IMPORTANT NOTICE:
THIS VOLUME IS ONLY A FIRST DRAFT, WHOLY UNCORRECTED,
OF THIS THIRD VOLUME OF BEYOND BEING, BEYOND MIND,
BEYOND HISTORY, LACKING MANY OF THE CHAPTERS AND
SECTIONS THAT WILL BE FEATURED IN THE DEFINITIVE
VERSION. IT WILL CERTAINLY TAKE MORE THAN ONE YEAR TO
PRODUCE THE DEFINITIVE VERSION, AND BEFORE BEGINNING
ITS PREPARATION THE DEFINITIVE VERSIONS OF VOLUMES I AND
II WILL HAVE TO BE PREPARED. HOWEVER, IN CASE THE
READERS OF VOLUMES I AND II WANTED TO HAVE A TASTE OF
WHAT VOLUME III WILL BE LIKE, THIS WAS INCLUDED AS WELL.
Elías Capriles
BEYOND BEING
BEYOND MIND
BEYOND HISTORY
A DZOGCHEN-FOUNDED
METATRANSPERSONAL, METAPOSTMODERN
PHILOSOPHY AND PSYCHOLOGY
FOR SURVIVAL AND AN AGE OF COMMUNION
VOLUME III:
BEYOND HISTORY:
A DEGENERATIVE PHILOSOPHY OF HISTORY
LEADING TO A GENUINE POSTMODERNITY
847
Composition courtesy of: Center for Studies on Africa and Asia,
Faculty of Humanities and Education,
University of the Andes,
Mérida, Venezuela
Composed in Times New Roman 12.
Title: Beyond Being, Beyond Mind, Beyond History:
A Dzogchen-Founded Metatranspersonal, Metapostmodern
Philosophy and Psychology for Survival in Communion
Author: Elias-Manuel Capriles-Arias
(Originally written in English by the author.)
Provisional version published on the author’s websites,
provided by Shang Shung Institute, Arcidosso, GR, Italy
and the University of The Andes in Mérida, Venezuela.
Version 1.1
It is prohibited to reproduce any section of this work, by any means, without the
expressed consent of the author, given in writing; it is permitted, on the other hand, to
summarize and quote for the purpose of study, provided that the names of the author and
the publisher are always mentioned.
© 2006 by Elias-Manuel Capriles-Arias
848
This book is dedicated to:
The dharmakaya, true Teacher of humankind
and original, single source of spontaneous liberation;
HH Dudjom Rinpoche and Dungse Thinle Norbu Rinpoche,
who dispensed the teachings that allow spontaneous liberation
to occur regularly in the context of Dzogchen practice;
HH Dilgo Khyentse Rinpoche, who bestowed so many
Empowerments and the strength of whose Contemplation
provided such an effective help for spontaneous liberation;
Chögyäl Namkhai Norbu, who most effectively herded
this practitioner since 1986, who provided the teachings
necessary for writing what had to be written,
and whom I hope will provide the teachings still needed;
And also:
Chadräl Rinpoche, Dodrub Chen Rinpoche, HH Pema Norbu Rinpoche
and several other important Masters, who bestowed
transmissions, lungs, teachings and/or assistance;
Khenchen Thrangu Rinpoche, who dispensed the first teaching
on Dzogchen and engaged in important dharma conversations.
849
TABLE OF CONTENTS
VOLUME III:
BEYOND HISTORY:
A DEGENERATIVE PHILOSOPHY OF HISTORY
LEADING TO A GENUINE POSTMODERNITY
PART IV
BEYOND HISTORY:
A METAPOSTMODERN PHILOSOPHY OF HISTORY
AND REFLECTIONS ON THE SOCIAL SCIENCES
Chapter IX: Philosophy of History: The Error of the “Forward Stampede”
in Hegel, Wilber and the Theosophical Society, and the Error of the
“Backward Reaction” in the Traditionalist Movement..................................................795
The Perennial Philosophy’s Degenerative View
of Human Evolution and History...........................................................797
Hegel’s Modernist Inversion of the Perennial Philosophy of History...............
Wilber’s Modernist Inversion of the Perennial Philosophy of History
and the Traditionalist Movement’s Reactionary Distortion of It...........
“Scientific Evidence” Sustaining the Perennial Philosophy of History
and Refuting the Inversions by
Hegel, Marx, Engels, Habermas and Wilber..........................................
The Ideological Character of the Sciences,
The “New Paradigm” Championed in the 1980s and 1990s,
And the Role of Science and Technology in the New Age.....................
The Current Decadence and reductio ad absurdum of Modernity
Vs the Upcoming, Truly Postmodern New Age......................................
References to the whole book.........................................................................................
Notes to Volume III........................................................................................................
851
PART IV
BEYOND HISTORY:
A METAPOSTMODERN PHILOSOPHY OF HISTORY
AND REFLECTIONS ON THE SOCIAL SCIENCES
853
IX
Philosophy of History:
The Inversion of the “Forward Stampede”
in Hegel, Wilber and the Theosophical Society,
and the Blindness of the “Backward Reaction”
in the Traditionalist Movement
855
[A] Mood of universal destruction and renewal... has set its mark on our age. This mood
makes itself felt everywhere, politically, socially, and philosophically. We are living in
what the Greeks called the “kairos”—the right moment—for a “metamorphosis of the
gods,” of the fundamental principles and symbols. This peculiarity of our time, which is
certainly not of our conscious choosing, is the expression of the unconscious man within
us who is changing. Coming generations will have to take account of this momentous
transformation if humanity is not to destroy itself through the might of its own
technology and science... So much is at stake and so much depends on the psychological
constitution of modern man... Does the individual know that he is the makeweight that
tips the scales?a
On the one hand I must attempt to change the souls of individuals so that their societies
may be changed. On the other I must attempt to change the societies so that the
individual soul will have a change.b
The Perennial Philosophy’s Degenerative View
of Human Evolution and History
Even though scientism forbids the production of myths and demands that the socioeconomic and spiritual evolution of humankind be interpreted in scientific terms, all
scientist interpretations of this evolution produced so far have been contradicted by
countless data obtained by scientists of different disciplines. In fact, Hume showed that the
sciences do not prove anything, and ever since many epistemologists have offered a great
deal of “evidence” backing this position. Even the attempts to validate the sciences have
done nothing but to invalidate them, for the most credible criterion adduced in pro of this
position, which is that of A. J. Ayer (1981)—according to which “we are authorized to
have faith in our procedure, so long as it carries out its function, which is that of predicting
future experience and thus control our environment”—has invalidated the sciences insofar
as, in trying to control our environment with the avowed aim of creating an Eden and kill
death and pain, the sciences and the technology based on them have produced a hellish
chaos, taking us to the brink of our extinction—which is supposed to be the opposite of the
place where we intended to go. We are, thus, with Sorel (1903, 1906, 1908) in his assertion
that the sciences are but myths, and the scientific pretension of Marxism was due to the
force of the scientific myth prevailing in Marx’s time. This implies that, insofar as we take
the “discoveries” of the sciences as truths in the sense of adæquatio of the scientific map to
the interpreted territory, they are ideologies—as Gramsci pointed out in 1948 (1997, p.
63),1 as Bachelard corroborated (1957), and as so many others have reiterated.2 Thus a
vision of our socio-economic and spiritual evolution as the one presented here, which has a
a
b
Jung (1970b, pp. 585-586; cited in Holland & MacDonald, 2006, pp. 75-76).
King (1998, S. 19).
857
greater hold than the Marxist interpretation on so-called “scientific evidence,” but which
rather than pretending itself true in the sense of adæquatio, in agreement with Sorel
acknowledges itself to be myth (of the kind Sorel called “authentic”),3 is far more in
agreement with Truth, not in the sense of adæquatio, but as will be defined below: as
absence of the delusion that involves the confusion of the map with the territory and the
belief in a perfect fit between them. And if “ideology” implies a masking of reality
reflecting the interests of a society of class (in this case modern, bourgeois society
represented by the scientists), this interpretation is not ideology in that it does not pretend
to be what it is not.
In response to the above problem, so-called “postmodernism” demands that we steer
away from totalizing metanarratives and produce only local, fragmentary petit récits (small
narratives. Now, so long as we experience the contents of thought as absolutely true or
false, the metanarratives prevailing in our civilization, society, cultural group or ideological
ambit, subliminally determine4 the assumptions on the basis of which we organize our
experience and lives. This happens to those philosophers who declare themselves
postmodern and forbid totalizing metanarratives yet take for granted theses such as... that
there is no alternative to industrialization or capitalism, or that we have perfected ourselves
in regard to primitive humans, of that technology in its present form is beneficial and we
should not replace with another one that would be radically different from it (as in
Marcuse’s proposal), or that we are richer than prehistoric and ancient humans in general,
or that contemporary European thought is more perfect than that of other times and
latitudes—and in particular that it is impossible to free oneself from conditioning by
thought, in a state of Communion free from the limits that thought introduces in our
experience, as achieved by the Dionysian tradition in Greece and its equivalents in Asia.5 (I
am not using the term communion in the sense given it by Gilligan [1982], Tannen [1990],
Wilber [1995, 1998], etc.; I capitalize it to make it clear that I am using it to refer to the
dissolution of the illusory boundaries separating people, in the unconcealment of Dzogchen
qua Base—which I believe was its original meaning.) The metanarratives that, not
acknowledged to be such, subliminally condition those philosophers, have effects that are
destructive and produce suffering, whereas the one presented here could provide keys for
putting an end to the destructive, suffering-producing effects of the delusion consisting in
the confusion of map and territory, as well as of modernity, industrialization and
capitalism.
The problem does not lie in the elaboration of totalizing metanarratives, but in not
realizing that one is conditioned by whichever narratives one clings to—which is
particularly destructive in the case of the metanarratives justifying the destruction of the
ecosphere, the subjugation and exploitation of other individuals, etc. This is why here I
present a metanarrative alternative to those of modernity, industrialization and capitalism
(which postmodernism has not managed to deconstruct as radically as it is imperative), in
order to promote the total revolution that would make our survival possible and that would
make human society a good place (eutopos) in which all of us could achieve plenitude and
harmony. Now, since, as will be shown below, the ultimate source of the present problems
is the delusion Shakyamuni called avidya or marigpa and which Heraclitus called lethe, an
essential aspect of which is the confusion of map and territory and the belief in the perfect
fit of the one and the other, in order for the metanarrative in question to achieve the
function for which it was conceived, it must explicitly acknowledge its character as a
metanarrative, and insist that it be used like Wittgenstein’s ladder, which is used to accede
858
to the place where it can be left behind: that in which we have feed ourselves from the
“bewitchment of our intelligence by means of language.”
Such metanarrative is what Sorel called a “counterideology” (a nail that is used to
remove another nail but that, so that it does not become an ideology, should not be left in
situ), which presents the sociospiritual evolution of our species as a process of
degeneration, recognizing—with Sorel—in the theory of progress an implicit of explicit
philosophy of history justifying the prevailing system of power, and—also with Sorel—
denouncing the latter to be characterized by an inversion that equates the increase of
“positive knowledge” with moral progress, and the development of the sciences with social
progress. (THIS IS TO BE RELATED TO THE STAGES OF EVOLUTION DISCUSSED
BELOW: THE INITIAL LACK OF MYTH, THEN THE MYTH OF ETERNAL
RETURN, AND THEN THE MYTH OF ETERNAL PROGRESS THAT NEGATES ITS
CONDITION AS MYTH AND ASSERTS ITSELF TO BE “SCIENCE” UNDERSTOOD
AS AN EXACT DESCRIPTION OF REALITY.)
In the book Individuo, sociedad, ecosistemaa I expounded my interpretation of the
degenerative view of human evolution and history, which I did not intend to review in
detail in the present work. However, in that book I criticized only the most widely
discussed Western philosophical interpretations of human evolution and history—Hegel’s,
on the one hand, and the Marxist, on the other—and did not even mention Ken Wilber’s.
Since in the preceding chapter I criticized in detail Wilber’s “spectrum of consciousness”
and in particular his explanation of ontogenesis in terms of fulcra, and since Wilber’s
conception of human evolution and history is expounded in terms of these fulcra, I believe
at this point it is mandatory to review the philosophy of history I expounded in Individuo,
sociedad, ecosistema (including my criticism of Hegel’s view of evolution and history, and
a few aspects of my criticism of the Marxist view on the same subject), and contrast it with
Wilber’s inverted views on evolution and history.
We have seen that the myth of lila (the hide-and-seek game of universal nondual
awareness with itself, whereby it conceals itself as individual consciousness, and then upon
Awakening rediscovers itself as cosmic nondual awareness—so to speak, since from its
own standpoint it never loses itself) and the degenerative view of human spiritual and
social evolution and history are common to a series of spiritual and philosophical traditions
having Mount Kailash as their most sacred place—including the various Indian Shaiva
traditions (and hence the Hindu Tantric traditions, which in general are Shaiva), Himalayan
Bön, Persian Zurvanism, and Buddhist Tantra and Dzogchen. In the first chapters of this
book, I also associated the myth of lila with the philosophy of Heraclitus and the related
Dionysian tradition of ancient Greece. Now we will see that the degenerative view of
human spiritual and social evolution and history is also shared by Chinese Taoism (which
is also related to Mount Kailash); Hesiod, Heraclitus and the Stoics (among many others)
in Greece;6 and non-Shaiva traditions of India (a modified version of this view is held by
the Ismailians, who also had a mystical center in Mount Kailash). In fact, the myth of the
human individual’s life as lila and the degenerative view of human spiritual and social
evolution and history are concomitant insofar as the latter is a macro manifestation of the
former—a fact that, as shown in Chapter III of Part I of this book, Heraclitus exemplified
by representing the time cycle (aion) as a child playing chess (Fr. B 52 DK). Independently
of whether we may prefer teleological or teleonomic interpretations of evolution, we may
a
Capriles (1994a).
859
refer to this view of human evolution—on the model of Wilber’s combination of Sanskrit
and Greek words in his phrase “atman telos of evolution”—of the lila telos of evolution.
In India the cosmic time-cycle was called kalpa (Tib., kalpaa), but different
traditions divided it in different ways. Some partitioned it into fourteen manvantara, which
then they subdivided into four yuga or eras, whereas others divided the kalpa directly into
these four yuga or eras, and still others divided it into three yuga or eras only. All traditions
that posited four yuga or eras, regardless of whether of not they posit manvantara, referred
to them as: (1) krityayuga (age of perfection) or satyayuga (era or Truth); (2) tretayuga
(age of three); (3) dwaparayuga (age of two); and (4) kaliyuga (age of darkness or black
era: the period of utmost degeneration).7 Those traditions that divided the cycle or kalpa
into three yuga or eras, referred to these as: (1) satyayuga; (2) dharmayuga (age of the
Law), and (3) kaliyuga.
In Zhang Zhung (which included Tibet), the ancient Bönpo had a sophisticated
degenerative conception of human evolution and history,8 according to which in the
original condition of total plenitude and perfection property and political power were
nonexistent: these developed in the course of the gradual “Fall” corresponding to the
degenerative evolution and history of our species. The view prevailing among Tibetan and
Western historians is that after the arrival of Buddhism the Bön religion assimilated the
Buddhist division into four or three yuga or eras, which it now teaches; however, some
Bönpo sources take the credit and claim that it was the other way around: that the Indian
systems assimilated their view of the successive yuga or eras from ancient Bön.
The Persians, Greeks and Romans shared the practice of naming the successive eras
after metals, each less “noble” than the former: the golden age of perfection was succeeded
by the less perfect silver age, which was followed by the more degenerate bronze age,
which in its turn was followed by the iron age, in the last period of which degeneration
reached its utmost expression. In Greece, after successive Aryan invasions effaced the
degenerative view, Hesiod re-imported it from Persia; later on, in his book Heraclitus
allegedly referred to the circular vision of becoming;9 finally, the Stoics re-introduced the
original schema of political, social and economic degenerative evolution that will be
summarized below, beginning in a condition in which there were absolutely no social
differences, no property, no exclusive family and no State or political power. (Also in
Judaism there is talk of four ages called after metals: the Book of Daniel, probably inspired
by Eastern traditions,10 mentions the successive kingdoms of gold, silver, bronze, and a
mixture of iron and clay, after which God will establish an everlasting kingdom. And, in
Christianity, Clement of Alexandria and Origen [Origenes Adamantius], and later on
Desiderius Erasmus, accepted a circular vision of becoming bearing the influence of
Heraclitus and the Stoics; likewise, more diluted versions of this view are found in
Albertus Magnus, Thomas Aquinas, Dante, and several others.)
