must be evaluated. Because the number of possible topologies (unrooted trees) rapidly increases with the number of taxa, it becomes very difficult to examine all topologies. In the case of the NJ method, the S value is not computed for all or many topologies, but the examination of different topologies is embedded in the algorithm, so that only one final tree is produced. The algorithm of the NJ method is somewhat complicated and is explained in detail in Nei and Kumar (2000, page 103). The NJ method produces an unrooted tree because it does not require the assumption of a constant rate of evolution. Finding the root requires an outgroup taxon. In the absence of outgroup taxa, the root is sometimes given at the midpoint of the longest distance connecting two taxa in the tree, which is
195
Maximum Parsimony (MP) Method Maximum parsimony (MP) methods originally were developed for morphological characters, and there are many different versions (see Nei and Kumar [2000] for a review). In MEGA, we consider both of these methods for nucleotide and amino acid sequence data (Eck and Dayhoff 1966; Fitch 1971).
For constructing an MP tree, only sites at which there are at least two different kinds of nucleotides or amino acids, each represented at least twice, are used (parsimonyinformative sites). Other variable sites are not used for constructing an MP tree, although they are informative for distance and maximum-likelihood methods.
MEGA estimates MP tree branch lengths by using the average pathway method for unrooted trees (see Nei and Kumar [2000], page 132). To search for MP Trees, MEGA provides three different types of searches: the max-mini branch-and-bound search, min-mini heuristic search, and closeneighbor-interchange heuristic search. Only the branch-and-bound search is guaranteed to find all the MP trees, but it takes prohibitive amount of time if the number of sequences is large (>15). For details, please see chapter 7 in Nei and Kumar (2000) UPGMA This method assumes that the rate of nucleotide or amino acid substitution is the same for all evolutionary lineages. An interesting aspect of this method is that it produces a tree that mimics a species tree, with the branch lengths for two OTUs
196
Appendix
being the same after their separation. Because of the assumption of a constant rate of evolution, this method produces a rooted tree, though it is possible to remove the root for certain purposes. The algorithm for UPGMA is discussed in detail in Nei and Kumar (2000, page 87). Selection Menu Tajima's Test of Neutrality
Selection | Tajimas Test of Neutrality This conducts Tajimas test of neutrality (Tajima 1989), which compares the number of segregating sites per site with the nucleotide diversity. (A site is considered segregating if, in a comparison of m sequences, there are two or more nucleotides at that site; nucleotide diversity is defined as the average number of nucleotide differences per site between two sequences). If all the alleles are selectively neutral, then the product 4Nv (where N is the effective population size and v is the mutation rate per site) can be estimated in two ways, and the difference in the estimate obtained provides an indication of non-neutral evolution. Please see Nei and Kumar (2000) (page 260-261) for further description.
For data sets containing more than two sequences, you can compute the average number of synonymous substitutions and the average number of non-synonymous substitutions to conduct a Z-test in a manner similar to the one mentioned above. The variance of the difference between these two quantities is estimated by the bootstrap method (See Nei and Kumar (2000) page 55). 197
Alignment Explorer/CLUSTAL
Alignment | Alignment Explorer/CLUSTAL This option displays the Alignment Explorer, which can be used to view and build DNA and protein sequence alignments and to explore the web based databases (e.g., NCBI Query and BLAST searches) in the MEGA environment.
Query Databanks
Alignment | Query Databanks Use this to open the MEGA web-browser to search the NCBI and other web sites for sequence data.
Help Menu
198
Appendix
Help Menu
This menu provides access to the help index as well as the About dialog box, which provides version information for MEGA.
Index
Help | Index This command provides access to the help file index and keyword searching facilities.
About
Help | About This command will display the About dialog box showing the copyright, authors, and version information for MEGA.
For Pair-wise Distance Data Missing Data Character used to show missing data in the data file; it should be set to a question mark (?). Matrix Format Choose the lower-left or upper-right distance matrix for the pair-wise distance data type.
Note: To avoid having to answer these questions every time you read your data file,
199
200
Appendix
Description Click on the Add button. Click on the highlighted name of the group and type in a new name. Select the group and click the Delete button. Any taxa that were assigned to this group will become freestanding. Drag-and-drop the taxon on the desired group or select one or more taxa in the Ungrouped Taxa window and click on the left arrow button on the middle command panel. Click on the taxon and drag-and-drop it into a group (or outside all groups). Or, select the taxon and click on the right arrow button on the middle command panel. Click the checkbox next to the group or taxa name.
201
domains contained in them. The MEGA gene and domain organizer is flexible and is designed to enable you to specify genes and domains as they appear in a genome. For instance, a sequence may contain one or more genes, each of which may contain one or more domains. In between genes, there may be inter-genetic domains. In addition, within or between genes or domains, there may be sites that are not members of any domain. At the bottom of this tab, you will find a toolbar with many drop-down menu buttons, which can be used to Add/Insert new genes or domains. The add and insert operations differ in the following way. If you add a gene or domain, then the new gene or domain will be added at the end of the list to which the currently focused gene or domain belongs. If you insert a gene (or domain), it will be inserted by shifting all the following genes or domains down. Add and Insert commands are context sensitive. You can rearrange the relative position of genes and domains by drag-and-drop operations.
202
Appendix
the third codon position. Site Labels Tab This tab displays sequences and allows you to label individual sites. To do this, change the default underscore (_) in the topmost line to the label of choice and give it a light green background. The site number will be displayed below in a window, next to which is shown the name of the domain, along with gene, name. Labeled sites can be selected or deselected for analysis. To change or give a label to a site, click on the site and type in the character you wish to mark it with. You can use the left and right arrow buttons on the keyboard to move to and then label adjacent sites. To change a label, simply overtype it. To remove a label, use the spacebar to type a space. Example Imagine an alignment consisting of a genomic sequence, including a gene and its upstream and downstream regions. You can define each intron and exon as a domain, and then define the overall gene, assigning the exons and introns to that gene. The upstream and downstream regions also can be defined as domains, or possibly multiple domains, depending on the analysis you wish to perform. These domains do not have to be assigned to any gene. Furthermore, some sites may be left unassigned, as independent sites. These can be scattered throughout the sequence and can be included or excluded from analysis as a group. If you have a complicated patterns of sites you wish to analyze as groups, and the domain gene approach is unsuitable, you should assign a category to these sites, which can be specified in addition to the groups and domains.
203
204
Appendix
205
206
Appendix
207
8.4.2 Alignment Gaps Phylogenetic analysis on two or more DNA or amino acid sequences requires that the sequences be aligned so that the substitutions can be accurately enumerated. During alignment, gaps must be introduced in sequences that have undergone deletions or insertions. These gaps are known as alignment gaps or indels. 8.4.3 Alignment session When working in MEGAs Alignment Explorer you can choose to save the current state of all data and settings in the alignment explorer to a file so you can archive your work, or save it to resume editing in the future. An alignment session is a binary file format that is saved with the .MAS file extension.
8.4.4 Bifurcating Tree A bifurcating tree is one in which each ancestral lineage gives rise to exactly two descendent lineages. A tree with only bifurcating nodes is called a bifurcating tree. 8.4.5 Branch A branch is a line connecting either two internal nodes to each other or an external node to an internal node in a phylogenetic tree. The length of a branch denotes the genetic distance (e.g., number of substitutions per unit time) between the two taxa it connects. Branch-and-Bound algorithm The branch-and-bound algorithm is used to find all the MP trees. It guarantees to find all the MP trees without conducting an exhaustive search. MEGA also employs the Max-mini branch-and-bound search, which is described in detail in Kumar et al. (1993) and Nei and Kumar (2000, page 123).