In ancient China, the two most characteristic systems of thought were Taoism and
Confucianism. The former, whose practice aimed at the radical transformation of the
individual’s inner experience, naturally linked up with the pre-existing worldview of yin
and yang, associating itself closely to the lower strata of society, and to the communitarian
structure and function of hamlets. In its turn, the latter—whose practice was limited to the
regulation of behavior, both at the individual and the political level—developed on the
basis of the pre-existing worldview of Heaven and Earth, associated with the Empire and
a
bdkal pa or kal pa.
860
the mandarinate. Among these systems, it was the former that upheld the degenerative view
of human evolution and history, in a version that will also be briefly reviewed below;
however, there is no evidence whatsoever that Taoists ever posited either eras (yuga) or
manvantara.
According to my interpretation of the traditional degenerative conception of human
evolution and history, degeneration results from the gradual development during the time
cycle, of the basic human delusion that the Buddha Shakyamuni called avidya and that
Heraclitus referred to as lethe. In the initial Era of Perfection, Age of Truth or Golden Age,
a state of Communion characterized by total plenitude and perfection and Total SpaceTime-Awareness (analogous or similar to the one called Dzogchen-qua-Path that here I
have been referring to by the term Self-qua-Path), in which the true, single nature of all
animate and inanimate entities was realized nonconceptually and nondually, alternated with
the incipient manifestation of the delusion the Buddha called avidya and Heraclitus called
lethe. However, this delusion being extremely mild, it failed to give rise to the unhappy
consciousness that constitutes the first noble truth of Buddhism and to the Angst that
according to existentialism and Existenzphilosophie constitutes the bare experience of the
being of the human individual. With the passing of time, it became gradually more difficult
to enter the state of Communion, so that only few practitioners of ancient Wisdom
traditions could gain access to it, and in the alternative state delusion became progressively
more powerful, giving rise to ever-increasing Angst, an ever unhappier consciousness, and
in general ever more negative, unwanted consequences. In our cycle, at the present point in
the process of degenerative evolution, which marks the final stage of the of the Age of
Darkness, Black Era or Iron Age, and hence of the cycle, delusion and its negative,
undesirable consequences have reached their utmost expression: the prevailing human
project aiming at producing a comfortable, painless world by technological means has
given rise to an ecological crisis at the level of ecosphere, society and individual, which
proves that it was based on a delusory perception, and which constitutes the reductio ad
absurdum of this delusory perception.11 Thus humankind has reached the threshold level at
which it can surpass the delusion that developed during the cycle, and if this surpassing is
achieved in time to prevent self-destruction (and personally I am convinced final
destruction will not occur at the end of this cycle), a new cycle may began, starting with a
new Age of Perfection, Age of Truth or Golden Age—or else the roughly analogous
Millennium of plenitude and perfection announced in the Tantra Kalachakra of Vajrayana
Buddhism and in analogous traditions of Christianity, the Ismailian tradition of Islama and
so on, may be instated.12
Delusion began developing already in the Age of Truth, Era of Perfection or Golden
Age, impelling the process of degeneration and thus preparing the ground for the advent of
the following eras (so to speak, for the periods in question result from the division by
human beings, according to a given criterion, of the time continuum, rather than from
clear-cut discontinuities in the evolutionary process). Despite my diametrical opposition to
the extreme right-wing Traditionalist movement, which will be discussed below, I find this
fact to be aptly expressed in Biblical and Koranic imagery by the following excerpt from a
work by Abu Bakr Siraj Ed-din (René Guénon’s successor as a Sufi teacher, Martin
Lings):b
a
b
Under the direction of Brice Parain (1972), p. 281.
Siraj Ed-din (1974), p. 29.
861
In all parts of the world tradition tells us of an age when man lived in a Paradise on
earth. But although it is said that there were then no signs of corruption upon the face of
earth, it may be supposed, in view of the Fall which followed, that during this age the
perfect human nature had become the basis for gradually less and less spiritual exaltation.
This is to be inferred from the story of Adam and Eve, whose creations are said to mark
different phases passed through by mankind in general during this age. The creation of
Adam and his adoration by the Angels is taken to refer to a period when man was born with
Knowledge of the Truth of Certainty. The creation of Eve thus refers to a later period when
man began to be born in possession of the Eye of Certainty only, that is, in the state of
merely human perfection: in the beginning Eve was contained in Adam as the human
nature is contained in the Divine, and her separate existence indicates the apparently
separate existence of the perfect human nature as an entity in itself.13 Finally the loss of this
perfection corresponds to the loss of the Garden of Eden, which marks the end of the
Primordial Age.
The beginning of Eve’s separate existence also marks the rupture of the state of
psychological hermaphroditism that in Persia was represented by Zurvan and in India was
represented by the form of Shiva called Ardhanarishwara, in which human beings of both
sexes needed not negate in themselves the essence associated with the sex that did not
correspond to that of their bodily shape, and in which—insofar as in Jungian terms this
meant that males had no anima and females had no animus—there could be no conflicts
among the sexes.
Despite the fact that, as note above, Taoism does not posit yuga or eras, some
Chinese texts list successive periods in the degenerative evolution of our species, which
they link to the lives of renowned characters (real of fabled) in Chinese prehistory and
history. In the Wen-tzu, attributed to Lao-tzu, we read:a
Lao-tzu said:
In remote antiquity, authentic people breathed yin and yang, and all living beings
admired their virtue, thus harmonizing in a peaceful way. In those times, leadership was
hidden, spontaneously giving rise to a pure simplicity. Simplicity had not been lost as yet,
and so the multitude of beings was very composed.
Later on, society deteriorated. Toward the time of Fu-hsi, a flourishing of deliberate
effort occurred; everyone was about to abandon their innocent mind and consciously
comprehend the universe. Their virtues were complex and were not unified.
When the epoch in which Shen-nung and Huang-ti governed the country and
elaborated calendars for harmonizing yin and yang, everybody kept upright and willingly
stood the charge of looking and hearing. Therefore, they were in order but not in harmony.
Subsequently, in the society of the times of the Shang-yin dynasty, the people carne to
savor and covet things, and intelligence was beguiled by external things. Essential life lost
its reality.
Upon the arrival of the Chou dynasty, we have diluted purity and lost simplicity,
straying from the Way (tao) to conceive artificialities, acting on the basis of dangerous
qualities. There have arisen the sprouts of craftiness and ruse; cynical erudition is used in
pretending to arrive at wisdom, false cynicism is used to intimidate the masses, the
elaboration of poetry and prose is used to attain fame and honor. Everyone wants to employ
knowledge and astuteness to be socially recognized, and loses the foundation of the global
a
Lao-tzu (1994), chap. 172, pp. 245-7. I am retranslating into English from the Spanish translation.
862
source; therefore, in society there are those who lose their natural lives. This deterioration
has been a gradual process, which has been occurring over a long time.
Thus, the learning of complete people consists in making their essential nature return to
nonbeing,14 and allow their minds to float in ampleness. [Conversely], mundane learning
does away with intrinsic virtues and reduces the essential nature; while internally they
preoccupy themselves for their health, [mundane people] resort to violent actions to
confuse with regard to name and honor. This is something complete people do not do.
What eradicated intrinsic virtue was self-consciousness; what reduced essential nature
was the cutting of its living creativity. If people are complete, they have certitude about the
meaning of death and life and understand the patterns of glory and ignominy. Even if the
whole world praises them, that does not give them added breath, and even if the whole
world repudiates them, that does not inhibit them. They have attained the key to the
essential Way (tao).
It takes an extremely long time for the delusion that Shakyamuni called avidya and
that Heraclitus called lethe to develop to a degree like the one it has attained today, when it
has given rise to the most extreme instances of the “reverse law” or “law of inverted effect”
illustrated in vol. II of this book with quotations from Vimalamitra and Sarahapada,15
which are characteristic of the moment when delusion is about to reach its logical extreme
and thus complete its reductio ad absurdum—or even to the degree it had attained at the
time when Shakyamuni taught the four noble truths. In our time, the fact that our
perception of reality is distorted has been demonstrated by the fact that our attempts to
reach the cardinal point of a technological Eden have led us to the opposite cardinal point
of a hellish existence and to the very verge of the abyss consisting in the self-destruction of
human society—and possibly of our biological species, or perhaps even of all life on our
planet. And—for the reasons summed up above, which will be further explained and
substantiated below—this has opened the hitherto nonexistent possibility that the delusion
that the Buddha called avidya and that Heraclitus called lethe may be surpassed on the
level of the species rather than on that of a few special individuals.
In fact, the most upright and regardful scientists on the planet have warned that, if
current trends of human action on the biosphere are maintained, ecological crisis will very
likely put an end to life on our planet, or at least disrupt human society—not unlikely in the
current century.16 Our way of life would sacrifice future generations in their entirety and
many members of present generations in exchange for an apparent comfort that is only
available to a privileged minority, but that does not provide true happiness even to this
minority. Like all other members of technological civilization, those who live in opulence
are always beset by dissatisfaction, anxiety and neurosis, and have no access to the
nonconceptual unveiling of the nondual Flow of our true nature that alone makes life truly
Meaningful.17 Furthermore, those who are near the outermost bounds of the higher point of
the wheel of samsara, as Blaise Pascal noted,a are made to fall far more precipitously by
the wheel’s turnings.18
The project of Modernity is a product of the exacerbation of the delusion called
avidya or marigpa, which has produced an extreme perceptual fragmentation resulting in a
lack of overall understanding of the universe, which is an indivisible continuum and a
network of interdependences. Let me quote from vol. II of this book, for what was written
a
Pascal (1962).
863
there with regard to an essential characteristic of the basic human delusion called avidya or
marigpa is essential for understanding the problem we are concerned with here:19
... the exacerbation of the delusion called avidya or marigpa, and hence of What Gestalt
theory calls figure-ground mind and of understanding exclusively in terms of digital
secondary process, has caused the figures we single out in the sensory continuum to appear
to us as in themselves isolated from the ground, making consciousness unaware of the
indivisibility of the analog continuum of the territory and of the interdependence, not only
of the singled out figure and the rest of the continuum, but of all potential figures among
themselves. The result is a lack of overall understanding of the indivisible, analog
continuum and network of interdependences that is the universe—which, according to the
Udana (third book of the Khuddaka Nikaya in the Pali Canon, which contains the teachings
of the First Promulgation that form the basis of the Hinayana), the Prajñaparamitasutras
(Second Promulgation), the philosophy of Nagarjuna (based on the latter sources) and other
Buddhist sources and systems, is a central aspect of the basic human delusion called avidya
or marigpa. K. Venkata Ramanan paraphrases the explanation the Prajñaparamitashastra,
which the Chinese attribute to Nagarjuna,20 gives about this essential aspect of delusion:a
“We select from out of the presented only the aspects of our interest and neglect the
rest; to the rest that is neglected we become first indifferent and then blind; in our
blindness, we claim completeness for the aspects we have selected. We seize them as
absolute, we cling to them as complete truth... While the intellectual analysis of the
presented content into its different aspects is conducive to and necessary for a
comprehensive understanding, analysis is miscarried if the fragmentary is mistaken for the
complete, the relative is mistaken for the absolute.”
In the Udana of the First Promulgation,b Shakyamuni Buddha illustrated this aspect of
the basic human delusion by the story of the six blind men and the elephant, according to
which the one who held the elephant’s head asserted the object to be like a pot, the one who
held the ear said it was like a winnowing fan, and so on:c each of them held so firmly to his
partial view, taking it to be the exact, absolute view of totality, that they quarreled bitterly,
unable to come to an agreement as to the nature of the object before them. The same story
is told in the Tathagatagarbhasutra of the Third Promulgation, as follows:d
“The king assembled many blind men and, [placing them before] an elephant,
commanded, “Describe [this object’s] particular characteristics.” Those among them who
felt the elephant’s nose said that [the object] resembled an iron hook. Those who felt the
eyes said that [it] resembled bowls. Those who felt the ears said [it] resembled winnowing
baskets. Those who felt the back said it resembled a sedan chair, and those who felt the tail
said it resembled a string. Indeed, though [their respective descriptions responded to the
parts of the] elephant [they touched], they were lacking in overall understanding...”
In a modified version of this story that was popularized by Sufi poets in Islamic
countries, each of the men grasped a different part of the pachyderm, reaching a diverse
a
Venkata Ramanan (1966), pp. 107-108.
Udana 6,4: Tittha Sutta.
c
P.T.S., pp. 66-68; Venkata Ramanan (1966), pp. 49-50, reference in note 138 to ch. I, p. 344.
d
Dudjom Rinpoche (1991), vol. I, p. 295. The quotation is from Sutra of the Nucleus of the Tathagata. Tib.
de bzhin gshegs pa’i snying po’i mdo. Skt., Tathagatagarbhasutra. Tohoku University catalogue of the sDedge edition of the Tibetan Buddhist Canon (Ed. H. Ui et al., Sendai, 1934), 258. P. Pfandt, Mahayana Texts
Translated into Western Languages (Köln: In Kommission bei E. J. Brill, 1983), 231. The parts in
parentheses are those I modified in order to make the text more comprehensible in the content in which it is
being used.
b
864
conclusion as to what the animal was: the one who took hold of its trunk said it was a hose;
the one who seized its ear thought it was a fan; the one who put his hand on its back
decided it was a throne; the one who clasped its leg concluded it was a pillar and, finally,
the one who grabbed its tail threw it away in terror, believing it to be a snake.21
The modern exacerbation of the essential human delusion, by carrying to its logical
extreme our sensation of being entities inherently separate and independent from the rest of
nature, and in general our fragmentary perception of the universe as though it were the sum
of intrinsically separate, self-existent and unconnected entities, has made us worse than the
men with the elephant. It has led us to develop and implement the technological project
aimed at destroying the parts of the world that annoy us and appropriating those that please
us, which has seriously impaired the functionality of the worldwide ecosystem of which we
are parts and on which our survival as a species depends. A popular Western author
illustrated this by saying that our incapacity to grasp the unity of the coin of life led us to
develop and apply powerful corrosives in order to destroy the side that we deemed
undesirable—death, illness, pain, troubles, etc.—and to protect the side we considered
desirable—life, health, pleasure, comfort, etc. Those corrosives, by boring a hole through
the coin, now are on the verge of destroying the side we were intent on preserving.22
In order to illustrate the narrow and fragmentary state of consciousness inherent in
avidya-marigpa that a tradition associated with the Kalachakra Tantra calls “small spacetime-knowledge,”a23 the Buddha Shakyamuni resorted to the example of a frog that, having
been confined throughout its life to the bottom of a well, thought the sky was a small blue
circle.b This is the type of consciousness illustrated by the famous adage of the tree that
does not allow the individual to see the forest, concerning which Gregory Bateson said
that, when it perceives an arc, it fails to realize that it is part of a circuit. Consequently,
when an arc annoys us, we aim at it our powerful technological weapons, destroying the
circuit of which they are a part; setting fire to the tree in front of us, we burn the forest in
which we stand, bringing about our own destruction. In other of my works,c I explained this
in terms of the structure of the Four Noble Truths:
(1) The current ecological crisis is so grave that, if everything goes on as it is, human
society will be disrupted and life may even come to disappear from the planet, possibly
within the current century. Meanwhile, natural disasters will proliferate, our existence will
become ever more miserable, and an increasing number of human beings will be incapable
of adapting to the social and biological environment, which will give rise to extremely high
levels of stress, neurosis and psychosis, addiction to the most harmful drugs, serious
illnesses and suicides.