208
Appendix
Close-Neighbor-Interchange (CNI) In any method, examining all possible topologies is very time consuming. This algorithm reduces the time spent searching by first producing a temporary tree, (e.g., an NJ tree when an ME tree is being sought), and then examining all of the topologies that are different from this temporary tree by a topological distance of dT = 2 and 4. If this is repeated many times, and all the topologies previously examined are avoided, one can usually obtain the tree being sought. For the MP method, the CNI search can start with a tree generated by the random addition of sequences. This process can be repeated multiple times to find the MP tree. See Nei & Kumar (2000) for details. 8.4.6 ClustalW ClustalW is a general purpose multiple sequence alignment program for DNA or proteins. You can learn more about ClustalW by visiting its website (http://www.ebi.ac.uk/clustalw/). 8.4.7 Codon A codon is triplet of nucleotides that codes for a specific amino acid. 8.4.8 Codon Usage
3 There are 64 (4 ) possible codons that code for 20 amino acids (and stop signals) so one amino acid may be encoded by several codons (e.g., serine is encoded by six codons in nuclear genes). It is therefore interesting to know the codon usage for each amino acid. In MEGA, the numbers of the 64 codons used in a gene can be computed either for one specific sequence or for all examined sequences. In addition to the codon frequencies, MEGA also writes the Sharp et al. (1986) relative synonymous codon usage (RSCU) statistic (see Nei and Kumar 2000, page 11).
8.4.9 Complete-Deletion Option In the complete-deletion option, sites containing missing data or alignment gaps are removed before the analysis begins. This is in contrast to the pair-wisedeletion option in which sites are removed during the analysis as the need arises (e.g., pair-wise distance computation). 8.4.10 Composition Distance Composition distance is a measure of the difference in nucleotide (or amino acid) composition for a given pair of sequences. It is one half the sum of squared difference in counts of bases (or residues). MEGA 4 computes and presents the Composition Distance per site, which is given by the total composition distance
209
between two sequences divided by the number of positions compared, excluding gaps and missing data.
8.4.11 Compress/Uncompress This command changes the cursor to the 'Compress/Uncompress' icon. If you click on an interior branch, MEGA will prompt you to give a name to the group that will be formed. It then will compress all the lineages defined by this branch into a solid elongated triangle whose thickness is proportional to the number of taxa condensed. Clicking on the branch again will uncompress it. The cursor may be reverted to the arrow by clicking on the arrow icon on the left hand side of the Tree Explorer. 8.4.12 Condensed Tree When interior branches in a phylogenetic tree do not have statistically significant lengths, choosing this command condenses the tree into a topology in which each branch with less than the desired statistical significance is collapsed. Consensus Tree The MP method produces many equally parsimonious trees. Choosing this command produces a composite tree that is a consensus among all such trees, for example, either as a strict consensus, in which all conflicting branching patterns among the trees are resolved by making those nodes multifurcating or as a Majority-Rule consensus, in which conflicting branching patterns are resolved by selecting the pattern seen in more than 50% of the trees. (Details are given in Nei and Kumar [2000], page 130). 8.4.13 Constant Site A site containing the same nucleotide or amino acid in all sequences is referred to as a constant site. MEGA identifies a site as a constant site only if at least two sequences contain unambiguous nucleotides or amino acids. 8.4.14 Degeneracy 0-fold degenerate sites are those at which all changes are non-synonymous. 2-fold degenerate sites are those at which one out of three changes is synonymous. (All sites at which two out of three changes are synonymous also are included in this category.) 4-fold degenerate sites are those at which all changes are synonymous. 8.4.15 Disparity Index Disparity Index measures the observed difference in substitution patterns for a 210
Appendix
pair of sequences. It works by comparing the nucleotide (or amino acid) frequencies in given pair of sequences and using the number of observed differences between sequences. MEGA 4 computes and presents the Disparity Index per site, which is given by the total disparity index between two sequences divided by the number of positions compared, excluding gaps and missing data. It is more powerful than a chi-square test of the equality of base frequencies between sequences.
8.4.16 Domains A domain is a continuous block of sites in a sequence alignment. A domain can be free-standing or assigned to genes and protein-coding (e.g., exons) or noncoding (e.g., introns). Domains can be defined in the input data, and can be defined and edited in the Setup Genes Domains dialog. 8.4.17 Exon A protein-coding gene typically consists of multiple coding regions, known as exons, interspersed with non-coding DNA (introns) 8.4.18 Extant Taxa The taxa whose sequences, other genetic information or morphological characters, etc. are being used for a phylogenetic analysis are known as extant taxa, irrespective of whether the individuals or species to which the sequences and other information belong are extant or extinct. 8.4.19 Flip This command changes the cursor to the 'Flip' icon. Then, if you click on an interior branch, MEGA reverses the order of the lineages defined by this branch. The cursor will revert to the arrow if you click on the arrow icon on the left hand side of the Tree Explorer. 8.4.20 Format command A format command in a data file begins with! Format and contains at least the data type included in the file. 8.4.21 Gamma parameter According to the gamma distribution, the substitution rate often varies from site to site within a sequence. The shape of this distribution is determined by a value known as the gamma parameter, which is also known as the shape parameter.
211
8.4.22 Gene A gene is a collection of domains. The domains included in a gene need not be consecutive or of the same type. Genes and domains can be defined in the input data, and can be defined and edited in the Setup Genes and Domains dialog. Genes can be selected or unselected from an analysis. When a gene is unselected, all its domains are automatically unselected. However, a gene can be selected, with some of its domains unselected. 8.4.23 Groups of taxa A group of taxa is a set of one or more taxa. Members of a group can be specified in the input data file, and created and edited in the Setup Taxa and Groups dialog. Groups of taxa often are constructed based on their evolutionary relatedness. For example, sequences may be grouped based on the geographic origin of the source individual, or sequences from a multi-gene family may be arranged into groups consisting of orthologous sequences. 8.4.24 Indels Phylogenetic analysis on two or more DNA or amino acid sequences requires that the sequences be aligned so that the substitutions can be accurately enumerated. During the alignment, gaps must be introduced in sequences that have undergone deletions or insertions. These gaps are known as alignment gaps, or indels. 8.4.25 Independent Sites In a sequence alignment, all sites that have not been assigned to any gene or domain are classified as independent. 8.4.26 Intron Introns are the non-coding segments of DNA in a gene that are interspersed among the exons. Labeled Sites Sites in a sequence alignment can be categorized and labeled with user-defined symbols. Each category is represented by a letter or a number. Each site can be assigned to only one category, although any combination of categories can be selected for analysis. Labeled sites work independently of and in addition to genes and domains, thus allowing complex subsets of sites to be defined easily.
212
Appendix
8.4.27 Maximum Composite Likelihood In general, a composite likelihood is defined as a sum of log-likelihoods for related estimates. In MEGA4, the maximum composite likelihood is used for describing the sum of log-likelihoods for all pair-wise distances in a distance matrix (Tamura et al. 2004) estimated by using the Tamura-Nei (1993) model (see related Tamura-Nei distance). Further information is in the Maximum Composite Likelihood Method. 8.4.28 Max-mini branch-and-bound search This is an algorithm for searching for the MP tree using the branch-and bound search method. See Nei & Kumar (2000) for details. 8.4.29 Maximum Parsimony Principle For any given topology, the sum of the minimum possible substitutions over all sites is known as the tree length for that topology. The topology with the minimum tree length is known as the Maximum Parsimony tree. 8.4.30 Mid-point rooting In the mid-point rooting method, the root of an unrooted tree is placed at the midpoint of the longest distance between two taxa in a tree. Min-mini algorithm This is a heuristic search algorithm for finding the MP tree, and is somewhat similar to the branch-and bound search method. However, in this algorithm, many trees that are unlikely to have a small local tree length are eliminated from the computation of their L values. Thus while the algorithm speeds up the search for the MP tree, as compared to the branch-and-bound search, the final tree or trees may not be the true MP tree(s). The user can specify a search factor to control the extensiveness of the search and MEGA adds the user specified search factor to the current local upper bound. Of course, the larger the search factor, the slower the search, since many more trees will be examined. (See also Nei & Kumar (2000), pages 122, 125) 8.4.31 Monophyletic A cluster of taxa that shared a common ancestor comparatively recently in the evolutionary history of a phylogenetic tree is monophyletic. The term reflects the close relationship of the taxa with each other. 8.4.32 mRNA Protein-coding genes are first transcribed into messenger RNAs (mRNA), which 213
are, in turn, translated into amino acid sequences to make proteins. 8.4.33 NCBI An acronym that stands for "National Center for Biotechnology Information". NCBI is a federally funded resource for molecular biology information. NCBI creates databases, conducts research in computational biology, develops software and tools for analyzing genome data, and disseminates biomedical information. You can find out more about NCBI by visiting the NCBI website (http://www.ncbi.nlm.nih.gov).
8.4.34 Newick Format NEWICK is a simple format used to write out trees in a text file. While this is a hard-to-read format for humans, it is very useful for exchanging trees between different types of software. An example of the contents of a NEWICK format tree file is given below (note that semi-colon is needed to end the tree). Further information on this format can be found at Joe Felsensteins website.
((raccoon, bear),((sea_lion,seal),((monkey,cat), weasel)),dog); The above tree with branch lengths will look as follows: ((raccoon:19.19959,bear:6.80041):0.84600,((sea_lion:11.99700, seal:12.00300):7.52973,((monkey:100.85930,cat:47.14069):20.59201, weasel:18.87953):2.09460):3.87382,dog:25.46154); If you wish to specify bootstrap values then they could appear before the branch lengths (e.g., in .DND files produced by CLUSTAL) or after the branch lengths (e.g., in .PHB files produced by CLUSTAL). In these cases, the format might look like: ((raccoon:19.19959,bear:6.80041)50:0.84600,((sea_lion:11.99700, seal:12.00300)100:7.52973,((monkey:100.85930,cat:47.14069)80:20.59201, weasel:18.87953)75:2.09460)50:3.87382,dog:25.46154); or ((raccoon:19.19959,bear:6.80041):0.84600[50],((sea_lion:11.99700, seal:12.00300):7.52973[100],((monkey:100.85930,cat:47.14069):20.59201[8 0], weasel:18.87953):2.09460[75]):3.87382[50],dog:25.46154);
8.4.35 Node A node in a phylogenetic tree represents a taxon, the external or terminal nodes represent the extant taxa and the internal nodes represent the ancestral taxa. 8.4.36 Non-synonymous change A nucleotide change is non-synonymous if it changes the amino acid encoded by the original codon. A nucleotide site in which one or more changes are nonsynonymous is referred to as a non-synonymous site. If only one of three possible nucleotide changes at that site is non-synonymous, then the site is 1/3 214
Appendix
non-synonymous. If two of three nucleotide changes are non-synonymous, then the site is 2/3 non-synonymous. And, if all three possible nucleotide changes are non-synonymous, then the site is completely non-synonymous. 8.4.37 Nucleotide Pair Frequencies
When two nucleotide sequences are compared, the frequencies of 10 or 16 different types of nucleotide pairs can be computed. In MEGA, these frequencies are presented in a text file.
8.4.38 OLS branch length estimates The ordinary least squares estimate of a branch length (b) is given by where dij is the pair-wise distance between sequences i and j. The coefficients wijs depend on whether the branch under consideration is internal or external. Coefficients wijs for an internal branch
where, mA, mB, mC, and mC are the numbers of sequences in clusters A, B, C, and D, respectively. Coefficients wijs for an external branch
where, mA and mB are the numbers of sequences in clusters A and B. 8.4.39 Orthologous Genes Two genes are said to be orthologous if they are the result of a speciation event. 8.4.40 Out-group An out-group is a sequence (or set of sequences) that is known to be a sister taxa to all other sequences in the dataset. 215
8.4.41 Pair-wise-deletion option In the pair-wise-deletion option, sites containing missing data or alignment gaps are removed from the analysis as the need arises (e.g., pair-wise distance computation). This is in contrast to the complete-deletion option in which all such sites are removed prior to the analysis. 8.4.42 Parsimony-informative site A site is parsimony-informative if it contains at least two types of nucleotides (or amino acids), and at least two of them occur with a minimum frequency of two. 8.4.43 Polypeptide A polypeptide is a chain of many amino acids. 8.4.44 Positive selection At the DNA sequence level, positive selection refers to selection in favor of nonsynonymous substitutions. In this case, the evolutionary distance based on nonsynonymous substitutions is expected to be greater than synonymous substitutions. 8.4.45 Protein parsimony A Maximum Parsimony analysis on protein sequences is known as protein parsimony. 8.4.46 Purifying selection Purifying selection refers to selection against non-synonymous substitutions at the DNA level. In this case, the evolutionary distance based on synonymous substitutions is expected to be greater than the distance based on nonsynonymous substitutions. 8.4.47 Purines The nucleotides adenine (A) and guanine (G) are known as purines. 8.4.48 Pyrimidines The nucleotides cytosine (C) and thymine (T) are known as pyrimidines. 8.4.49 Random addition trees This refers to the generation of random initial trees for a heuristic search to find MP trees. In this case, a tree is generated by randomly selecting a sequence
216
Appendix
and adding it to the growing tree on a randomly-selected branch. 8.4.50 RSCU Many amino acids are coded by more than one codon; thus multiple codons for a given amino acid are synonymous. However, many genes display a non-random usage of synonymous codons for specific amino acids. A measure of the extent of this non-randomness is given by the Relative Synonymous Codon Usage (RSCU) (Sharp et al. 1986). The RSCU for a particular codon (i) is given by RSCUi = Xi / XI /n where Xi is the number of times the ith codon has been used for a given amino acid, and n is the number of synonymous codons for that amino acid. 8.4.51 Singleton Sites A singleton site contains at least two types of nucleotides (or amino acids) with, at most, one occurring multiple times. MEGA identifies a site as a singleton site if at least three sequences contain unambiguous nucleotides or amino acids. Site Label The individual sites in nucleotide or amino acid data can be labeled to construct non-contiguous sets of sites. The Setup Genes and Domains dialog can be used to assign or edit site labels, in addition to specifying them in the input data files. This is shown in the following example of three-sequences in which the sites in the Third Gene are labeled with a + mark. An underscore marks an absence of any labels.