(2) There is a primary cause of the ecological crisis, which is the fragmentation of
human perception and extreme selfishness inherent in fully developed avidya. If we feel
and believe ourselves to be inherently separate from the rest of the human species, sooner
or after we will give rise to the religious, social, economic, racial and ideological divisions,
within societies as well as between different human groups, which are at the root of
injustices and conflicts. If we are unaware of ecological interdependence and feel
inherently separate from the rest of the ecosystem, we are likely to wish to destroy the
aspects of nature that disturb us and to appropriate those we wrongly believe will endow us
a
Cf. Tarthang Tulku (1977a).
Tibetan lama Dungse Thinle Norbu Rinpoche often uses this example.
c
Capriles (1994, 2000e, 2003).
b
865
with comfort, pleasure and security—giving rise to the technological project that has
destroyed the systems on which life depends.
(3) There is a solution to the ecological crisis, which lies in the eradication of its
primary cause—the basic human delusion called avidya or marigpa—and of its secondary
causes—the technological project of domination and exploitation of nature and of other
human beings, and the severe political, economic and social inequality.
(4) The Buddhist Path can eradicate the causes of ecological crisis and restore an era of
communitarian, harmonious social organization based on the systemic wisdom that frees us
from the urge to obtain ever more manipulative knowledge, and allows us to use the
knowledge we already possess in ways that are beneficial to the biosphere as a whole, and
to all beings without distinctions.
All of this shows that fully developed avidya, as a delusion, is not unlike the ones
psychiatrists describe as a result of the observation of their psychotic patients—the main
difference between the one and the others being that unanimous consensus causes normal,
socially sanctioned delusion to go unnoticed. As shown in the second volume of this book,
Madhyamika-Prasangika Master Chandrakirti told the fable of a king that consulted a
famous astrologer, who predicted a rainfall of “maddening water” would contaminate the
reservoirs in his kingdom, so that all who drank from them would be driven insane. The
king warned his ministers and subjects to prepare a protected supply of water and avoid
drinking the deranging water. However, the subjects, being less wealthy, exhausted their
reserves more rapidly, and at some point had to drink contaminated water. Since the king
and the ministers did not behave like the subjects who had drunk the maddening water, the
latter concluded that the former had become insane. When the ministers used up their
reserves, they also had to drink the deranging water—upon which the rest of the subjects
thought the ministers had become normal, and all agreed the only one still insane was the
king. Thus in order to keep his kingdom and avoid being impeached and put into an
asylum, the king had no option but to drink the polluted water.a24 As also seen in the
volume in question, in the West Pascal compared the state of mind of normal individuals to
a psychological disorder,b and Erich Fromm reproduced Chandrakirti’s idea almost exactly
when he suggested that our society as a whole is lacking sanity, by noting that,c “Just as
there is a folie à deux there is a folie à millions. So long as space-time-awareness is not
total, perception is fragmentary, and so long as thought is delusorily valued the singled-out
fragments of the whole, being recognized in terms of delusorily-valued thoughts, are taken
to be substantial, isolated essents; therefore, there is delusion, which is the only valid
criterion for diagnosing insanity, and which implies the consequences that derive from a
distorted or inverted perception of reality: a greater or lesser degree of selfishness, of menwith-the-elephant effect, of frog-in-the-well effect, of self-impeded centipede effect,25 and
so on.
The progressive development of delusion impelled the process of degeneration that
followed its course one era after another until, in the Iron Age, Era of Darkness or Dark
Age (kaliyuga), it conceived the project of domination of nature and other human beings,
a
Trungpa (1976); Shah (1970); Chöphel (2005). The original Buddhist version of the story was told in
Chandrakirti, Bodhisattvayogacharyachatuhshatakatika (Tib., dbu ma bzhi brgya pa’i ’grel pa, or Byang
chub sems dpa’i rnal ’byor spyod pa gzhi brgya pa’i rgya cher ’grel pa): a Commentary to Aryadeva’s
Chatuhishataka (Tib., bzhi brgya pa).
b
Pascal (1962).
c
Fromm (1955), pp. 14-15.
866
and set out to implement this project through the development of technology—which,
toward the end of the Age in question, caused delusion to complete its reductio ad
absurdum. The Pythagoreans had already conceived the technological project, which is the
one Goethe described in his famous ballad, The Sorcerer’s Apprentice (a theme that later
on was used by authors as diverse as Karl Marx and Friedrich Engels,a Alan Watts,b José
Lutzenberger,c and Arturo Eichler,d and which was put into music in the famous scherzo by
Paul Dukas, into a cartoon by Walt Disney,e and into a ballet by Helga Swedlund and
Walter Braunfelds): the apprentice used one of his master’s spells to fulfill his duties
effortlessly, but the charm went far beyond his control, and disaster ensued. Scientific
knowledge allows us to develop the magic of technology, which, like the charms of the
sorcerer’s apprentice, makes it possible for us to realize surprising feats—such as flying,
performing colossal tasks without exerting physical effort, and even reaching the moon.
And, just as in the fable of the sorcerer’s apprentice, at some time we lose control of the
charm and wreak havoc on ourselves—in our case, coming to the verge of extinction. Alan
Watts wrote:f
When we fight the environment and disown it, our methods and weapons become part
of it, part of the involuntary and uncontrollable aspect of karma. This, like in the tale of the
sorcerer’s apprentice, is the fate of all power games, not only in the areas of material
power, but also in those of psychic and spiritual power. This is why one should not let
oneself be beguiled by the many forms of psychic and mental discipline that promise ever
greater control over thought and emotion, and even magical powers. All of those
methods—unless they are designed specifically to be self-frustrating and thus to reduce to
absurdity the ambition for power—are simply ego-trips of a highbrow and refined order,
but often they produce such sensational short-term results that people are easily deceived
by the pseudo-gurus who teach them.
Among others, Aldous Huxley in The Perennial Philosophy and John Blofeld in the
Introduction to his version of the I Ching, put forth statements similar to the above.
However, rather than being a recent by-product of technological development, acute
awareness of the dynamics expressed in the fable of the sorcerer’s apprentice seems to have
been widespread in high antiquity, and genuine Wisdom traditions always warned against
this dynamics in their respective fables. Indian mythology featured the character of
Matariswan, who in Greek mythology became Prometheus:26 the demigod who, having
molded a clay statuette, stole the fire from the gods in order to animate it, giving rise to
technology—which we have brought much farther than the ancient Greeks ever dreamed.
Ivan Illich wrote:g
The world of the primitive is governed by fate, facts and necessity. By stealing fire
from the gods, Prometheus turned facts into problems, called necessity into question and
defied fate. Classical man... was aware that he could defy fate-nature-environment, but only
a
Marx & Engels (1970).
Watts (1973).
c
Lutzenberger (1978).
d
Eichler (1987).
e
The famous movie, Fantasy, featuring Mickey Mouse as the sorcerer’s apprentice.
f
Watts (1973). Retranslated into English from the Spanish translation.
g
Illich (1971).
b
867
at his own risk. Contemporary man goes farther; he attempts to create the world in his
image, to build a totally man-made environment, and then discovers that he can do so only
on the condition of constantly remaking himself to fit it. We now must face the fact that
man himself is at stake.
Prometheus, “the one who looks toward the future” or “who makes the polestar
advance”, unleashed Zeus’ wrath by his theft. As a result, the latter sent Pandora and her
box into the world, to let out the evils; he conjured up a deluge that destroyed humankind;27
and he chained Prometheus to a rock in the Caucasus, where vultures would tear at his
liver—which would grow again as soon as the last bit were devoured. Having played at
being Prometheus, we human beings are enduring a torture that, unlike Prometheus’, has
not ceased at the term of thirty years, for no Heracles has the power to unchain us, and
unless we become Noah-like Deucalions, going aboard the Ark and recovering the horn of
plenty, our torment will go on until we destroy our own species and possibly all life on this
planet. For Deucalion to save the waters in the Ark and from Pyrrha beget a new
humankind, Prometheus’ brother, Epimetheus, “the one who looks back”, must marry the
Earth—source both of hope and of the evils—and from her beget Pyrrha. In the JudeoChristian tradition it is said that “the devil is not evil; he only pursues the wrong star.” The
star he pursues is the polestar, which is the star of the North, the star of Prometheus: this is
why E. F. Schumacher declared, “Any activity which fails to recognize a self-limiting
principle is the devil”.a28
The project of modernity stems from the rebellion of the technological Sisyphus
against the spontaneity of becoming, which ancient Greeks misunderstood as “fate”. Our
punishment is the mental state of the modern city-dweller, which, as Illich noted, may be
compared to the torment of Sisyphus, who was chained to an enormous rock he had to roll
up the hill to the pinnacle of hell, but which always slipped when he tried to place it at the
top, dragging him down—so that immediately he had to begin rolling it up again. One of
the versions of the myth presents Sisyphus—the rebellious descendent of Deucalion—as a
paradigm for the homo technicus who has tried to destroy the “negative” side of the coin of
life, attempting to kill death: he managed to temporarily chain Thanatos, so that for a while
no one died on earth. However, since it is impossible to prevent death forever, Thanatos
was liberated and Sisyphus was condemned to suffer his proverbial torment, corresponding
to the mental state of those who have come to live totally outside the Now, hungrily
anticipating a future that—since we are cut from the Now and our attention is directed to
the future—can never become a Now.
Tantalus’ crime was similar to Sisyphus’. Having been invited to the dinner of the
gods, he stole the recipe for the Ambrosia, the panacea bestowing immortality. As a
punishment, he was immersed in a lake to the neck, under trees with branches loaded with
fruit, under a charm that prevented him from eating or drinking, for it caused the waters to
recede when he lowered his mouth toward them, and the trees’ branches to be blown away
by the wind whenever he attempted to reach their fruits: his punishment was the
exacerbation of the sensation of lack inherent in delusion, similar to the one that the mass
media and other elements of modern life have induced in us.
The project of modernity is aptly represented by the biblical story of the tower of
Babel, as an attempt to arrive at paradise through building, by means of linear intelligence,
a
Schumacher (1973).
868
fragmentary vision and delusion, a material structure on earth—which produces an
enormous confusion ending up in a disaster. In the mystical tradition of the Hasidim, the
project we are concerned with is represented by the fable of the Golem. It is well-known
that, according to the Kabbalah, the word is the source of creation (the “four letters” of
God’s name cannot be pronounced, for the creative principle must not be put in the place of
the created and taken for a product of delusorily valued thought); one day, a Hasid decided
to create a servant who would perform his domestic tasks, and to this end he molded a doll
with clay, wrote on its forehead the first, the thirteenth and the last Hebrew letters (aleph,
mem and thau), which spelled word emeth, meaning “truth,” and circumambulated the holy
temple anticlockwise. The homunculus came to life and began to carry out its masters’
household duties, while constantly increasing in size. When the android reached an
inconvenient size, the master was meant to erase the first of the letters on its forehead,
leaving the other two, which formed the word meth, meaning “death”—upon which the
Golem would instantly dissolve and become mud again. Once, when the homunculus was
becoming too big for its master’s household, the latter fell asleep, and so the Golem grew
so much that, when the master woke up, it was about to cause the house to break apart.
Unable to reach the forehead of such an enormous humanoid, the master had to pile up
tables and chairs until, finally, he managed to erase the aleph—whereupon the Golem
instantly dissolve, letting so much mud fall on the Hasid as to bury him and cause his
death.29 In the fiction of our time, it is Dr. Frankenstein who appoints himself as demiurge
and gives life to a Golem, with results analogous to those obtained by the Hasid of the
Hebrew tale.30
The Sufis have similar a similar story, in which a group of ignorant, power-seeking
men who went to see Jesus in order to obtain the word that revived the dead. Initially, Jesus
refused to give it to them, but having realized that the men would only learn from
experience, he gave them the word. When they were walking through the desert on their
way home, they found a heap of bones and, suspecting that Jesus could have deceived
them, they decided to try the word’ s power. As soon as they pronounced it, the bones flew
up and joined into an animal skeleton, were covered with flesh, and became the live wild
beast to which they had belonged—which immediately devoured the would-be sorcerers.
The above stories illustrate the fact that the technological project has reduced
delusion to absurdity by making patent the boomerang effect of the projects and actions
conceived and carried out under delusion. Einstein noted:a
The unleashed power of the atom has changed everything save our modes of thinking,
and we thus drift toward unparalleled catastrophes.
However, what has “changed everything” is modern technology in general, and
what must be changed in order to avert the destruction of humankind by the magic of
technology is not only our ways of thinking, but also—and especially—our experience and
perception. If catalyzed by genuine Wisdom traditions, rather than destroying our species
and the whole of the ecosystem, the “boomerang effect” of technological action will
destroy human delusion, for it is the latter that our scientific-technological project has led
to its reductio ad absurdum.31 This was apparently foreseen by Kant, who in the famed
a
In Gilliam (1986).
869
essay Perpetual Peacea asserted that the word is destined for perpetual peace, which would
come about either through human foresight, or through a series of catastrophes that leave
no other choice. This is also the meaning of the statement by E. F. Schumacher:b
We can say today that man is far too clever to be able to survive without wisdom. No
one is really working for peace unless he is working primarily for the restoration of
wisdom.
The basis of the scientific-technological project is the illusion of omnipotence of
human reason and the distrust of Nature’s holistic, non-conceptual Wisdom: we feel that,
for our earthly existence to be comfortable and pleasant, we must control and dominate
Nature; that the latter is imperfect and that, therefore, we must impose on it the “perfect
order” that we have imagined. To this aim we developed the project of technological
domination of the natural word that in the long run caused the basic delusion that
developed during the entire evolutionary cycle to prove unviable and thus achieve its
experiential reductio ad absurdum. Therefore, now we have the opportunity to overcome
delusion as a species and recover the systemic wisdom and basic virtue it impeded,32 and
only if we succeed in this will we have real possibilities of avoiding extinction as a species
and, if this wisdom and its virtue are recovered on a sufficiently large scale, of entering
either a new Golden Age / Era of Truth / Age of Perfection, or the Millennium of harmony,
spirituality and fulfillment predicted in the Kalachakra Tantra, as well as in the John’s
Apocalypse, in the Book of Ismailians,c and so on.
At this point, it seems pertinent to go beyond mythology and discuss this process in
strictly philosophical terms. Hence the following section summarizes the critique of
Hegel’s philosophy of history, with reference to the relationship between the functioning of
the two brain hemispheres and the two corresponding processes (those that Freud described
in the Project of 1895), which I developed in other two works.d
Hegel’s Modernist Inversion of the Perennial Philosophy of History
Since Hegel believed everything was thought, for him change and movement,
which were at the root of becoming, evolution and history, occurred in the realm of
thought. This implied that each and every new moment in the evolution of our species
necessarily had to negate the content of the previous moment of thought. Thus in a series of
moments a - b - c, moment c would involve the negation of the content of moment b,
which in its turn would involve the negation of the content of moment a; therefore,
moment c would involve the negation of the negation of the content of moment a. Since in
formal logic the negation of a negation restores the condition negated by the negation that
in its turn is negated, if all changes in the physical world were changes in thought, unless a
negation different from that of formal logic were at work, the negation of the negation of
the content of moment a would restore the content of moment a—and hence evolution and
history would be impossible. Thus if change and movement occurred in the realm of
a
Kant (1957).
Schumacher (1973).
c
Under the direction of Brice Parain (1972), p. 281.
d
Capriles (1992, 1994a); referred to in Capriles (2000b); also to be featured in Capriles (work in progress 1,
work in progress 2).
b
870
thought, for there to be becoming, evolution and history, the negation of previous moments
that would make change possible, would have to be of a special kind, totally different from
that of formal logic, which would make it possible for the negation of the content of a past
moment of thought not to return us to the state previous to that moment. Furthermore, since
Hegel believed that the chronological evolution of the human spirit and of human
institutions represented a constant increase in truth and totality, the special negation he
required would have to be of such nature that the incorporation of the negated into a new
thesis would produce an increase in completion and perfection, as well as in truth and
authenticity. Thus he transposed a type of negation that, in case it occurs at all, does so
only in the realm of thought and in specific areas of intellectual activity (for example, in
the succession of some specific scientific theories), to occur both in the dynamic that he
described in the Science of Logic and in the one he described in the Phenomenology of
Mind: what he called Aufhebung or sublation, which he exlained as a dialectical negation
that conserved what it negated, incorporating it into a new position (thesis), and which by
so doing was supposed give rise to an increase in completion and perfection, authenticity
and truth. With regard to this negation, Hegel wrote:a
Surpassing (das Aufheben) expresses its true twofold significance, which we have
already seen in the negative: it is at the same time a negating (Negieren) and a conserving
(Aufbewahren).