!Gene=FirstGene Domain=Exon1 Property=Coding; #Human_{Mammal} ATGGTTTCTAGTCAGGTCACCATGATAGGTCTCAAT #Mouse_{Mammal} ATGGTTTCTAGTCAGGTCACCATGATAGGTCCCAAT #Chicken_{Aves} ATGGTTTCTAGTCAGCTCACCATGATAGGTCTCAAT !Gene=SecondGene Domain=AnIntron Property=Noncoding; #Human ATTCCCAGGGAATTCCCGGGGGGTTTAAGGCCCCTTTAAAGAAAGAT #Mouse GTAGCGCGCGTCGTCAGAGCTCCCAAGGGTAGCAGTCACAGAAAGAT #Chicken GTAAAAAAAAAAGTCAGAGCTCCCCCCAATATATATCACAGAAAGAT !Gene=ThirdGene Domain=Exon2 Property=Coding; #Human ATCTGCTCTCGAGTACTGATACAAATGACTTCTGCGTACAACTGA #Mouse ATCTGATCTCGTGTGCTGGTACGAATGATTTCTGCGTTCAACTGA #Chicken ATCTGCTCTCGAGTACTGCTACCAATGACTTCTGCGTACAACTGA !Label +++__-+++-a-+++-L-+++-k-+++123+++-_-+++---+++;
Each site can be associated with only one label. A label can be a letter or a number. For analyses that require codons, MEGA includes only those codons in which all three positions are given the same label. This site labeling system facilitates the 217
analysis of specific sites, as often is required for comparing sequences of regulatory elements, intron-splice sites, and antigen recognition sites in the genes of applications such as the Major Histocompatibility Complex. 8.4.52 Staden The Staden file format is used to store data from DNA sequencing instruments. Each file contains the data for a single reading and includes the called sequence as well as additional data obtained from the reading. This file format was first described in Dear, S and Staden, R. "A Standard file format for data from DNA sequencing instruments", DNA Sequence 3, 107-110, (1992) MEGA is able to display the contents of a Staden-formatted trace file using MEGAs Trace File Editor, which is part of the Alignment Explorer. 8.4.53 Statements in input files All statements in MEGA files start with an exclamation mark (!) and end with a semicolon (;). They are useful in specifying various attributes of the data and the data file. There are three common statements for all types of data: Title, Format, and Description. There also are other statements that can be used in MEGA files, depending on the type of data being analyzed. 8.4.54 Swap This command changes the cursor to the 'Flip' icon. Then, you click on an interior branch, MEGA swaps the two subtrees defined by this branch. If each of the subtrees is an individual taxon, then Swap is the same as Flip. The cursor will revert to the arrow if you click on the arrow icon on the left-hand side of the Tree Explorer. 8.4.55 Synonymous change A nucleotide change is synonymous if it does not cause the codon to code for a different amino acid. A nucleotide site in which one or more changes is synonymous is referred to as a synonymous site. If only one of three possible nucleotide changes at that site is synonymous, then the site is 1/3 synonymous. If two of three nucleotide changes are synonymous, then the site is 2/3 synonymous and 1/3 non-synonymous. And, if all three possible nucleotide changes are synonymous, then the site is completely synonymous. 8.4.56 Taxa A taxon is the individual unit whose evolutionary relationship is being investigated. Depending on the study, "taxa" may refer to species, populations, individuals, or sequences within an individual. 218
Appendix
8.4.57 Topological distance The topological distance quantifies the extent of topological differences between two given trees. For unrooted, bifurcating trees, this distance is twice the number of interior branches at which the taxa are partitioned differently. 8.4.58 Topology The branching pattern of a tree is its topology. 8.4.59 Transition A transition occurs when a purine is substituted by a purine, or a pyrimidine by a pyrimidine. 8.4.60 Transition Matrix A transition matrix specifies the probability of every possible substitution among the nucleotides or amino acids. 8.4.61 Transition/Transversion Ratio (R) This is the ratio of the number of transitions to the number of transversions for a pair of sequences. R becomes 0.5 when there is no bias towards either transitional or transversional substitution because, when the two kinds of substitution are equally probable, there are twice as many possible transversions as transitions. MEGA allows you to conduct an analysis of your data with a specified value of R. Note that R should not be confused with the ratio of the transition and transversion rates (k = /). 8.4.62 Translation Translation is the process whereby each codon in the mRNA is translated into a particular amino acid, according to the genetic code specific to the species and its DNA, and added to the growing polypeptide chain. 8.4.63 Transversion A change from a purine to a pyrimidine, or vice versa, is a transversion. 8.4.64 Unrooted tree An unrooted tree is one in which no assumption is made regarding the ancestor of all the taxa in the tree. 219
8.4.65 Variable site A variable site contains at least two types of nucleotides or amino acids. Some variable sites can be singleton or parsimony-informative. A site that is not variable is referred to as a constant site.
220
9 Index
0
0-fold site .................................................228 BCL ......................................................... 243 Between Groups ..................................... 257 Bidirectionally.......................... 145, 181, 289 Bifurcating Tree....................................... 400 Blank Names Are Not Permitted............. 372 BLAST Search .......................................... 64 Bootstrap method............................ 233, 245 compute standard error .................. 233, 245 Bootstrap Test................................. 244, 352 Bootstrap Test of Phylogeny........... 244, 352 Branch Length......................................... 304 Branch Line............................................. 304 Branch tab............................................... 304 Branch-and-bound .......................... 240, 358 Browse Databanks.................................. 363 Bugs.......................................................... 31 Reporting .................................................. 31 Built-in Genetic Codes ............................ 109
2
2-Dimensional Data Grid 115, 149, 255, 259 2-fold site .................................................228 2S-fold site...............................................228 2V-fold site...............................................228
4
4-fold site ........................ 225, 226, 228, 327
A
ABI File Format........................................397 About BLAST .............................................63 About CLUSTALW.....................................60 About dialog.....................................365, 367 Acknowledgements .....................................4 Add button ...............................................368 Add taxa...........................................368, 370 Add/Insert ................................................370 Add/Remove Programs ...............................9 Adding/Modifying Genetic Code Tables ..111 Alanine.......................................................84 Aligning coding sequences via protein sequences .........................................60, 310 Alignment Builder...............................57, 307 Alignment Explorer/CLUSTAL .................362 Alignment Gap ................ 238, 245, 247, 367 Alignment Menu.......................................361 Alignment Menu in Alignment Explorer ....67, 313 Alignment session....................................399 Amino Acid Compositions........147, 180, 291 Analysis Preferences..... 229, 233, 236, 240, 250, 252 Analysis Preferences dialog ....................177 Analysis Preferences/Options dialog.......177 Arrange Taxa ...........................................301 ASCII .................... 49, 77, 83, 154, 165, 173 editing ................................................49, 154 ASCII-text ..................................................77 Asparagine.................................................84 Aspartic Acid..............................................84 Assigning .................................................370 exons .......................................................370 Average Menu .................................153, 257
C
Categorize............................................... 151 taxa ......................................................... 151 Change Font ................................... 152, 258 Change Font dialog box.................. 131, 275 Change Font.Display ...................... 131, 275 Choose Model......................................... 345 Circle....................................................... 301 Citing MEGA in Publications....................... 6 Classroom................................................. 29 Clipboard......................................... 169, 170 Close Data .............................................. 331 Close-Neighbor-Interchange........... 242, 403 CLUSTAL.................................................. 94 ClustalW.................................................. 404 CLUSTALW Options DNA ........................ 61 CLUSTALW Options Protein .................... 62 CNI.................................................. 242, 403 Code Table ............................................. 112 Code Table Editor ................................... 115 Coding......................... 85, 87, 115, 259, 370 DNA ................................................ 115, 259 Codon .... 109, 112, 115, 123, 146, 179, 180, 182, 225, 229, 233, 236, 240, 250, 252, 259, 267, 290, 326, 327, 344, 370, 372, 406 find .......................................................... 115 inclusion/exclusion . 229, 233, 236, 240, 250, 252 position.................................................... 115 Codon based Z-test ................................ 325 Codon Usage .................. 146, 182, 290, 406 Color Cells ...................................... 127, 271 Column Sizer .................................. 149, 255
B
Basic Sequence Statistics .......................179
221