When the “dialectical negation” called Aufhebung or sublation in turn was negated,
what the first negation had negated was not restored, for the second negation did not
thereby disappear; contrariwise, both what the first negation had obliterated and the
product of this first negation would be incorporated in the product of the second negation: a
unification (synthesis) that instantly becomes a new position (thesis), and which constitutes
greater truth, authenticity and totality than the two former stages: the one that had been the
object of the first negation and the one that had resulted from this first negation and that
had been the object of the second negation.
The negation characteristic of formal logic is the same to formal logicians, to Hegel
and to the author of this book; however, even concerning this negation I have a
fundamental disagreement with Hegel. Since the German philosopher held, not only that
the conceptual map corresponded exactly to the territory it interpreted, but that the map
was itself the territory, he believed we should take the map to be absolutely true but to be
necessarily self-contradictory insofar as reality itself was contradictory. The higher
Buddhist teachings, and in particular the Dzogchen teachings, on the contrary, stress the
fact that the map is not the territory, and that it is the delusory valuation of the map that
gives rise to the mistaken belief in the ultimately contradictory character of the two
extremes of any of the dualities produced by formal logical negation. This belief is
destroyed by the manifestation of the Self-qua-Path, which involves the dissolution of the
delusory valuation of thought and which, qua boundless panoramic condition, embraces the
indivisible continuum from deluded mind artificially abstracts the opposites produced by
the negation of formal logic. Thus when the delusory valuation of thought is reestablished,
the practitioner is aware that neither extreme of a duality—for example, a and not-a—can
correspond precisely to that which it interprets, and that both extremes imply each other,
a
Hegel (1976), Book I, pp. 97-98. I translated the quotation from Spanish into English.
871
depend on each other to be what they are, and are artificially abstracted within an
indivisible whole. Therefore, in the Self-qua-Path what delusion takes to be opposites
coincide, for it involves the nonconceptual realization of the continuum from, when
delusion is functioning, the opposites are abstracted. However, Hegel disparaged this
possibility, which alone can resolve the “problem of life,” for in the discussion of the views
of his fellow German idealists he implied that any kind of surpassing of differentiation
would result in a night in which “all cats are grey”33—or, in German, “all cows are black:”a
To pit this single assertion, that “in the Absolute all is one,” against the organized
whole of determinate and complete knowledge, or of knowledge which at least aims at and
demands complete development — to give out its Absolute as the night in which, as we
say, all cows are black — that is the very naiveté of emptiness of knowledge.
And, in fact, both in the Phenomenology of Mind and in the Lectures on the
Philosophy of Religion, Hegel dismissed Eastern Wisdom traditions for reasons quite
similar to these, and placed Eastern thought in one of the lowest stages of development of
Mind, previous to the one attained by the Ancient Greeks.
Let us go back to the consideration of the Hegelian “dialectical negation” called
Aufhebung or sublation. We say that in our sensations all is movement and change.
However, the idea of movement and change only may arise once thought compares what
sensitiveness shows in two successive moments, implicitly negating the condition shown in
the first moment, as it has been replaced by the condition shown in the second moment.
This negation does not take place in that which is interpreted, which is not conceptual and
cannot contemplate the possibility of negation, but in the interpretation that—contrarily to
Hegel’s beliefs and in this respect to some extent in agreement with the views of cardinal
Nicholas of Cusa—can never correspond exactly to that which it interprets.34
In these terms, it is legitimate to understand the determination (Bestimmung) carried
out by thought in terms of Spinoza’s principle Omnis determinatio negatio est
(“determination is always a negation”) and to affirm, as Hegel did,b that determination is
always a negation of the indeterminate. However, it would be necessary to make it clear
that determination, understood in this sense, is a process that takes place in thought, and
that thought neither is the same as what it interprets, nor corresponds to it exactly;
therefore, thought is not responsible for the constant movement that takes place in
sensitiveness and that common sense interprets as changes in the physical world, but only
for our perception and understanding of those changes. (The only way to explain this
unequivocally in a way that all may understand is in terms of an example: imagine I am
facing the road with open eyes as a car passes; if the corresponding sensa occur but I do not
recognize them in terms of concepts, there will be no perception and therefore no
consciousness that there were changes, or, far less, that “a car passed.” In fact, this is
precisely what occurs if the one facing the road is engrossed in an absorption of the neutral
condition of the base-of-all: if after the individual come out of the absorption someone asks
her or him whether a car passed, she or he might be unable to reply.) As we have seen,
though in terms of the Dzogchen teachings both thoughts and the sensa that thought
interprets are manifestations of the energy or thukjec aspect of the Self-qua-Base, they
a
Hegel (1955).
Hegel (1976).
c
thugs rje.
b
872
belong to two different forms of manifestation of this energy or thukje: thoughts are
manifestations of the danga form of manifestation of energy, whereas the sensa that we
perceive as the so-called “physical” reality are forms of the tselb form of manifestation of
energy. Furthermore, as already noted repeatedly and as I have shown by means of a
plethora of arguments in other of my works,c contrarily to Hegel’s beliefs thought can
never correspond exactly to what it interprets (below, this will be briefly discussed in terms
of the impossibility of the digital to correspond to the analog, but many other relevant
arguments will not be considered).
Nonetheless, negation has a leading role in processes of phenomenological
development,35 including the one Hegel dealt with in the Phenomenology of Mind (but
which he understood invertedly); the point is that, as shown in the above paragraph,
negation is involved in the succession of thought-conditioned, human states of mind, rather
than in what equivocally may be called “successive conditions of sensitiveness:” unlike
sensitiveness, states of mind are determined by the delusorily-valued thoughts conditioning
them, and thus are subject to logic—though not to a reversible abstract logic like formal
logic as it applies to mathematics. The type of negation that takes place in processes of
phenomenological development (as defined in the note to this paragraph) is the one that I
have called phenomenological negation, which in fact does conserve what it negates but,
instead of giving rise to an increase of truth, plenitude and authenticity, results in an
increase of error/delusion (falsehood), fragmentation and unauthenticity. This negation,
like all negations, takes place in thought, and so when it applies to something other than the
states of mind determined by delusorily-valued thought, the increase in falsehood lies in
the ensuing greater discrepancy between the map, which we confuse with the territory, and
the territory itself; however; when it refers to the states of mind determined by delusorilyvalued thought, it modifies the territory, for it makes states of mind (which in this case are
the territory) become ever more inauthentic.
Double negations such as Sartre’s bad faith (which, it should be remembered, is
explained as “negating and in the same operation negating one has negated something”)
and the one Ronald D. Laing illustrated with the diagram of the spiral of pretences
reproduced and explained in a previous chapter of this book (which, qua explanations
circumscribed to secondary process, provide what is no more than a partial and quite
inaccurate explanation of a process the most important part of which lies in primary
process), are paradigmatic instances of phenomenological double negation as I am
understanding the term. Unlike logical processes, which are reversible and thus
characteristically atemporal insofar as the negation of what was formerly posited annuls it,
phenomenological processes of the kind Laing described involve the irreversibility proper
to temporality, in the sense that the negation of whatever was formerly posited conceals it
rather than annulling it, and thereby asserts it and sustains it.36 (In the diagram by Laing
reproduced in vol. II of this book, B is a phenomenological negation of A;37 whereas in a
logical process the negation of B qua negation of A would again be A, in a
phenomenological process of this kind the negation of the negation of A represented as B,
rather than being A, is an imitation of A—which is what the diagram represents as A1.
Therefore, contrarily to Hegel’s Aufhebung or sublation, which was supposed to increase
a
gdangs.
rtsal.
c
Capriles (1994a, 1999b, 2000a), etc.
b
873
plenitude and truth but which is not found in phenomenological processes (it may seem to
occur in non-phenomenological processes such as scientific development, in which new
theories very often negate older ones while retaining a great deal of what they posited—as
Washburn’sa example of the negation / incorporation of Newtonian physics by Einstenian
physics—but what happens in these cases is that logical negation is applied to some aspects
of the older theory but not to other aspects). Thus understood, phenomenological double
negation conserves what it negates because, rather than canceling it or dissolving it, it
gives rise to the illusion of having surpassed it—and since illusion is a synonym of untruth,
phenomenological double negation gives rise to an increase in untruth rather than in truth.
Furthermore, we have seen that the Self-qua-Base is an undivided continuum, that our
fragmentary perception of this continuum is a function of the basic error or delusion that
the Buddha called avidya and that Heraclitus called lethe, and that the gradual increase of
this error or delusion as the cosmic cycle proceeds, gives rise to a proportional increase of
our fragmentary perception; since phenomenological negation increases error / delusion
insofar as it gives rise to a new pretence and a new deceit, rather than increasing truth,
plenitude and authenticity, it increases falsehood, fragmentation and unauthenticity. This is
substantiated by the fact that the research by ethnoecologists in the Amazon that will be
reported below in this chapter has shown that “primitive” human beings had an awareness
of interconnections that allowed them to improve biodiversity, whereas the research by
Tom Dale and Vernon Gill Carter that will also be reported below, as well as the current
ecological crisis, show that modern humans have such an unawareness of interconnections
as to have produced a technology allowing us to destroy segments of the web of life,
whereby we have destroyed biodiversity and in general the physical basis of life to such a
degree that presently the survival of life on the planet is at stake. The philosophy of history
that Hegel laid down in the Phenomenology of Mind refused to see that the only negation
that conserves what it negates is the phenomenological negation explained here, and in
order to support the myth of a gradual increase in truth and wholeness invented his
Aufhebung—which, as we have seen, is a negation that only existed in Hegel’s fantasy.
(The processes I call “phenomenological” are those involving the succession of
states of being rather than the succession of systems of though built on the basis of
secondary process / operative thinking logic; in processes of this kind, the only negation
involved that is different from logical negation is the one under discussion, which increases
fragmentation and falsehood. Understanding processes of this kind as involving Hegel’s
Aufhebung or sublation would only be possible on the basis of the false Hegelian premise
[implicit in Engels’,b38 even though he rejected the idealism on the basis of this error] that
nature and reality in general are a projection of spirit ruled by the secondary process /
operative thinking logic that rules thought, but which are self-contradictory and hence can
only be described dialectically in terms of contradictions. [The phenomenological double
negation that Laing illustrated with the above diagram was contrasted with Hegel’s
Aufhebung or sublation in others of my works.c])
Hegel’s Phenomenology of Mind presents the dialectical process of evolution of
humankind as a process of alienation of Mind in time, which comes to an end with the final
a
Washburn (1995).
Engels (1998/2001).
c
The definitive explanation of this will be found in Capriles (work in progress 2); previous, less precise
explanations were provided in Capriles (1992, 1994a).
b
874
surpassing of this alienation. The first stage in this process is that of sense-certainty, in
which humans lacking self-certainty or, what in this system is the same, lacking selfconsciousness, are aware of sensa as something that is external to them and independent of
them, thus failing to realize that all that they perceive as external things are projections of
Mind. Then as positions give rise to counter-positions, as the former and the latter unify,
and as unifications become new positions, differences between knowledge and truth arise
and are surpassed, giving rise to a gradual increase in truth and wholeness; in particular,
through the dialectic of the master or lord and the slave or serf, self-consciousness qua selfcertainty develops, which hitherto was lacking: according to Hegel, in consciousness of
self qua an autonomous perceiving and acting being, for the first time certainty is the same
as its truth, for what is perceived as true is the subject itself rather than something that
seems to be external to it. The process goes on, until finally self-consciousness, with the
corresponding coincidence of certainty and its truth, recognizes itself in nature, becoming
fully aware that nature is no more than its own projection and that in truth it is neither
separate nor different from itself. Before this moment, each dialectical stage involved first
the difference between knowledge and truth, and then the surpassing of this difference, but
now for the first time—in what Hegel called “science,” or, more specifically, in what he
called the absolute concept—knowledge and truth no longer separate and thus no longer a
separation between them may be surpassed. This is, according to Hegel, the end of the
dialectical process of the Phenomenology of Mind, and hence of the alienation of Mind in
time, upon which, in his view, final perfection is achieved as absolute knowledge.
If we apply Laing’s diagram to human evolution and history, not as Hegel fancied
it, but as interpreted by the traditional cyclic view we have been considering, point A may
represent the state of aletheia or vidya—the absence of the delusion called lethe or avidya
and therefore the absence of the illusion of separateness—corresponding to what I have
been calling the Self-qua-Path, as manifest in the state of Communion of human beings in
the Golden Age, Age of Perfection (krityayuga) or Age of Truth (satyayuga). (As we saw
with regard to Wilber’s pre/trans fallacy, the infant’s “oceanic feeling” as such is quite
different from the manifestation of aletheia in the condition of the Self-qua-Path or of the
Self-qua-Fruit; however, as will be shown below, Wilber is utterly wrong in drawing an
absolute analogy between ontogenesis and phylogenesis, for human beings in the
Primordial Age did not lack the capacity to deal with the world, but on the contrary,
judging by the impact aborigines had on Amazonian biodiversity, they dealt with it far
more effectively than beings of our time, and as will be shown below, rather than lacking
the virtues that manifest as a result of spiritual practice in the context of Wisdom-traditions,
they naturally exhibit many of these virtues, which we lack.)
In terms of this interpretation, point B would represent self-consciousness qua
phenomenological negation of the state represented by A—but which, however, is not the
upshot of a “dialectic of lord and serf”—as it arises and, with the passing of time, gradually
develops in the post-Communion state. Rather than being, as Hegel believed, the first
manifestation of a condition in which certainty is the same as its truth, self-consciousness is
the root of the self-impediment that in the poem caused the centipede to fall into the pit,
and, as shown in the above quotation from the Wen-tzu, attributed to Lao-tzu,a is what
eradicated intrinsic virtue (i.e., the te or virtue inherent in the patency of the tao). (How and
why self-consciousness eradicates intrinsic virtue was considered in the section of a former
a
Lao-tzu (1994), chap. 172, pp. 245-7.
875
chapter dealing with the arising of the Jungian shadow understood in terms of Susan
Isaacs’ concept of unconscious phantasy.)
Finally, in terms of the same interpretation, point A1, rather than representing the
reestablishment of aletheia / vidya and the concomitant primordial perfection after the term
of the cosmic cycle, would symbolize a delusive attainment of the kind that Chögyam
Trungpa Rinpoche subsumed under the term “spiritual materialism” and that I subsumed
under the term “path of darkness.” In fact, Hegel’s “self-consciousness’ self-recognition in
Nature,” which he posited as the highest possible human attainment, if it were an actual
mystical experience, would be one of these delusive attainments, for it would simulate the
lack of separateness characteristic of the condition represented by A, while conserving and
incorporating the illusion of separateness and self-consciousness corresponding to B, and
as such would be further removed from Truth than preceding states: qua phenomenological
negation of the negation that Laing’s diagram represents as B, it involves greater error /
delusion and fragmentation than B and, in general, than all preceding conditions. What
Hegel posited as the final result of human evolution is supposed to be a representation that
has become infinite in order to include difference within itself, but such a thing is
impossible, for representations must be recognizable, and recognition depends upon
contrast and exclusion, which imply finiteness: as in the case of the formless absorptions of
Buddhism, representations that seem infinite, rather than being infinite, involve the illusion
of infinitude. Gilles Deleuze was right in noting that attaining the infinite amounted to
attaining a universal lack of difference,a and, although Deleuze was far from realizing this,
if such lack of difference is not to be an absorption of the neutral base-of-all in which we
are useless to both human society and ourselves, and in which we waste the possibilities
inherent in the human condition, it must be and can only be the one that is attained by
going beyond delusory valuation at the root of samsara and beyond the unawareness of the
true condition of the Base at the root of the neutral condition of the base-of-all, in the
condition of the Self-qua-Path of Self-qua-Fruit. To sum up, the final result of Hegel’s
process, represented by point A1 in Laing’s diagram, is no more than an illusion produced
by self-consciousness and involving the self-deceit that Sartre called “bad faith” and that
Laing referred to as “elusion.”
Søren Kierkegaard denounced Hegel’s concept of a transition that, despite not being
gradual, never arrives at a breakthrough and always conserves an element of the former
stage. The Danish thinker warned against the deceit inherent in reason, which has the
function of unifying and identifying, and implied authenticity lay in immersing ourselves in
the vortex of existence, not eluding the Angst that in his view was inherent in the
insurmountable abyss that parts the finite from the infinite, or the forlornness in which the
limited subjectivity of the human individual is suspended in the nothingness of Angst. Thus
he laid the immediate bases of Existenzphilosophie and existentialism—as well as of the
meta-existential system expounded in this book, in terms of which Angst is inherent in selfconsciousness, which is spuriousness itself, but according to which refusing to elude Angst
is far more authentic than eluding it. However, the idea is not to remain stuck in Angst, but
to use it as a springboard—not in order to take a “leap” (German, Sprung; Danish,
Springet) from the ethical to the religious dimension as in Kierkegaard, but in order to go
beyond self-consciousness in the unveiling of the Self-qua-Base. As we have seen, Hegel
a
Deleuze (1995).
876
disparaged this possibility, implying that any kind of surpassing of differentiation would
result in a night in which “all cats are grey.”
So far, Hegel’s explanation of human evolution and history has been shown to be
inverted because it explains as an increase in completeness and perfection what in fact is an
increase in the illusory fragmentation that conceals the original completeness and inhibits
the original perfection of our true condition. Furthermore, Hegel’s system as a whole has
been shown to be definitely wrong in viewing the map and the territory as being
indistinguishable. Now it is necessary to add that his system further involves the error or
drawing a map in exclusively digital terms, in order to represent a territory that is normally
experienced as analog. Consider this (slightly modified) quotation from another of my
works:a
The analog being continuous and the digital being discontinuous, there cannot be a
perfect correspondence between them.39 This is evident in the case of digital photographs:
the greater the number of pixels per square inch (ppi) in the photograph, the less the naked
eye will notice the lack of correspondence between the photograph and the object it
represents; however, if you look at the picture through a magnifying glass, or through a
microscope, you will realize that no matter how high the number of pixels per square inch,
there is still an insurmountable gap between the digital picture and the analog object it
reproduces. Likewise, if you send a spaceship to Mars, in order to predetermine its
trajectory you will have to put many numbers (which are digital representations)40 after the
comma if the engine is to have any chance of reaching its aim—and yet, as the ship
advances, its trajectory will have to be constantly modified so that it will not miss its aim.
In the case of concepts that are not numbers and their referents, the impossibility of
correspondence if far more evident, for as shown by the Madhyamikas the attempt to
establish a perfect correspondence between the ones and the others results in sheer
contradiction.
The Madhyamikas in India and Zenon of Elea in Greece were aware that digital
maps cannot correspond precisely to the analog territory, and that attempts to make it
correspond univocally to it result in contradiction; therefore, the former based on these
facts many of their refutations of the premises of common sense and of metaphysical and
religious fictions, and the latter used them for their respective purposes (which seem to
have been contrary to those of the Madhyamikas41). This, however, would not have worked
in the case of Hegel, for as we have seen he thought conceptual maps were
indistinguishable from the territory they interpret, and the fact that attempts to make the
map correspond exactly to the territory inevitably resulted in contradictions in the map
meant “things themselves are contradictory;”b in fact, according to Hegel, in order to be
correct, the map had to violate the principle of non-contradiction (for example, for
something to move, it would have to simultaneously be and not be in the same place).42
Spinoza referred to an error consisting in “the incomplete and abstract.” Spinoza
was a rationalist and his views differ radically from the ones expounded in this book;
however, the latter coincide with his wording, for the error or delusion that developed
throughout the cosmic cycle involves the incomplete—in the sense of “fragmentary”—
comprehension resulting from the abstraction of segments of the given. Though, as shown
a
b
Capriles (2004).
Hegel (1976).
877
in a previous chapter, the negations consciousness carries out in terms of the digital code of
secondary process catalyze the development of the delusion called lethe or avidya toward
its own reductio ad absurdum, this development itself proceeds analogically rather than
digitally. This was ignored by Hegel, who was right in noting the relation between the
dialectical process and the logical procedure of reductio ad absurdum, and in asserting that
error was revealed as such by the contradictions it produced (a principle that, as will be
shown below in terms of the objections raised by McTaggart Ellis, applies to error as
conceived in this book, but not as Hegel conceived it), but who erred in limiting this
reductio ad absurdum to contradictions inherent in the theses that manifest in secondary
process in each dialectical stage and that he wrongly took to lie not only in the map but also
in the territory from which in his view the map was indistinguishable and which was but
the map’s projection, to be achieved through the consequences that showed those theses to
involve a contradiction. As we have seen, the contradiction that develops throughout
human evolution and history is one inherent in the basic delusion called avidya or lethe,
and its reductio ad absurdum is completed at the end of the cosmic cycle, as it produces the
ecological crisis that puts at stake the continuity of life on the planet (and which manifests
on the plane of the ecosphere, on that of society, and on that of the individual).
Provided that we keep in mind that human evolution and history consist in the
development of a delusion characterized by incompleteness and abstraction, that the
development of this delusion takes place mainly in the analog primary process, that the
map is not the territory, and that digital maps cannot correspond to the analog territory of
the given, it may be valid to say that, from a digital standpoint that does not at all exhaust
the process, that evolution and history may be seen as a succession of positions, negations
and unifications-that-become-positions. However, it must be kept in mind that what this
process does is to increase and reveal as such the original delusion / error / contradiction,
the gradual development of which gave rise to the instrumental reason that conceived and
implemented science and the technological project concomitant with it (for, as Herbert
Marcuse correctly noted, science is by its very nature instrumental, and so it can but deliver
the means for domination of the natural environment and other human beingsa43), and
which in its turn was boosted by this project, which gradually transformed into conflict the
contradiction inherent in basic delusion and progressively obstructed the functioning at the
root of this delusion—thus proving that the latter, its technological project and the type of
reason at the root of this project, do not work, and making it possible for the original
delusion / error / contradiction to fall by its own weight.
The above is based on the Hegelian thesis that, in human evolution and history,
error reveals itself as such by the contradictions it produces. However, this idea does not
seem to work in the context of Hegel’s system, for, as McTaggart Ellis showed,b on the one
hand Hegel insisted that reality and the ideas interpreting it (which as we have seen in his
view are inseparable and indivisible) are inherently self-contradictory (so that, for example,
for something to move it had at the same time to be and not to be in the same place) and,
on the other, he asserted that error unveils through the contradictions it generates. If all is
contradictory and in order to describe reality accurately it is necessary to do so in terms of
contradictory statements, how could contradictions reveal error as such?44 Nevertheless, as
a
“From Negative to Positive Thinking: Technological Rationality and the Logic of Domination,” ch. 6 of
Marcuse (1964).
b
McTaggart (1931, 1999-2000, 2000).
878
will be shown below, the thesis according to which error reveals itself as such by the
contradictions it produces does work in the system outlined here, in which it has been
compounded with the Marxist principle that “whenever there is a difference there is a
contradiction” and with Marx’s thesis that in order to resolve unjustified social, economic
and political contradictions (to which in our age ecological contradictions should be
added), these must reveal themselves as such so that they turn into conflict and this may
drive us to surpass them. However, for this to make sense I have to explain in most precise
terms what is it that I mean by contradiction—particularly insofar as in various works I
have insisted that according to Madhyamika philosophy the same territory may be validly
(though not correctly)45 understood in terms of mutually contradictory maps,a which
implies that contradiction in description does not imply that there is error or delusion, and
therefore I could be accused of incurring in an error similar to the one McTaggart
denounced in Hegel.
What I mean by contradiction does not lie in the simultaneous application of
contradictory concepts to the same segment of reality, but in our experience of this as
contradictory, which results from the delusory valuation of those concepts. This may be
thoroughly understood in terms of the following excerpt from a recent work of mine:b46
Chandrakirti [asserted] that one should not have “own mind,” that one must not affirm
anything “from one’s own heart,” or that one should not make “self-directed” or “interiordirected assertions” (Tib., rang rgyud du khes len pa) — and therefore that one should only
make “other-directed” or “exterior-directed assertions” (Tib., gzhan ngo khas len).47 “To
have own mind,” “to affirm from one’s heart” or “to make self-directed / interior-directed
assertions” was the same as “to have theses of one’s own:” to take as true whatever one
thinks or asserts without the intention to deceive others, and to take the contrary of this as
false. Therefore, “not to have own mind” or its synonyms expressed an essential trait of
fully realized individuals, for, insofar as they are utterly free from [the delusory valuation
of] concepts and other thoughts, they do not take anything they say as being absolutely true
or false: whatever they say arises beyond [delusory valuation] as the spontaneous function
of Awakening that naturally leads beings beyond samsara...
Since, as we have seen, “other-directed” or “exterior-directed” assertions are those that
are made without believing them to be true, the lies told by ordinary beings belong to this
category. However, when ordinary beings speak, independently of whether they “lie” or
“say the truth,” their assertions are totally incorrect, in the sense that they are a function of
delusion — and whatever is thought or said under delusion is incorrect, for delusion is itself
incorrectness. The point is that, since they cannot avoid [the delusory valuation of] their
own thoughts and assertions, ordinary beings wrongly take their “interior-directed”
assertions to be absolutely true, and wrongly take their lies to be totally untrue: being
deluded, in contradiction with Prajñaparamita Sutras like the Vajrachchedikac and with
Madhyamika thought, they take forms to be either existent or nonexistent, and if they take
something to be existent they will perceive themselves as lying if they say it is nonexistent
(and vice-versa): this is the reason why all they say is incorrect, and it is also the reason
why, if they assert what they believe to be untrue while being connected to a polygraph, the
machine will detect a lie. Contrariwise, whatever the Buddhas say, being always “othera
Capriles (1994a, 2004, 2005), etc.
Capriles (2005).
c
Vajracchedikaprajñaparamita; Tib., rdo rje gcod pa (Diamond Cutter Sutra). (A Complete Catalogue of the
Tibetan Buddhist Canon [Tohoku University catalogue of the sde ge edition of the Canon, Ed. H. Ui et al.,
Sendai, 1934], 16).
b
879
directed” or “exterior-directed,” is totally correct, for insofar as they are totally free from
[the delusory valuation of] thought (and thus utterly undeceived and free from the power of
conventional truth — which, as Gendün Chöphel shows in his text,a is “deluded truth”),
they do not experience their assertions as being either true or false: they do not take forms
as being either existent of nonexistent. Therefore, if they assert something and immediately
negate it, in neither case will the polygraph register a lie: This is the reason why the
Maharatnakutasutra,b quoted in Gendün Chöphel’s text,c says, “Existence and
nonexistence contradict each other; pure and impure also contradict each other; because of
contradiction, suffering cannot be calmed; when contradiction is no more, suffering comes
to an end...” “Surpassing contradiction” does not mean “never asserting the opposite of
whatever one affirmed in the past;” it means going beyond the [delusory valuation of
thought] that causes one to perceive a contradiction in making contradictory assertions, and
that hence causes the polygraph to detect a lie when one of the two contradictory assertions
is made.
In fact, insofar as the assertions made by Awake Ones are part of the spontaneous
activities whereby they lead beings to Awakening, upon making them they (are) totally
beyond action, beyond intention, beyond self-consciousness and beyond judging in terms of
right or wrong. In the Bodhicharyavatara we read:d
“[Objection] How can there exist a liberated being?
“[Madhyamika] He is false imagination in the mind of another, but he does not exist
because of conventional truth on his own part. After something has been established it
exists; if not, it does not exist even as conventional truth.”
The above means that Buddhists who lived at the time of Shakyamuni through their
false imagination perceived Shakyamuni as a Buddha, but Shakyamuni, who was not
subject to false imagination, did neither perceive himself as a Buddha, nor perceive others
as deluded sentient beings; therefore, in all that he asserted there was no own-mind, and
hence his assertions were ... “assertions made from the perspectives of others”...
The stanzas by Shantideva coincide with Jigme Lingpa’s assertion that, though
Buddhist sentient beings may perceive Buddhas as carrying out countless activities on their
behalf, Buddhas perceive no beings that must be helped, and harbor no intentions to help
beings. The point is that, since Buddhas are free from [the delusory valuation of] the
threefold thought-structure (Tib., ’khor gsum), whatever they do is an instance of what is
called “action and fruit [of action] devoid of the concept of the three spheres” (’khor gsum
rnam par mi rtog pa’i las dang ’bras bu): from their own standpoint they are beyond
activity — and yet sentient beings, if they are devout Buddhists and are able to recognize
the Buddhas as such, see the latter as carrying out countless activities on their behalf. This
is why the terms “other-directed” and “exterior-directed” do not categorize the actionless
activities of the Buddhas precisely: Buddhas perceive no others and no exterior, and
therefore, although here I decided to follow the terminology that prevails in Chöphel’s
book and call their assertions “other-directed” or “exterior-directed,” in truth these belong
to a category different from that of the “exterior-directed” or “other-directed” assertions
made by sentient beings — which are the lies they say — and properly speaking should not
be referred to by the same words, but should be called “assertions from the perspectives of
others.” And this is also why “purpose” is a term that does not apply to the Buddhas.
a
Chöphel (2005).
Maharatnakutadharmaparyayashatasahasrikagranthasutra; Tib., dkon mchog brtsegs pa chen po’i chos kyi
rnam grangs le’u stong phrag brgya pa’i mdo (Heap of Jewels Sutra). Peking Edition of the Tibetan
Tripitaka (Tokyo-Kyoto: Tibetan Tripitaka Research Foundation, 1956) 760, Vol.22-24.
c
Chöphel (2005).
d
Shantideva (1996), IX. 107, p. 126.
b
880
In turn, superior Bodhisattvas (which are those in the third and fourth Bodhisattva
paths, or, which is the same, those ranging between the first and tenth levels [Skt., bhumi;
Tib., sa]) have no “own mind” and hold no theses “from the heart” while they are in the
state of Contemplation (Skt., samahita; Tib., mnyam bzhag), but they do so again while in
the state of post-Contemplation (Skt., prishthalabdha; Tib., rjes thob), in which [the
delusory valuation of] thought has been reactivated. However, as they advance on the Path,
delusion is progressively neutralized, and so the strength of [the delusory valuation of]
thought in the state of post-Contemplation is progressively mitigated — which implies that
the strength of the delusive appearances that manifest in that state diminishes. Furthermore,
having experientially realized, while in the Contemplation state, that the illusions resulting
from [the delusory valuation of] thought are mere illusions, while in the postContemplation state they maintain some awareness of this fact (which is why the relative
truth that manifests in this state is called “correct relative truth” [Skt., tathyasamvritisatya;
Tib., yang dag pa’i kun rdzob bden pa]). Therefore, in this state they posit theses that are
mainly “other-directed” or “exterior-directed,” but that to a great extent are also “interiordirected” (and, in fact, in order to continue on the Path they still need to believe that there is
a final Buddhahood and a means to proceed toward it, as well as a series of Dharma truths
to be accepted); therefore, the conceptual positions they adopt are to a great extent correct.