Molecular Evolutionary Genetics Analysis Command Statements...................86, 87, 92 Keywords ...................................................87 Writing............................................86, 87, 92 Common Features.....................................77 Common Sites .........................................387 Complete-Deletion ...................................245 Complex 2-fold sites ................................228 Composition Distance..............................408 Compute Between Groups Means ..........351 Compute Menu ........................................307 Compute Net Between Groups Means....350 Compute Overall Mean............................347 Compute Pair-wise ..................................346 Compute Sequence Diversity ..................349 Compute standard error ..................233, 245 Bootstrap method ............................233, 245 Compute Within Groups Mean ................348 Computing ...................... 112, 222, 228, 323 Statistical Attributes .................................112 statistics ...................................................323 Computing Statistical Quantities for Nucleotide Sequences...............................45 Computing the Gamma Parameter (a) ...195, 220 Condensed Trees ....................................243 Construct ........................ 233, 244, 357, 358 Constructing Trees and Selecting OTUs from Nucleotide Sequences ......................38 Constructing Trees from Distance Data ....47 Convert To MEGA Format Main File Menu ...................................................................96 Copy ........................................................170 Copyright .....................................................1 CPU .............................................................7 Create New Folder...................................328 Creating Multiple Sequence Alignments ..34, 58, 308 Curved .....................................................301 Cut ...........................................................169 Cutoff Values Tab ....................................299 Cysteine.....................................................84 Data Description Window ....................... 327 Data Explorer . 118, 262, 323, 329, 335, 368, 387 Data File Parsing Error ........................... 373 Data menu 32, 113, 117, 118, 120, 121, 122, 261, 262, 264, 265, 266, 329, 334, 341 Data Menu in Alignment Explorer ..... 70, 316 Data Type ....................................... 335, 367 Datafile...................................................... 80 DataFormat ............................................... 91 Dataset..... 91, 115, 119, 146, 180, 182, 259, 263, 290, 331, 380, 388, 389 DataType ...................................... 83, 85, 91 Dayhoff and JTT distances Gamma rates ................................................................ 221 Dayhoff distance ..................................... 222 Dayhoff Distance Could Not Be Computed ................................................................ 374 Dayhoff Model......................................... 220 Define/Edit/Select ................................... 370 Defining Genes ......................................... 86 Defining Groups .................................. 87, 92 DefiningTaxa............................... 89, 93, 336 Description Statement Rules .................... 82 Disclaimer ................................................... 2 Discrete-character................................... 233 Disparity Index ........................................ 414 Display | Color................................. 127, 271 Display | Restore Input Order ......... 125, 269 Display | Show ................................ 126, 270 Display | Show Group Names......... 130, 274 Display | Show Sequence Names .. 129, 273 Display | Sort Sequences....... 132, 133, 134, 135, 136, 276, 277, 278, 279, 280 Display | Use Identical Symbol ....... 128, 272 Display font ..................................... 131, 275 Display Menu .................. 124, 152, 258, 268 Display Menu in Alignment Explorer. 68, 314 Display Newick Trees from File ........ 94, 355 Display Saved Tree Session................... 354 Distance Computation ............................ 229 Distance Correction Failed ..................... 384 Distance Data Explorer.. 149, 151, 152, 153, 178, 255, 259 Distance Data Formats ............................. 90 Distance Data Subset Selection ............. 178 Distance Display Precision ............. 149, 255 Distance estimates.......................... 233, 245 Distance Matrix Dialog... 378, 383, 384, 391, 392, 393, 394, 395 Distance Matrix Explorer 153, 255, 257, 258, 259 Distance menu ................ 324, 327, 344, 349 Distance Model Options.......................... 232 Distance Options............................. 250, 252 Distances ........ 115, 119, 183, 259, 263, 325
D
Data .........................................367, 370, 386 Missing.............................................367, 386 Data | Data Explorer ................329, 331, 335 Data | Quit Data Viewer ...................124, 268 Data | Select Genetic Code Table ..113, 120, 264, 341 Data | Select Preferences339, 340, 343, 344 Data | Setup/Select Genes .....122, 175, 266, 337 Data | Setup/Select Taxa... 89, 93, 121, 265, 336 Data | Translate/Untranslate............119, 263 Data | Write Data .............................123, 267
222
Index Distances | Choose Model.......................345 Distances | Compute Between Groups Means.Choose.........................................351 Distances | Compute Net Between Groups Means.Choose.........................................350 Distances | Compute Overall Mean.........347 Distances | Compute Pair-wise ...............346 Distances | Compute Sequence Diversity .................................................................349 Distances | Compute Within Groups Means.Choose.........................................348 Distances Display Box.............................154 Distances Menu .......................................344 Divergence Time..............................297, 306 Divergence Time Dialog Box ...................300 DNA ..... 77, 85, 94, 115, 124, 127, 180, 233, 245, 259, 268, 271, 335 coding ..............................................115, 259 reading data from other formats ................94 DNA/RNA...........................................84, 382 Do BLAST Search .....................................64 Domain Editor ..........................................370 Domains... 86, 122, 144, 145, 146, 147, 175, 181, 182, 266, 288, 289, 290, 291, 337 Domains Cannot Overlap ........................375 Domains Dialog .......................................370 Drag-and-drop .........................................370 Drosophila mitochondrial genetic code table .................................................................109 Nucleotide Sequences.............................. 36 Exclude/include sites ...................... 123, 267 Exit .................................. 168, 259, 332, 334 Distance Data Explorer........................... 259 MEGA ..................................................... 334 Exit Tree Explorer ................................... 295 Exon............................................ 85, 87, 370 Expand/contract box ............................... 370 Export All Trees ...................................... 295 Export Current Tree ................................ 295 Export Data ............................. 123, 267, 329 Export/Print Distances .................... 151, 259 Exporting Sequence Data............... 123, 267 Exporting Sequence Data dialog .... 118, 262
F
Feature List ............................................... 19 File menu .................. 49, 151, 154, 259, 327 File Menu ................................................ 334 File Name................................................ 328 Files ................................ 123, 267, 295, 328 Data | Write Data ............................ 123, 267 Tree Explorer .......................................... 295 Type ........................................................ 328 Files Of Type........................................... 328 Find ......... 115, 173, 174, 242, 324, 357, 403 codon ...................................................... 115 ME........................................................... 357 MP................................................... 242, 403 number.................................................... 324 Find Again............................................... 174 Find Text dialog ...................................... 173 Fisher's Exact Test ......................... 252, 361 Selection ................................................. 361 Fisher's Exact Test Has Failed ............... 377 Fixed Column.................. 115, 149, 255, 259 Fixed Row ....................... 115, 149, 255, 259 Font......................................................... 173 Font dialog .............................. 124, 268, 305 Format dialog .......................................... 367 Format Statement ......................... 83, 85, 91 Keywords ............................................ 85, 91 Rules......................................................... 83 Formats....................................... 77, 90, 328
E
Edit | Copy ...............................................170 Edit | Cut ..................................................169 Edit | Font ................................................173 Edit | Paste ..............................................171 Edit | Undo ...............................................172 Edit menu...........................................49, 154 Edit Menu in Alignment Explorer .......69, 315 Edit Sequencer Files ...............................365 Edits...................................................49, 154 ASCII .................................................49, 154 EMF .........................................................296 End ......................................................85, 87 Entire Population .....................................349 Mean Diversity .........................................349 Equal Input Correction Failed ..................376 Equal Input Model....................................218 Equal Input Model Gamma......................196 Equal Input Model Gamma rates and Heterogeneous Patterns..........................210 Equal Input Model Heterogeneous Patterns .................................................................222 Estimate...........................................222, 349 Dayhoff distance ......................................222 interpopulational diversity ........................349 Estimating Evolutionary Distances from