Finally, Bodhisattvas who have not yet reached the third Bodhisattva path (or, which is
the same, the first level) and who therefore have never gone beyond the state of “inverted /
incorrect relative truth” (Skt., mithyasamvritisatya; Tib., log pa’i kun rdzob bden pa) in
which there is no awareness of the illusion-like character of phenomena, in order to lead
both themselves and others to Awakening, must posit from the heart theses that as such are
wholly “self-directed” or “interior-directed:” they must posit from the heart all that is
written in canonical sources having definitive meaninga (but do not have to do likewise
with what is written in sources of provisional meaningb, for in the case of the latter they
have to ascertain the true import of the text and then posit from the heart what they have
ascertained).48
Thus the basic contradiction that must unveil as such for it to become conflict, so
that finally it may be surpassed, is the one inherent in the error or delusion called avidya or
lethe, which involves the fragmentary perception that has as its condition of possibilityc a
narrow focus of conscious awareness / low energetic-volume-determining-the-scope-ofawareness and that I characterized in Spinozian terms as involving incompleteness and
abstraction, and which, rather than consisting in the application of contradictory concepts
to the same segment of reality at the same time, lies in the delusory valuation of thought
that makes us believe conceptual maps correspond exactly to the territory they interpret and
/ or mistake them for it, and perceive contradictory concepts (such as a and not-a) as
mutually incompatible. It is due to this error that when we human beings interpret the
territory in terms of conceptual maps, we cannot simultaneously entertain a and not-a
without experiencing a contradiction. Since a and not-a are not in the territory but in the
map, and since no map can correspond exactly to the territory it interprets, Hegel was
wrong in claiming that reality was itself contradictory.
The Marxist principle according to which “whenever there is a difference there is a
contradiction” certainly could not mean that, so far as there are mountains and plains,
a
Skt., nitartha; Tib., ngedön (nges don).
Skt., neyartha; Tib., drangdön (drang don).
c
Ger. Bedingungen der Möglichkeit; the term is being used in a nonKantian way.
b
881
wetness and dryness, males and females, etc., there will be contradictions to overcome. In
Marxism, it is implicitly understood that this assertion is circumscribed to the social,
economic and political ambits. However, as shown in the above quotation, in these planes,
as in all other ones, we perceive contradictions only so far as the delusory valuation of
thought is working. Hence from the perspective of the above quotation,a which is that of
the present book, the thesis according to which “whenever there is a difference there is a
contradiction” could only make sense if by “difference” we understood “experience of
differences” (or, if we preferred to employ the language of Je Tsongkhapa, “experience of
differences as inherently existent”), for such experience is a manifestation and a function of
the basic contradiction that is the delusion called lethe or avidya. Thus from this
perspective it would convenient to reformulate the Marxist principle under consideration as
follows: “wherever differentiation—or, which is the same, conceptualization—is delusorily
valued, there is a contradiction (i.e., a manifestation of the basic contradiction that is avidya
/ lethe).”
Does the above mean that, since contradiction does not lie in the apparently
objective situations we perceive as unjust, but in their delusorily valuation, we must get rid
of delusory valuation and let injustices be? Of course not. All injustices result from the
development of delusory valuation, and at the present point in degenerative evolution they
have achieved their reductio ad absurdum, for the only way the human species can survive
in an extremely overpopulated, polluted, ill planet such as ours is if a small portion of the
global population stops consuming more than all the rest put together, and all achieve
equitable, relatively frugal levels of consumption.49 In fact, survival and the inception of a
New Age of Communion and harmony depend on overcoming the delusion involving a
narrow focus of conscious awareness and the delusory valuation of thought, together with
the products of this delusion—and, among the latter, specially the antagonisms between
human beings and the unjustified social, economic and political differences between them,
and the hostility of humans to the rest of the ecosphere at the root of what Gregory Bateson
referred to as “conscious purpose versus nature.”b Since in our time delusory valuation has
become so strong, all human beings experience seemingly “objective” divisions as
contradictions (even though many may not be willing to admit this) and have to face the
pain and conflict issuing from them; therefore, we have the duty of working toward
resolving those contradictions.
Thus the “true” contradiction impelling human degenerative evolution lies in the
basic delusion involving a narrow focus of conscious awareness and the delusory valuation
of thought, and the unveiling of contradiction as such must give rise to an irrepressible
impulse to overcome this basic delusion. However, as noted above, so long as we perceive
“objective” situations as contradictions and we and / or other individuals suffer because of
them, it is our responsibility to work toward changing these situations, in no lesser measure
than it is our responsibility to rid ourselves of the basic delusion that is the ultimate source
of the situations in question. Conversely, though some may feel the need to put an end to
the situations they perceive as “objective” to be so urgent and imperative that they should
postpone the task of overcoming basic delusion in order to dedicate all of their time and
energy to change these situations, since the law of inverted effect is inherent in basic
a
b
Capriles (2005).
Bateson (1968); also in Bateson (1971).
882
delusion, all actions aimed at modifying those situations, if based on this delusion, will
give rise to results contrary to the ones intended.
Should the above be understood to mean that we have to wait until we have rid
ourselves of delusion to begin working to act on the ecological, social and political planes?
Since this might delay change beyond the threshold at which the destruction of the web of
life becomes irreparable, we must work simultaneously on all planes. (Since I discussed
this matter to great length in other works,a I will not enter into its detailed discussion here.)
The following paragraphs may illustrate the reasons why we cannot give rise to a new Age
of Truth / Golden Age or to a Millennium of Harmony and Fulfillment so long as we are
possessed by the basic delusion called avidya or lethe, and at the same time show the sense
in which the dialectical principle of the contraries’ change into their opposites may validly
posited.
In terms of the relation between primary process and secondary process, or, which
is the same, between the computations of the brain’s two hemispheres, one of which is
analog and the other digital, it must be noted that, since in the former, which is
determinant, the emphasis is on the type of relations taking place between individuals
rather than on who is who in those relations, and since in it there is no possibility of
entertaining negatives, once a type of primary process relations develop (for example,
instrumental subject-object relations) there is no way conscious intention, which works in
terms of digital secondary process, may either undo them at will or circumscribe them to
one field. On the contrary, as shown in a previous chapter (IN VOL. II OF THIS BOOK?),
any attempt by conscious intention to control analog primary process will be subject to the
law of inverted effect and produce results opposite to the ones intended. This is a reason
why Jürgen Habermas’ proposal that relations between humans should be communicative
and relations between humans and the natural environment be instrumentalb (which might
have been inspired by Engels’ idea that in the communism that he and Marx posited as last
stage of human society, rather than dominating human beings, we would dominate nature
and inanimate things) is impracticable—and, were it practicable, it would not solve
anything, for the current crisis is the result of our instrumental relations with the natural
environment.50 It is also the reason why Emilio Estiú was right when he noted that,c
A subject surrounded by mere objects ends up objectifying the subjects themselves.
This is why [Heidegger says that) “modern science and the totalitarian State are, at the
same time, consequences and sequences in the essence of technology.”
And it is also the reason why (to some extent under the influence of Heidegger’s
views, which in this regard are quite sound,d and to some extent due to what has been taken
to be a misinterpretation of Husserl’s viewse51) Herbert Marcuse asserted that the natural
science of modernity is by its very structure and function committed to a view of nature as
a
Principally, in Capriles (1994a), but also in some minor works. A book in English circulating under my
signature, dated 1988 and claiming to have been published in Mérida, Venezuela, but with no reference to the
publishers, does not express my views in this regard.
b
Habermas (1982).
c
Estiú (1980). The words by Heidegger quoted by Estiú are from (1977), German Edition of 1950 (Frankfurt
am Main), p. 267.
d
Heidegger (1977).
e
Husserl (1970).
883
an object to be manipulated and controlled; that a science of human beings based on the
model of the natural sciences is thereby committed to an analogous view of those beings as
objects to be manipulated and controlled; and that therefore there is a necessary relation
between the scientific domination of nature and the scientific domination of human beings.a
The dynamics of the relations between primary process and secondary process also
explains why, just as in the case of the individual going through the inner journey
represented by the Divine Comedy discussed in the seventh chapter of this book, in the
degenerative evolution of our species the primary process relationships that do not work
have to increase until they achieve their reductio ad absurdum in ecological crisis and,
upon going beyond a threshold level, spontaneously collapse like a elastic band that breaks
upon being stretched beyond its maximum resistance—which is what happens at the end of
the aeon or cosmic cycle, when delusion, and therefore the phenomenon of being and the
experience of time as such, disintegrate.52 And just as in the case of the individual, this
comes to pass because the discomfort produced by the patterns that must be overcome
activates a positive feedback loop that pushes the organism in the direction of its
symptoms—and that, as Bateson noted, could correspond to what Freud called Thanatos,
but that, as I have noted, is catalyzed by consciousness’ reactions in terms of secondary
process.53 This is why Indian mystic-philosopher Sri Aurobindo asserted that:b54
The end of a stage of evolution is normally characterized by a powerful recrudescence
of all that has to go out of the evolution.
In the development of delusion that, as we have seen, is catalyzed by the positive
feedback loop inherent in the relations between primary process and secondary process, as
primary process relations develop, from the limited standpoint of secondary process it may
be to some extent valid to see this development in terms of a succession of positions,
negations and unifications-that-become-positions. Thus, the phenomenon of
“transformation of the opposites into each other” that in Hegel’s view characterizes
dialectical development, and which Marxism applies in its own way to the succession of
economic and social systems, could be said to result from the fact that, while the primary
process relation develops, in secondary process the position of actors change. For example,
in a relation of oppression, the oppressed revolt, but since the relation of oppression has not
changed in the primary process of the insurgents, when they seize power they will take the
place of the oppressors—that is, will switch the secondary-process-position they occupy in
the primary-process-relation of oppression—and so, though they impose new doctrines and
systems, they will oppress others just as their predecessors had done (and perhaps even
more so)—to be likely overthrown at some point by those they had oppressed. Thus, in the
French Revolution the bourgeoisie toppled the aristocracy that had oppressed it, taking the
place of the oppressor and oppressing the proletariat and the peasants far more than they
had been oppressed before. And something similar occurred later on with the Bolshevik
Revolution (though in this case most of those who took power did not belong to the social
class that, according to Marx, should implement the “proletariat’s dictatorship”—which, by
a
“From Negative to Positive Thinking: Technological Rationality and the Logic of Domination:” ch. 6 of
Marcuse (1964).
b
Aurobindo (1955); Satprem (1973).
884
the way, because of its very structure and function could never lead to the extinction of the
State and therefore of the power of some human beings over the rest55).
This means that the primary process relation gradually accentuates itself while, in
secondary process, somehow subjects may be said to switch places. For example, in the
development of the cosmic cycle, initially the state of Communion free of delusion
alternates with a state of incipient, mild delusion in which primary process relations are of
a kind that may be termed “pan-communicative.” As Communion becomes hardly
accessible to most human beings, delusion becomes more pronounced, and, as will be
shown later on, with the arising of the vertical relation that is expressed in art as the rise of
the gods, primary process relations become instrumental; then, through the positive
feedback loop that, as we have seen, is impelled by conscious reactions in secondary
process, this instrumentality is exacerbated until it achieves its reductio ad absurdum in
ecological crisis—which is the reductio ad absurdum of the basic delusion that, upon
developing beyond a certain point, manifested as instrumental primary process relations.
The outcome of this is that finally instrumental relations, and not only these relations but
delusion as well, may be spontaneously disconnected. Since to some extent from the
standpoint of secondary process the development of the cosmic cycle may be seen as a
dialectical development, in a limited sense it may be said that when delusion is
disconnected the dialectical process is disconnected.
If, following Bateson, we affirm that the “positive feedback loop” that is the motor
of the process of experiential reductio ad absurdum, and that process itself, are what Freud
called Thanatos, then we have to say that the unfolding of delusion that is the true reality
behind that which Hegel called “dialectical process” is blindly and waywardly driven and
catalyzed by Thanatos (which, despite its being associated with tropisms such as the one
described by Brodey and discussed in a previous chapter, is not an instinct, and depends on
our intentional actions) toward the threshold at which the spontaneous liberation of this
dynamics in the manifestation of the Self-qua-Path introduces a dynamics of spontaneous
disconnection of Thanatic positive feedback loops, re-orienting the process in an obviously
healthy direction. Then, the process is no longer catalyzed solely by the Thanatos, but also
by the repeated spontaneous liberation of the basic contradiction (basic human delusion),
and by the systemic Wisdom arising from recurrent spontaneous liberation. This
reintroduces the Communion that was so frequent in the Era of Perfection, Age of Truth or
Golden Age, which in this case is the manifestation of the Self-qua-Path, and the frequent
repetition of which progressively mitigates delusory valuation and results in an awareness
of illusoriness, so that when the delusion called avidya or lethe manifests, it does so in a
much milder way, as it did in the Primordial Age (where, as we will see below, this
awareness of illusoriness was accompanied by the capacity to recognize as such the
different modes of experience, so that people knew they had to avoid the “real” physical
tiger but not so the tiger of dream states); therefore, post-humans will not be as different
from primal humans as some could imagine.
The above shows that the development of the species through the cosmic cycle is
analogous to the experience of the aeon that takes place in the practice of Dzogchen and
which is catalyzed by practices such as those of Thögel and the Yangthik: the process
begins with systemic activities of the type I have called morphodysgenesis, which go on
until what I have called metamorphy occurs; then continues with systemic activities that, as
we have seen, involve what I have called morphoeugenesis but that go beyond
morphogenesis; finally, the systemic activities work toward the consolidation of the Awake
885
condition, just as does the process that Dante represented as an ascension through
successive heavens.
In this section I have considered Hegel’s thought at some length. Schopenhauer,
who in his book On the Basis of Morality asserted that Hegel scribbled nonsense quite
unlike any mortal before him, except perhaps for those in the madhouse,a might have
complained that I took Hegel too seriously and made his thought seem too coherent.
Though I agree that there is a lot of nonsense in Hegel’s works, and I regard his basic
views as being far more inverted than Marx and Engels ever believed, the fact that I have
been able to use many of Hegel’s categories and basic ideas shows that, if the views I
express in this book were plausible, there could be no doubt that the German philosopher,
no matter how much hubris he may have exhibited and how much he may have tried to
hide his weaknesses by scribbling nonsense, had quite a few valid, most relevant intuitions.
The same applies to Marx and even Engels: though (to some extent here, and to a far
greater extent elsewhereb) I have shown the blatant contradiction between their aims and
the methods through which they intended to achieve those aims, and though I agree with
the general objections raised by nonviolent anarchist prince Piotr Kropotkin, with the
refutations of their conception of the stone age carried out by anthropologists and
ethnologists including Pierre Clastres and Marshal Sahlins, and with the criticisms that
anarchists like Abraham Guillén and libertarian Marxists such as Rosa Luxemburg, Anton
Pannekoek and Cornelius Castoriadis directed against the praxis of officially Marxist
states, the fact that in various of my works I have been able to use some of their categories
and basic ideas shows that, if the views I express in the works in question were plausible,
there could be no doubt that the couple of German revolutionaries had quite a few valid and
most relevant intuitions.
Wilber’s Modernist Inversion of the Perennial Philosophy of History
And the Traditionalist Movement’s Reactionary Distortion of It
We have seen repeatedly that being is the most basic of delusive phenomena, and
that having more being, rather than amounting to comprising more truth and being closer to
the unveiling of the Self-qua-Base (as Ken Wilber and other Western authors seem to
believe it is the case), amounts to having less truth and further concealing the Self-quaBase. In the preceding chapter, the gradation of being was related to human phylogenesis,
and although it was shown that being increases with as human spiritual and social
evolution go on (a point with which I believe Wilber and his like would possibly agree),
this increase of being and the concomitant, proportional acceleration of our subjective
experience of the passing of time, were explained as an increase of delusion toward its
empirical reductio ad absurdum—which, as shown throughout this chapter, in
phylogenesis is achieved when delusion, in its attempts to improve the human condition by
technological means, gives rise to the current ecological crisis, which unless delusion be
surpassed and a radical change in all planes be achieved, would destroy our species and
possibly all life on this planet. The crumbling of delusion would be the crumbling of being
and time, and would allow a new cycle to begin.
a
b
Schopenhauer (1965).
Capriles (1994a).