G
G+C-content ................................... 191, 394 Gamma ................... 197, 198, 201, 222, 378 Gamma Correction Failed Because p..... 378 Gamma distance..................................... 222 Gamma model ........................................ 201 Gaps ....................................................... 343 Handling.................................................. 343 Gene Names Must Be Unique ................ 379 General Comments on Statistical Tests . 242
223
Molecular Evolutionary Genetics Analysis General Considerations.......................83, 90 Genes ................................................86, 370 Genes/Domains .........................................87 Genes\Domain.........................................370 Genetic Code...........................................112 Glutamic Acid.............................................84 Glycine.......................................................84 Gojobori ...................................................252 Grid ................................. 115, 149, 255, 259 Grishin's distance ....................................222 Group Name ....................................133, 277 Groups ... 87, 89, 92, 93, 115, 118, 121, 134, 149, 153, 257, 259, 262, 265, 278, 336, 348, 350, 351 taxa .... 87, 92, 115, 118, 149, 153, 257, 259, 262, 348, 350, 351 Groups Dialog..........................................368 positions/labeled sites.... 229, 233, 236, 240, 250, 252 Inconsistencies ................................. 31, 328 Incorrect Command Used....................... 381 Increase/decrease .......................... 149, 255 Indel .......................................... 85, 238, 247 Independents node ................................. 370 Index ....................................................... 366 Information Box....................................... 294 Input Data Format Dialog........................ 367 Insert genes or domains ......................... 370 Insertions/deletions ......................... 238, 247 Installing MEGA .......................................... 8 Intergenic domains ................................. 370 Interior Branch Test ........................ 243, 353 Interpopulational diversity ....................... 349 estimate .................................................. 349 Introduction to Walk Through MEGA ........ 32 Intron........................................... 85, 87, 370 Intron Property .............................. 86, 87, 92 Invalid distances ..................................... 386 Invalid special symbol............................. 382 Isoleucine.................................................. 84 IUPAC single letter codes......................... 84
H
Hand-with-a-pencil icon ...........................368 Help .............................................6, 327, 368 Help | About .............................................367 Help Index........................................365, 366 Help menu ...................................6, 327, 365 Hiding taxa...............................................258 Highlight | Parsim-Info Sites ............140, 284 Highlight 0-fold Degenerate Sites....141, 285 Highlight 2-fold Degenerate Sites....142, 286 Highlight 4-fold Degenerate Sites....143, 287 Highlight Conserved Sites ...............137, 281 Highlight Menu.................................136, 280 Highlight Singleton Sites..................139, 283 Highlight Variable Sites ...................138, 282 Highlighted Sites..............................149, 293 Highlighting ......................................115, 259 Sites.................................................115, 259 Histidine .....................................................84
J
Jukes-Cantor................... 188, 223, 224, 383 Jukes-Cantor Correction Failed .............. 383 Jukes-Cantor distance ............................ 187 Jukes-Cantor Gamma distance .............. 197
K
Keywords ...................................... 85, 87, 91 Command Statements .............................. 87 Format Statement ............................... 85, 91 Kimura 2-parameter distance ................. 189 Kimura gamma distance ......................... 198 Kimura-2-parameter-Gamma distance ... 198 Kumar Method ........................................ 228 [email protected] ................... 1, 29
I
ID .................... 133, 134, 136, 277, 278, 280 Identical .....................................................85 Identical Symbol ......................................367 Image Menu.............................................296 Importing Data From Other Formats .........94 Inapplicable Computation Requested .....380 Include Codon Positions..........................339 Include Labeled Sites ..............................340 Include Sites Option ................................248 Include/exclude................................115, 259 Include/Exclude taxa ...............149, 255, 368 Including ........................................6, 94, 301 CLUSTAL...................................................94 MEGA ..........................................................6 taxon ........................................................301 Inclusion/exclusion of codon
L
Labels Tab .............................................. 370 Large Sample Tests of Selection............ 248 Leaf taxa ................................................. 294 Leucine ..................................................... 84 Level of CP ............................................. 243 Linux ........................................................... 7 Listing...................................................... 368 taxa ......................................................... 368 Li-Wu-Luo ............................................... 228 Li-Wu-Luo Method .................................. 225 LogDet Distance Could Not Be Computed ................................................................ 385 Look In .................................................... 328
224
Index
M
Main MEGA Window ...............................327 Managing Taxa With Groups.....................44 Manipulating tree aspects........................303 Marker Graphics ......................................305 MatchChar .................................................85 Matrix .......................................................386 Matrix Explorer.........................................259 Matrix Format...........................................367 Maximum Composite Likelihood......195, 429 Maximum Composite Likelihood Gamma Rates and Heterogeneous Patterns ........216 Maximum Composite Likelihood Heterogeneous Patterns..........................210 Maximum Composite Likelihood Method 195 Maximum Composite_Likelihood Gamma .................................................................205 Maximum Parsimony .......................240, 358 Maximum-likelihood .........................243, 358 Max-mini branch-and-bound search........430 ME .......................... 234, 243, 244, 356, 357 ME Tree Tab............................................357 Mean Diversity .........................................349 Entire Population .....................................349 Interpopulational Diversity .......................349 MEG.........................................................328 MEGA citing ............................................................6 classroom use............................................29 exiting ......................................................334 Installing.......................................................8 MEGA Format............................................77 MEGA Software Development Team ..........5 Menu bar............................................49, 154 Menus ......................................................326 Methionine .................................................84 Microsoft Word...........................................77 Midpoint ...................................................301 Minimum Evolution ..................234, 236, 357 Minimum Evolution Construct Phylogeny 357 Missing.............................................367, 386 data..........................................................386 Data .........................................................367 Missing Data ............................................343 Missing Information .................238, 245, 247 Models .............................................183, 188 Nei ...........................................................188 Modified Nei-Gojobori..............................252 Modified Nei-Gojobori Method.................224 Molecular sequences...............................382 Monophyletic............................................434 MP .................. 238, 242, 243, 247, 358, 403 constructing .............................................358 find ...................................................242, 403 MP Trees .................................................358
N
Name ...................... 115, 149, 255, 258, 328 sequences/groups........................... 149, 255 taxa ......................................................... 258 NCBI ....................................................... 436 Neighbor Joining ..................................... 244 Neighbor Joining Construct Phylogeny .. 244 Neighbor-Joining..................................... 356 Nei-Gojobori.................................... 112, 224 Nei-Gojobori Method............................... 223 Net Between Groups ...................... 153, 257 Neutrality......................................... 253, 359 Tajima's Test................................... 253, 359 Tests | Tajima's Test....................... 253, 359 New......................................................... 157 Newick Format ........................................ 437 Nex............................................................ 94 Nexus/PAUP ............................................. 94 NJ............................ 234, 243, 244, 356, 357 NJ/UPGMA ............................................. 233 Noncoding............... 85, 86, 87, 92, 123, 267 Non-synonymous ... 112, 223, 224, 225, 226, 228, 248, 250, 252, 360, 377, 383 Non-synonymous site .... 225, 226, 228, 248, 360, 361 Notations Used ......................................... 32 Notepad ............................................ 49, 154 NSeqs ................................................. 85, 91 NSites ....................................................... 85 NT ............................................................... 7 NTaxa ................................................. 85, 91 Nucleotide ............................................... 180 Nucleotide Composition.................. 144, 288 Nucleotide Pair Frequencies.. 145, 181, 289, 440 Nucleotide-by-nucleotide ........................ 183 Nucleotide-by-nucleotide site.................. 339 Number .. 112, 189, 191, 193, 198, 201, 223, 224, 225, 226, 228, 234, 244, 248, 252, 255, 324, 356, 360, 377 0-fold ....................................... 225, 226, 228 4-fold ....................................... 225, 226, 228 codons .................................................... 252 Finding .................................................... 324 non-synonymous.... 112, 223, 224, 225, 226, 228, 248, 360, 377 Sites ................................................ 223, 224 taxa ................................. 234, 244, 255, 356 transversional.......... 189, 191, 193, 198, 201
O
OLS branch length estimates ................. 441 Only 4-fold degenerate sites................... 327
225
Molecular Evolutionary Genetics Analysis Writing......................................................327 Only highlighted sites ..............................323 Only Nei-Gojobori ....................................252 Open ........................................................158 Open Data ...............................................328 Open Saved Alignment Session................53 Operational Taxonomic Units ....................80 Options dialog 154, 302, 303, 304, 305, 306, 344 quit ...........................................................154 Order................................................301, 368 taxa ..................................................301, 368 OTUs .........................................80, 233, 359 Outgroup..........................................245, 356 Outgroup taxa ..........................................356 Output file ................................................327 Print dialog .............................................. 295 Printer Setup ................................... 295, 333 Program ...................................................... 8 uncompress ................................................ 8 Proline....................................................... 84 Protein parsimony ................................... 448 Pyrimindine ............................................... 84
Q
Query Databanks .................................... 363 Quit Data Viewer............. 118, 124, 262, 268 Quit Options dialog ................................. 154 Quit Viewer ..................................... 151, 259
R
RAM ............................................................ 7 Rate ........................................................ 187 Read ......................................................... 94 DNA .......................................................... 94 Relative Rate .................................. 245, 356 Relative Rate Tests................................. 355 Removing................................................ 368 taxon ....................................................... 368 Reopen Data........................................... 330 Replace................................................... 175 Reporting Bugs ......................................... 31 Resampled dataset................................. 242 Resampling ..................... 244, 248, 352, 360 Residue-by-residue................................. 183 Restore Input Order ........................ 125, 269 RNA .................................................. 85, 335 RSCU...................................................... 406 Rules....................................... 80, 81, 82, 83 Description Statement .............................. 82 Format Statement ..................................... 83 Taxa Names.............................................. 80 Title Statement.......................................... 81
P
Pair-wise comparisons ............................324 Pair-wise Deletion....................................245 Pair-wise Distance Data ..........................367 Pair-wise menu ........................................325 Pair-wise-Deletion....................................245 Pamilo-Bianchi-Li.............................226, 228 Pamilo-Bianchi-Li Method........................226 Parsimony-informative.............................358 Paste........................................................171 Pattern Menu ...........................................183 PAUP 3.0 .........................................123, 267 PAUP 4.0 .........................................123, 267 P-distance................................186, 217, 391 Phenylalanine ............................................84 Phy.............................................................94 PHYLIP ......................................................94 PHYLIP 3.0 ......................................123, 267 Phylogenetic 6, 77, 183, 233, 236, 238, 240, 243, 244, 247, 339, 340, 343, 344, 345, 351, 352, 357, 434 construct ..........................................233, 357 Phylogenetic Inference ............................233 Phylogenies ............ 115, 119, 233, 259, 263 Phylogeny | Any.......................................293 Phylogeny | Bootstrap Test .............244, 352 Phylogeny | Display Saved Tree Session.Use.............................................354 Phylogeny | Minimum Evolution ..............357 Phylogeny | Neighbor-Joining..................244 Phylogeny menu ..............................327, 351 Poisson ....................................219, 222, 392 Poisson Correction distance....................219 Poisson Correction Failed .......................392 Polypeptide ..............................................446 Position ............................................115, 177 codon .......................................................115 Preface ........................................................3 Print .................................................166, 332
S
Save................................................ 164, 332 Save As................................................... 165 Save As dialog ........................ 165, 295, 296 SBL ......................................................... 294 Scale Bar tab .......................................... 306 Scrollbar.......................................... 115, 259 Search | Find........................................... 173 Search | Find Again ................................ 174 Search | Replace .................................... 175 Search menu..................................... 49, 154 Search Menu in Alignment Explorer . 73, 319 Select ...................... 115, 149, 178, 259, 368 taxa ......................................... 115, 149, 259 taxon ....................................................... 368 Select & Edit Taxa/Groups ..................... 151 Select Genetic Code dialog ............ 118, 262
226
Index Select Genetic Code Table.....113, 120, 264, 341 Select Genetic Code Table Dialog ..........372 Select Preferences ..................................344 Select/Edit Taxa Groups..................135, 279 Select/Edit Taxa/Groups window.............368 Selected Sequences........................126, 270 Selection ................. 248, 250, 325, 360, 361 Fisher's Exact Test ..................................361 Large Sample Tests ................................248 Tests | Codon-based Tests .............360, 361 Z-Test ......................................................360 Sequence Data ..........................83, 245, 367 Sequence Data Explorer 115, 119, 120, 121, 122, 123, 124, 136, 143, 259, 263, 264, 265, 266, 267, 268, 280, 287, 323, 327 Sequence Data Organizer ...............118, 262 Sequence Data Subset Selection............177 Sequence Diversity submenu..................349 Sequence Names ............................134, 278 Sequencer Menu in Alignment Explorer...74, 320 Sequences/groups...........................149, 255 Setup/Select Genes122, 144, 145, 146, 147, 175, 181, 182, 266, 288, 289, 290, 291, 337, 370 Setup/Select Genes/Domain .....................86 Setup/Select Taxa ..... 89, 93, 121, 265, 336, 368 Show........................................149, 255, 304 pair-wise ..........................................149, 255 statistics/frequency ..................................304 Show Analysis Description ......................259 Show Group Names ....... 130, 152, 258, 274 Show Information.....................................295 Show Input Data Title ..............................259 Show Names ...........................................258 Show Only Selected Sequences .....126, 270 Show Only Selected Taxa .......................152 Show Pair Name......................................258 Show Sequence Names ..................129, 273 Show Web Browser .................................364 Show/Hide ...............................................301 Simple 2-fold............................................228 Site Labels ...............................................370 Site Picker dialog .....................................370 Sites 115, 223, 224, 238, 245, 247, 259, 324 Highlighting ......................................115, 259 Number ............................................223, 224 Sites Redundancy .................................112 Sizer button......................................149, 255 SoftWindows95............................................7 SoftWindows98............................................7 Sort ..........................................................368 Sort Sequences ..... 