886
Wilber’s views concerning human phylogenesis, like those of the Theosophical
Society, despite sharing the merit of upholding democratic values (which, however, have
been allegedly betrayed by the Indian and other branches of the Society), are clear upshots
of the modern paradigm, which has conditioned us to view human spiritual and social
evolution as a process of progressive improvement leading to a future condition of
perfection, and has simultaneously furthered scientism—to such an extent, that most people
(including critics of modernity such as the so-called “postmodern” philosophers and
sociologists, and transpersonal psychologists who dared to contest the prevailing views
concerning human sanity) shy before contesting scientism56 and find scandalous the
degenerative view of spiritual and social evolution. Only a few independent writers and
thinkers (such as, among others, Steven Taylor,a with whose egalitarian views I
sympathize), together with the elitist members of the extreme right-wing Traditionalist
movement57 (such as René Guénon,b Frithjof Schuon,c Martin Lingsd and Jean Bièse), have
dared to publicly profess and expound the degenerative vision of human evolution and
history. However, although the Traditionalist movement has the merit of rejecting
scientism and the progressive view proper to modernity, it exhibits reactionary capital
vices, such as seeking the restoration of the Muslim Caliphate (in which it coincides with
al-Qaida) or some similar medieval theocracy, and adamantly rejecting all non-creationist
and non-theist views. In this regard, the Middle Way is the one expressed in this book,
which agrees that the process of human evolution is a degenerative one, but rather than
positing theism or creationism, or insisting on the supposed need to revert to a previous
stage of history, proposes that the current historical process be allowed to go ahead, but be
catalyzed by traditional wisdom and concomitant spiritual methods, so that the reductio ad
absurdum of delusion and of all that arose with it, rather than resulting in the destruction of
humankind, may give rise to a New Age of harmony such as the Millennium announced in
the Kalachakra Tantra and so on, or the next Golden Age, Era of Truth or Age of
Perfection—but which in either case should involve a direct democracy in which all turn
toward the wisest for counsel.
In fact, despite the abundant, striking evidence supporting the degenerative view of
human evolution and history,f Ken Wilber decidedly sided with Eurocentric, neo-colonial
social-spiritual evolutionisms such as those of Jürgen Habermasg and Beck & Cowan,h
which he compounded with the mistaken conception of ontogenesis in terms of the
“spectrum of consciousness” refuted in the preceding chapter,58 to posit a precise
correspondence between phylogenesis and ontogenesis, making the former involve the
same stages he posited with regard to the latter, and concluding that “primitive” human
beings were incapable of going beyond a quite low stage of “spiritual evolution,” and
a
Taylor (2003, 2005).
Guénon (1945, 1947/1991, 2003).
c
Schuon (1984).
d
Lings (2002).
e
Biès (1985).
f
Among the works that collect relevant evidence from many source I find worth mentioning Capriles (1994a,
2000b), and, most overwhelmingly, Taylor (2003, 2005).
g
Habermas (1979).
h
Beck & Cowan (1996).
b
887
therefore that Awakening was barred to them (though in 2000a he made this rule more
flexible). Steven Taylor summarizes Wilber’s views in this regard:a
On the one hand there is what Wilber calls the ‘Retro-romantic’ view, which holds that
primal peoples were more ‘spiritual’ than modern human beings. They possessed a strong
sense of connection to the cosmos and an awareness of esoteric forces and phenomena,
both of which we have lost. With the development of our powerful intellect and strong
sense of ego—and especially with the development of modern industrial civilization—we
‘Fell’ away from their higher state of being.
But according to Wilber (e.g., 1995), this is to fall victim to the pre/trans fallacy.
Applying his spectrum of consciousness model to phylogenetic development, Wilber
argues that primal peoples were at a pre-personal level of consciousness. The huntergatherers of the Paleolithic Era belonged to what he calls the typhonic stage of evolution,
which is characterized by ‘magical thinking’, including voodoo practices, taboos, and an
animistic worldview. The farmers of the Neolithic Era, beginning around 10,000 BCE,
belonged to the mythic stage, where individuals began to realize that magic no longer
works and instead projected the existence of elaborate systems of gods, demons, and other
forces. At around 2,500 BCE the ‘solar ego stage’ began, with the ‘low egoic’ phase lasting
until 500 BCE when the current ‘high ego’ began. Only at this stage did human beings
become capable of rationality and hypothetico-deductive reasoning; and only at this stage
did human beings become capable of experiencing the higher transpersonal levels,
including nirvikalpa samadhi itself. Every age has an ‘average’ level of consciousness, and
some gifted individuals are able to ‘jump’ from that level to the higher realms, but because
their average level was relatively low, earlier human beings could not leap the full height of
the spectrum. Even during the mythic stage individuals could only ‘peak’ at the psychic
realms, which they attained with the help of shamanic rituals and trances (Wilber, 1981,
1995). Recently, however, Wilber (2000a) has modified this view, and now suggests that “a
truly developed shaman in a magical culture, having evolved various postconventional
capacities, would be able to authentically experience the transpersonal realms (mostly the
psychic, but also, on occasion, subtle and perhaps causal)” (p. 146, my italics).
We have seen that, according to Wilber, the final level of spiritual evolution lies in
the attainment of the ninth fulcrum, which is the one he calls causal, and the associated full
realization of the tenth fulcrum—the absolute, which would be the source of all other
levels. However, before 2000a he claimed that before 500 BCE it was impossible for any
human being to attain this realm (which he makes correspond to full Awakening), and also
that average individuals belonging to primal peoples of the Stone Age and tribal peoples of
our time do not go beyond fulcrum-2 or in the best of cases fulcrum-3—though in 2000a he
modified this view and claimed that (though very rarely) it may be possible for “a truly
developed shaman” to experience the seventh and on occasion the eighth, and perhaps even
the ninth fulcrum. Furthermore, according to our author, from the spiritual perspective,
since its beginnings humankind has been in a process of perfecting propelled by the atman
telos of evolution, and taking place either through a series of leads or through a slow
progressive forward movementb—which leads to the conclusion that the state of mind that
gave rise to the current ecological crisis, and that if not surpassed will put an end to human
a
b
Taylor (2003), p. 61.
Wilber (1981).
888
society and quite likely human life and perhaps all life on this planet, is the highest stage
achieved so far in this process of perfecting!
I do not know whether or not Wilber was influenced by the Theosophical Society,
but at any rate what he has done to the traditional view of evolution and history of the
Wisdom traditions he claims to follow, practice and vindicate, is very similar to what the
Theosophical Society did to the exoteric Buddhist doctrine of rebirth: they insisted that,
just as Darwin’s view of evolution implied perfecting and progress, so it had to be with
rebirth, which therefore could occur from lower species to “higher” ones, but not the other
way around—so that, for example, animals could take rebirth as humans but not the
reverse. And, just like the founding mothers and fathers of the Theosophical Society seem
to have believed they had improved the views of Buddhism by making them agree with
modern scientist beliefs which they took for an ultimately true revelation of modernity,
Wilber seems to believe he bettered Wisdom traditions by ridding them of views that
modern evolutionism has “surpassed.” However, all that he has done is to express the neocolonial prejudice according to which Europe and its extensions are at the fore-front of a
process of universal perfecting, whereas primal peoples are “backward” and in some way
inferior—which he compounded with the Theosophical view that Asian traditions are
extremely valuable but have been surpassed by the scientific evolution led by Europe and
its extensions (and, one must assume, in particular by his own theories).
The true paradox with Wilber’s evolutionistic Eurocentrism is that it outright
contradicts some of the central views of Wisdom-traditions that Wilber vindicates in his
writings—namely, the degenerative vision of spiritual and social evolution and the view
that the most notorious products of this evolution are noxious. In particular, Wilber has
studied under H. H. Pema Norbu (Penor) Rinpoche the teachings of Nyingmapa Tibetan
Buddhism (in particular, those of the supreme vehicle of this tradition, which is the
Atiyoga-Dzogchen), which uphold the degenerative view of evolution and explain it in
terms of the already considered succession of foura or threeb eras, beginning with an era
(yuga) of perfection (krita) and truth (satya), and concluding with a destruction and
renewal at the end of an era (yuga) of darkness or blackness (kali). If Wilber accepts these
teachings and yet rejects their view of evolution as a degenerative process, we may infer
that he considers that he is in a higher stage of rationality than primordial masters (tönpasc)
such as Shenrab Miwoche and Garab Dorje, and than masters such as Padmasambhava,
Jetsun Senge Wangchuk, Longchen Rabjampa and Jigme Lingpa, among other of the
greatest Dzogchen Masters of the last 3000 years—and that this has made him able to
amend a deviation in the conception of evolution and history that plagued the Dzogchen
teachings.
Furthermore, according to the Rigpa Rangshar Tantrad of the Upadeshavarga or
Menngagdee series of the Dzogchen teachings,f it was at the earliest and hence most primal
a
For Nyingmapa/Dzogchen explanations of the kalpa or cosmic cycle in terms of four successive eras or
yugas, each more degenerate than the preceding, cf. Dudjom Rinpoche (1991); Kongtrul Lodrö Tayé (1995).
b
For a Nyingmapa/Dzogchen explanation of the kalpa or cosmic cycle in terms of three successive eras or
yugas, each more degenerate than the preceding, cf. Padmasambhava (1977).
c
ston pa.
d
Cited in Namkhai Norbu & Clemente (1999), pp. 22-26 and p. 265, n. 23 (pp. 23-27 and p. 23, n. 13 of the
Italian version).
e
man ngag sde or man ngag gyi sde.
f
In the rnying ma’i rgyud bcu bdun, vol. I, pp. 389-855, Delhi 1989 (pp. 162 et seq.).
889
stage of humankind that there manifested the first of the twelve tönpas (tönpa chunyia) or
primordial revealers of Dzogchen teachings, the perfect Master Khyeu Nangwa Tampa
Samgyi Mikhyappa, who lived at the time when the span of a human lifetime was
unlimited (as corresponds to the psychological condition which a tradition associated with
the Kalachakra Tantra called “Total Space-Time-Awareness”,b which Zurvanism called
Zurvan,c and which Shaivism called Mahakala or “total time”d), and who, after full
Awakening, communicated to his perfect entourage of disciples59 the Drataljur Chenpo
Gyüe (the fundamental Tantra of the Upadeshavarga or Menngagdef series of Dzogchen
teachings and foundation of all teachings), which was transcribed by the divine beings
Gajed Wangchuk and Nyima Raptu Nangjed. Thereafter, eleven other tönpas or primordial
revealers manifested successfully: the second flourished when the span of a human lifetime
was of ten million years (so slow was the subjective experience of time at the period)—and
so on, until the time of Buddha Shakyamuni and the supreme Master Garab Dorje, when
the span of a lifetime was of one hundred years (Garab Dorje being a manifestation that
Shakyamuni emanated in order to transmit the Dzogchen teachings). Each and every time
circumstances associated with the passing of time caused a type of teaching to disappear or
become incomplete, a new primordial master reintroduced it in the human world.60 Surely
for Wilber this is all mythological, for in terms of his schema the highest teachings leading
to full Awakening must have arisen after 500 BCE, and quite likely were improved
thereafter through successive generations of Masters, until he himself led them to final
perfection by modifying the philosophy of history of the Dzogchen teachings and implying
that there were no primordial masters before Shakyamuni.
We have seen that Steven Taylorg noted that Wilber’s stance concerning primal
peoples (just as those of Habermash and Beck & Cowani) have uncomfortable echoes of the
Eurocentric colonial mentality, which saw those peoples as inferior or backwards, and
which posited European developments as products of higher evolution that demonstrate the
superiority of the European peoples. For example, Wilber claims political democracy such
as the one that developed in Europe is impossible to primal peoples, despite the fact that
nowadays it is well-known that the latter’s democracy was truer insofar as it was direct
rather than representative, and that US democracy was to a great extent inspired by the
Iroquois aborigines; he claims that sexual equality, which has not yet been attained either
in Europe or North America, was impossible to primal peoples, even though nowadays it is
well-known that sexual inequity has increased with the passing of time, having been
exacerbated by Semitic and Indo-European influence. As Sean Kellyj points out, to say that
the hunter-gatherers of the Paleolithic Era belonged to what Wilber calls the typhonic stage
of evolution, and that human beings at this stage were at a pre-personal level of
a
ston pa bcu gnyis.
Tarthang Tulku (1977a). Capriles (2000a, 2000b, work in progress 1, work in progress 2, work in progress
3).
c
Capriles (2000a, 2000b, work in progress 1, work in progress 2, work in progress 3).
d
Capriles (2000a, 2000b, work in progress 1, work in progress 2, work in progress 3).
e
sgra thal ’gyur chen po’i rgyud, Skt., shabda maha prasanga mula tantra.
f
man ngag sde or man ngag gyi sde.
g
Taylor (2003).
h
Habermas (1979).
i
Beck & Cowan (1995).
j
In Rothberg & Kelly (1998).
b
890
development, was close to suggesting that they were not persons at all, or even that they
were nonhuman. Taylor cites Kelly:a
If so, the same would have to be said for the many aboriginal cultures encountered by
modern, mental-egoic, ‘rational’ cultures capable of formal-operational thinking. Giving
Wilber’s adoption of the principle of ontogenetic recapitulation, this would hold as well for
the very young (or mentally challenged, for that matter) who fail to manifest fully
differentiated operational thinking.
However, Wilber is far from claiming that the rights of such people are like the
rights of animals (such as guinea pigs). This is evident in what Taylor writes right after the
above:b
Similar ‘progressivist’ views were put forward by early neo-colonial thinkers such as
Frazer and Comte, both of whom saw the ‘magical’ religions of primal peoples as the
‘lowest’ expression of religion. According to Comte (in Hamilton, 1995) the primitive
‘fetishistic’ stage is transcended—in sequence—by the polytheistic, monotheistic,
metaphysical and positive stages. To Frazer (1959), the magical stage was transcended by
the religious and the scientific. Freud’s model of phylogenetic development—which he also
believed ran parallel with ontogenesis—puts ‘the primitive’ at the ‘narcissism’ stage of
young children (Freud, 1946).
I am certainly not suggesting that Wilber has a neo-colonial outlook himself, or
accusing him—or Habermas or Beck and Cowan—of fascism. Wilber has written that he
eulogizes primal tribal societies because they are “literally our roots, our foundations, the
basis of all that was to follow... the crucial ground floor upon which so much of history
would have to rest” (1996, p. 175). He has also pointed out that, whatever their position on
the holoarchy, all holons ultimately have ‘Ground Value’, since they are all “a radiant
manifestation of Spirit, of godhead, of Emptiness” (200b, p. 324). Nevertheless, there is a
denigration of primal peoples here which is—I intend to show—unjustified. I believe there
is a great deal of evidence suggesting that primal peoples did possess many of the higher
characteristics that Wilber believes can only arise at the egoic and post-egoic levels. Or
more generally, I believe that in some respects primal tribal cultures reached a higher level
of development than modern postindustrial societies. However, above and beyond this, I
believe that the primary problem is not a parsimonious view of primal peoples, but the
application of ontogenesis to phylogenesis which leads to the parsimonious view. In my
opinion, this application is a fallacy, similar to Wilber’s pre/trans fallacy, in the sense that a
number of superficial similarities prompt one to take the giant leap to complete
identification. Primal peoples seem to possess a simple, undivided consciousness and a
strong sense of connection to the natural world; they also seem to have less developed
powers of rationality and intellect, and a less developed sense of individuality and
separateness. But to leap from these similarities to the conclusion that their level of
consciousness is exactly that of ontogenetic fulcrum 2 or 3, and that they share exactly the
same state of pre-egoic fusion which children experience, is unwarranted. Wilber himself
recognizes that the application of ontogenesis to phylogenesis is sometimes unfounded,
noting that there are “many places that strict onto/phylo parallels break down” (Wilber,
2000a, p. 146), but in my view the matter is much more problematic than he believes.
a
b
Kelly (1996), p. 121, cited in Taylor (2003), p. 62.
Taylor (2003), pp. 62-63.