132, 133, 134, 276, 277, 278 Sort Sequences As per Taxa/Group Organizer ........................................ 135, 279 Sort Sequences By Sequence Name .... 136, 280 Sort Taxa ........................................ 152, 258 Special Symbols ....................................... 83 SQRT .............................................. 248, 360 Staden..................................................... 457 Statistical Attributes ................................ 112 Computing............................................... 112 Statistics.................................................. 323 Computing............................................... 323 Statistics | Amino ............................ 147, 291 Statistics | Codon Usage......... 146, 182, 290 Statistics | Nucleotide Composition 144, 288 Statistics | Nucleotide Pair Frequencies 145, 181, 289 Statistics | Use ................................ 149, 293 Statistics | Use All Selected Sites ... 148, 292 Statistics Menu........................ 143, 287, 323 Statistics/frequency................................. 304 Status Bar ................. 49, 115, 149, 154, 259 Subpopulations ....................................... 349 Substitution ..................................... 324, 325 Subtree Drawing Options (in Tree Explorer) ................................................................ 298 Subtree Menu ......................................... 297 Subtree Option........................................ 305 Sun Workstation.......................................... 7 Synonymous-non-synonymous .............. 183 Syonymous ..................................... 248, 360 System Requirements ................................ 7
T
Tajima ..................... 188, 245, 253, 356, 359 Tajima Nei distance Gamma rates ......... 200 Tajima Nei Distance Gamma Rates and Heterogeneous patterns ......................... 211 Tajima Nei Distance Heterogeneous patterns ................................................... 205 Tajima-Nei....................................... 188, 394 Tajima-Nei distance ................................ 188 Tajima-Nei Distance Could Not Be Computed ............................................... 393 Tajima's Test................... 245, 253, 356, 359 Neutrality......................................... 253, 359 Tamura.................................................... 394 Tamura 3 parameter Gamma rates and Heterogeneous patterns ......................... 214 Tamura 3 parameter Heterogeneous patterns ................................................... 206 Tamura 3-parameter distance ................ 191 Tamura 3-parameter Gamma ................. 203 Tamura-Nei ............................. 193, 201, 395 Tamura-Nei distance ...................... 193, 201 Tamura-Nei Distance Could Not Be
227
Molecular Evolutionary Genetics Analysis Computed ................................................395 Tamura-Nei distance Gamma rates and Heterogeneous patterns ..........................212 Tamura-Nei distance Heterogeneous Patterns ...................................................208 Tamura-Nei gamma distance ..................201 Taxa... 80, 87, 89, 90, 92, 93, 115, 118, 149, 151, 152, 153, 177, 178, 234, 244, 255, 257, 258, 259, 262, 301, 336, 348, 350, 351, 356, 368, 386, 434 Adding......................................................368 categorize ................................................151 defining ........................................89, 93, 336 Defining Groups...................................87, 92 following...............................................87, 92 Groups87, 92, 115, 118, 149, 153, 257, 259, 262, 348, 350, 351 hiding .......................................................258 listing........................................................368 name........................................................258 number............................ 234, 244, 255, 356 order ................................................301, 368 selecting...................................115, 149, 259 Taxa Names ..............................................80 Rules..........................................................80 Taxa/Group Organizer.....................135, 279 Taxa/Groups ............................................368 Taxon 80, 149, 152, 255, 258, 301, 303, 368 including...................................................301 indicate ....................................................368 manipulate ...............................................303 Removing.................................................368 select .......................................................368 Taxon Iabel ................................................80 Taxon Name tab ......................................305 Technical Support......................................30 Test of Positive Selection ..........................43 Tests | Codon-based Tests .............360, 361 Selection ..........................................360, 361 Tests | Interior Branch Test .............243, 353 Tests | Relative Rate Tests .....245, 355, 356 Tests | Tajima's Test........................253, 359 Neutrality..........................................253, 359 Tests menu ..............................................327 Tests of the Reliability of a Tree Obtained 40 Text Editor ..... 157, 158, 164, 165, 166, 168, 169, 170, 171, 172, 173, 174, 175 Text File Editor...................................49, 154 Text Label ................................................305 Threonine...................................................84 Title ..........................................77, 79, 81, 82 Title Statement...........................................81 Rules..........................................................81 Toolbars in Alignment Explorer .........64, 311 Topological distance................................462 Trace Data File Viewer/Editor....................52 Transition/transversion .. 179, 184, 186, 189, 191, 193, 198, 201, 224, 252 Transitions + Transversions... 184, 186, 187, 189, 191, 193, 197, 198, 201 Translate/Untranslate ..................... 119, 263 Transversional 184, 186, 189, 191, 193, 198, 201, 225, 226, 228 Transversions 184, 186, 189, 191, 193, 198, 201 Tree......................................................... 400 Bifurcating ............................................... 400 Tree Data ............................................ 83, 93 Tree Explorer . 293, 294, 295, 296, 297, 301, 302, 307 Tree Explorer window ............................. 294 Tree tab................................................... 303 Tree/Branch Style ................................... 301 Treelength............................................... 294 Tryptophan................................................ 84 Txt ....................................................... 32, 77
U
Uncompress................................................ 8 program....................................................... 8 Undo ....................................................... 172 Unexpected Error.................................... 396 Ungrouped Taxa ..................................... 368 Ungrouped Taxa window ........................ 368 Unhide..................................................... 368 Uninstall MEGA........................................... 9 Unique ASCII .......................................... 382 Unrooted . 233, 234, 244, 356, 357, 358, 462 Updates..................................................... 30 UPGMA........................................... 243, 359 Use All Selected Sites .................... 148, 292 Use Identical Symbol ...................... 128, 272 Use only Highlighted Sites.............. 149, 293 User Stopped Computation .................... 397 User-Entered Text..................................... 32 Using MEGA in the classroom.................. 29
V
Valine ........................................................ 84 Vertebrate mitochondrial......................... 109 View ........................................................ 115 View menu ...................................... 301, 327 View/Edit Sequencer Files...................... 365 VirtualPC..................................................... 7
W
Web Browser ............................................ 53 Web Explorer Tab Alignment Explorer ..... 53 Web Menu in Alignment Explorer ..... 75, 321 Website ................................................. 8, 30 What s New in Version 3.0 ......................... 9
228
Index Windows ..............................................2, 7, 9 Windows Clipboard..................169, 170, 171 WinZip..........................................................8 WordPad....................................................77 WordPerfect...............................................77 Words ........................................................79 Working With Genes and Domains ...........42 Write Data................................................329 Writing............................. 78, 86, 87, 92, 327 Command Statements...................86, 87, 92 only 4-fold degenerate sites ....................327 Writing site .......................................123, 267
Y
Yeast mitochondrial ................................ 109
Z
ZIP file......................................................... 8 Z-statistic................................................. 325 Z-Test.............................. 248, 252, 325, 360 conduct ........................................... 248, 360 Selection ................................................. 360
229