891
When Taylor uses the term “holon,” he is using it in Wilber’s sense, as referring to
the human individual, rather than in the sense given it by Sartre, or in my own modification
of this sense. It is important to reiterate that in primal humans a state of Communion,
which is nonrelational, alternates with a relational post-Communion state.61 The words by
Chuang Tzu cited in a previous chapter, which set the infant as the paradigm of mental
health, fully apply to the Buddhas, and to a great extent to higher bodhisattvas in the
Contemplation state and to primal human beings in the state of Communion; therefore, it is
clear that there is a partial analogy between all of them. However, as noted in a previous
chapter, in our age infants are quite egocentric, they lack the capacity to effectively deal
with reality, and they are most prone to be conditioned, whereas Buddhas cannot be
conditioned, exhibit no traces of egocentrism, and are incomparably more skillful than selfconscious humans—for their activities being unselfconscious, they are not subject to the
self-hindering “centipede effect” inherent in self-consciousness, and yet in them the whole
learning achieved in the process of ontogenesis is unconsciously active. In the postContemplation state, superior bodhisattvas also incorporate the learning achieved
throughout their lifetime, which is much higher than the one achieved by ordinary
individuals, and though they are not free from self-hindering, they are subject to it to a
lower degree than ordinary human beings. Finally, the state of post-Communion of primal
humans is to a great degree analogous to the post-Contemplation state of higher
bodhisattvas, in which they again perceive the so-called external world as external, and
make differences of all types that could never be made by infants, but in which they are far
less affected by the ill-effects of delusion than ordinary human beings of our time, and, as
will be shown below, exhibit far greater wisdom than these.62
My main disagreement with Taylor lies in the fact that, although he outright rejects
Wilber’s view of phylogenesis, he accepts and eulogizes Wilber’s “spectrum of
consciousness” view of ontogenesis. Since this spectrum does not fully apply even to
ontogenesis, for, as shown in the preceding chapter, in terms of Buddhism the higher fulcra
are altogether mistaken, and yet he relates them to the successive attainments of the
Mahayana, the problem is not merely that it is wrong to map this spectrum unto
phylogenesis, but mainly that the spectrum itself is defective.
As to whether or not Wilber has a neo-colonial or a fascist outlook, it does not seem
that he may be accused of fascism in the literal sense of the term, for he seems to believe in
the U.S. model of “democracy,” but he certainly seems to have a neo-colonial outlook, for
the model of “democracy” in question is limited to chosing between two parties that share
the same neo-colonial project, which they express in different ways (and, by the way, that
model is designed for excluding other possible parties from elegibility, is designed in such
a way as to make policies depend on lobbying by transnationals and other elitistic interest
groups, and excludes direct election—not even to mention direct or at least participative
democracy). In fact, Wilber’s political project lies in seeking a synthesis of the positions of
George Bush Jr, Bill Clinton (heads of two US administrations that subsequently refused to
sign the Kyoto treatise, among countless other blemishes), Tony Blair (enthussiastic and
most inconditional ally of Bush in the project and invasion of Iraq), and Gerhard Schroeder
/ Angela Merkel.63 He writes:a
a
Wilber (2000c).
892
Politics. I have been working with Drexel Sprecher, Lawrence Chickering, Don Beck,
Jim Garrison, Jack Crittenden, and several others toward an all-level, all-quadrant political
theory (in addition to working with the writings of political theorists too numerous to list).
We have been involved with advisors to Bill Clinton, Al Gore, Tony Blair, and George W.
Bush, among others. There is a surprisingly strong desire, around the world, to find a "Third
Way" that unites the best of liberal and conservative--President Clinton's Vital Center,
George W. Bush's Compassionate Conservatism, Germany’s Neue Mitte, Tony Blair's Third
Way, and Thabo Mbeki’s African Renaissance, to name a few—and many theorists are
finding an all-level, all-quadrant framework to be the sturdiest foundation for such.
Here is what I consider to be my own particular theoretical orientation, developed largely
on my own, which has then become a framework for discussions with these other theorists,
who bring their own original ideas for a cross-fertilization. I will first indicate my own
thoughts, and then the areas where these other theorists have helped me enormously.
In the last chapter of Up from Eden ("Republicans, Democrats, and Mystics"), I made the
observation that, when it comes to the cause of human suffering, liberals tend to believe in
objective causation, whereas conservatives tend to believe in subjective causation. That is, if
an individual is suffering, the typical liberal tends to blame objective social institutions (if
you are poor it is because you are oppressed by society), whereas the typical conservative
tends to blame subjective factors (if you are poor it is because you are lazy). Thus, the liberal
recommends objective social interventions: redistribute the wealth, change social institutions
so that they produce fairer outcomes, evenly slice the economic pie, aim for equality among
all. The typical conservative recommends that we instill family values, demand that
individuals assume more responsibility for themselves, tighten up slack moral standards
(often by embracing traditional religious values), encourage a work ethic, reward
achievement, and so on.
In other words, the typical liberal believes mostly in Right-Hand causation, the typical
conservative believes mostly in Left-Hand causation. (Don't let the terminology of the
quadrants confuse you--the political Left believes in Right-Hand causation, the political
Right believes in Left-Hand causation; had I been thinking of political theory when I
arbitrarily arranged the quadrants, I would probably have aligned them to match).
The important point is that the first step toward a Third Way that integrates the best of
liberal and conservative is to recognize that both the interior quadrants and the exterior
quadrants are equally real and equally important. We consequently must address both
interior factors (values, meaning, morals, the development of consciousness) and exterior
factors (economic conditions, material wellbeing, technological advance, social safety net,
environment)--in short, a true Third Way would emphasize both interior development and
exterior development.
It is significant that Wilber accepts and employs the newspeak term “Compassionate
Conservatism” as a way of referring to Bush’s policies against the poor in his own country
(another example of which is Bush’s vetoing the law granting state medical coverage to
poor children in October 207) and against the peoples of the Third World (the latter of
which led to the extermination of hundreds of thousands Iraqis64 and to the horrors of
Guantanamo and Abu Ghraib), does not list among the ideologies and positions he tries to
synthesize, even moderate, mainstream, relatively environment-friendly positions such as
those of the European Green parties (Al Gore writes in favor of ecological conservation,
but while he was vice-President to Clinton the US refused to sign the Kyoto treaty, and he
is reputed to personally produce much more CO2 than average US citizens). And he does
not even mention socialism, Marxism or anarchism. In short, though Wilber cites Fritjhof
893
Schuon approvingly, he seems to be nearer the Theosophic Society than the Traditionalist
Movement.
Actually, I think that Wilber is to transpersonal psychology, to Eastern spirituality in
the West, and in general to emerging spiritual forces in the West, what State Department
propagandist Francis Fukuyama was to political ideology: his views are instrumental in
keeping potential dissidents within the ego-camp, capitalist, antiecological establishment.
In fact, I believe Wilber’s harsh, unpolite criticism of ecofeminists, feminists in general,
deep ecologists and so on may be due to the fact that they threaten the status quo: on the
economic plane they are a threat to capitalism; on the social plane they are a threat to all
manifestations of stratification; on the political plane they are a threat to the prevailing
media-manipulated, lobbying-based pseudo-democracy; etc. At any rate, as the books on
Engaged Buddhisma have made it clear and as will be shown in the corresponding section
of this volume, the Buddhist canonical texts, as well as the writing of the most important
Buddhist Masters, whenever they touch upon politics and social and economic
organization, express an egalitarian and social oriented perspective, which as Wilber’s own
words make it patent, the US integral author contradicts. Thus it is clear that, in the name
of Buddhism, Wilber contradicts the Buddhist vision of the individual Path of Awakening
(cf. the discussion of Wilber in vol. I of this book), turns upside down the Tantric and
Dzogchen view of history (as shown in the discussion in the present volume), and runs
counter to Buddhist political, economic and social orientations.
“Scientific Evidence” Sustaining the Perennial Philosophy of History
and Refutation of the Inversions of Hegel, Marx, Engels, Habermas and Wilber
In order to dispel the prejudices associated with the view of phylogenesis as a
process of progressive perfecting led by Europe and its extensions, in different guises and
modalities shared by Hegel, Positivist and Neo-Positivist philosophy, Habermas, Beck and
Cowan and Ken Wilber, among many others, it seems vital to provide so-called “scientific
evidence” of the greater wisdom and more enlightened social characteristics of primal
peoples. Thereby I do not intend to demonstrate what so-called “postmodern” thinkers
would call the degenerative metanarrative concerning evolution and history, for as will be
shown in a subsequent section of this chapter, I do not share the scientist belief that the
sciences prove hypotheses. All I intend to show is that modern scientism is wrong in
assuming that what it views as “scientific evidence” supports the modern metanarrative of
progress, for the “findings of the sciences” lend far more weight to the degenerative
metanarrative that I expound in this book than they do to what has been called the modern
“myth of eternal progress.”b
Firstly, it must be noted that, according to the findings of ethnoecology that
Philippe Descola reported in an important paper,c in the Amazon, where the topsoil is
extremely poor, regions that have been inhabited for a longer time exhibit a higher degree
of biodiversity than those that have been inhabited for shorter time or that are as yet
uninhabited—which seems to show that the intuitive wisdom of the aborigines was such
that their interventions on the environment optimized ecological relations. This is the very
a
Insert data of all newly obtained publications on the subject plus the ones alerady in Bibliography.
Armand (1998).
c
Descola (1996).
b
894
opposite of what happens with human civilizations, which, as Tom Dale and Vernon Gill
Carter have shown,a repeatedly destroyed themselves by irrationally preying on their
environment, and which, in the case of Western civilization, at some point developed what
Gregory Bateson called a “conscious purpose against nature.”b As Arturo Eichler has
noted,c in Mexico the ancient Lacandons used to grow 70 different crops in a single acre,
whereas those Amazonian aborigines who have not yet been exterminated grow up to 80
varied crops in their small plots, which they never overexploit. They know that many
weeds are indexes of the quality of the soil or of some lack; upon restituting the balance of
the soil (e.g., by adding a new crop, or increasing one crop and reducing another, etc.), the
weed disappears. In Peru, a group of anthropologists restored a pre-Columbian system of
channels for irrigation and natural fertilization, achieving a yield per acre much higher than
the average obtained worldwide with chemical fertilizers. Hence the question is definitely
not whether primal peoples or civilized ones are more destructive, but whether or not the
former are potentially as destructive as the latter, and the latter’s destructiveness is due to
the greater population and demographic concentration of civilized social groups—and
whether the progression from the primal state to civilization is an automatic consequence
of the increase in population, or the product of the development of ego-delusion and in
general of a psychological mutation. Regarding the first point, Wilber’s view is that primal
peoples could not have ecological awareness, for they lacked “formal operational
cognition.” After citing Sheldrake’sd remark that the mammoth, the gigant armadillo of
South America and the pigmey hippopotamus of Cyprus may have been droven into
extinction by overhunting, and quoting Roszak’s remarks that some human groups of high
antiquity caused ecological disasters,65 cited abundant evidence of the ecolological
awareness of what he calls “primal peoples,”e66 Steven Taylor concluded that, “while some
unfallen peoples may have lacked foresight in their treatment of the natural world, it seems
that many of them do manage heir resources a lot more sensibly than we do. However, the
Fall is not something that occurred at some point, but a continuous, gradual ongoing
process occurring throughout human spiritual and social evolution, and hence the point
seems to be that the peoples that caused ecological disasters were already relativel
advanced in the process of degenerative spiritual evolution. At any rate, Taylor explicitly
rejects Wilber’s view as follows:f
...I dispute Wilber’s view that primal peoples were potentially—apart from their lack of
technology—as environmentally destructive as we are... [together with his view—as
expressed in (1995), for example] that ecological awareness can only arise with formal
operational cognition, when we become capable of grasping mutual interrelationships. But
surely there is another kind of ecological awareness which is nonrelational, and which
stems from the sense of empathic connection with the natural world—in other words, from
direct perceptual awareness of a shared sense of being, rather than from rationality.
a
Dale & Carter (1955).
Bateson (1968); also in Bateson (1972).
c
Eichler (1987), p. 86.
d
Sheldrake (1991).
e
Taylor (2003), ch. 14, section Primal Ecolological Awareness et seq., pp. 120 et seq.
f
Taylor (2003), p. 68.
b
895
I wonder how would Wilber explain the reactions of American aborigines’ to the
European invaders’ attitude to the rest of the ecosphere.67 At any rate, it is important to
note that Taylor’s remarks in this regard fit into the model of the degenerative evolution of
humankind we have been discussing, according to which the earliest stage of humankind is
one in which a nonrelational state of Communion alternates with a state that is relational
but in which relations are communicative, and later on the capacity for Communion
diminishes, so that the nonrelational state becomes rare and in the relational state
instrumental relations come to prevail.
Concerning ethics and morality, it is clear that humans in what I call the pre-ethical
period exhibited virtues that are absent in humans of the ethical period, who exhibit the
vices that constitute the opposites of those virtues. As Martine Lochouarn stated in an
important paper,a on the basis of the study of a very large quantity of European and NorthAfrican human fossils from the Paleolithic and the Neolithic, paleopathology has
established that in those eras human beings did not die from traumatisms caused by other
human beings, and that, on the contrary, whenever possible wounds and traumatisms
caused by the attack of animals or by accidents were cured with the help of other
individuals—whereas, in our time, many thousands of human beings die everyday from the
violence exerted by other human beings in wars, ethnic conflicts and common crime.
(Paleopathology has also discovered other surprising facts; according to Time & Life’s The
Library of Curious & Unusual Facts, in Europe brain surgery was performed many
thousands of years ago, and 80% of patients survived.) The cultures of hunter-gatherers,
horticulturalists and so on that anthropologists have been able to observe in the last few
centuries are far distant from the truly primal societies of the Paleolithic and even from
those of the early Neolithic, and yet researchers have found them to be highly unwarlike. In
the words of Steven Taylor:b
The great majority of primal cultures are also strikingly unwarlike. Lenski (1978)
notes, for example, that for hunter-gatherers “the incidence of violence is strikingly low ...
Warfare is uncommon and violence between members of the same group is infrequent” (p.
422). This was also true during the early to middle Neolithic period of history, when simple
horticultural societies developed. As Lenski notes, “there is little evidence of warfare
during the early Neolithic. Graves rarely contain weapons and most communities had no
walls or other defenses ... Later in the Neolithic the picture changed drastically and warfare
became increasingly common” (pp. 148-149). The idea that ‘war is as old as humanity’ is
now disputed by the majority of archeologists and anthropologists. In The Origin of War
(1995), for example, J. M. G. van der Dennen surveys over 500 primal peoples, the vast
majority of which he finds to be “highly unwar-like,” with a small proportion who have
mild, low-level, or ritualized warfare. Similarly, R. Brian Ferguson (2000) has stated that
“the global pattern of actual evidence indicates that war as a regular pattern is a relatively
recent development in human history, emerging as our ancestors left the simple, mobile
hunter-gatherer phase” (p. 160)
In other words, when we look back at history we do not see a gradual ascent to present
day Western democracy, equality and (relative) nonmilitarism. First of all, we see an earlier
time when these qualities were already present. The ancient hunter-gatherers and simple
horticulturalists clearly possessed ‘enlightened’ social characteristics which should only,
according to Wilber, manifest themselves at the formal-operational level. Beck and
a
b
Lochouarn (1993).
Taylor (2003), pp. 70-72.
896
Cowan’s view that from 50,000 to 10,000 years ago—when the ‘red meme’ was
dominant—human beings were extremely self-assertive, battling with one another for status
and demanding attention and respect, does not hold true. These authors appear to fall for
the pernicious—and totally unjustified—myth of prehistoric cave-dwelling ‘savages’
whose lives were a harsh and bleak struggle for survival, and who constantly fought over
food and women and used any excuse to bash each other over the head with cubs. Again,
there are hints of a kind of neo-colonialism at work, with a very Victorian—and very
false—view of human history as a slow progression from primitive chaos and ignorance to
increased enlightenment and order.
After this early more ‘idyllic’ phase, we see an apparent ‘Fall’ into war, patriarchy, and
social stratification (as well as greater egocentrism). And later still—during recent
centuries—we see a gradual re-emergence of these ‘higher’ social characteristics. [In fact,]
according to Wilber, enlightened social characteristics such as nonmilitarism, democracy,
and equality can occur when societies as a whole move to the formal-operational level. This
is happening at the present time, and has been since the beginning of the ‘high ego’ or
egoic-rational phase at around 500 BCE. This phase reached its fruition in the sixteenth
century, with the rise of the modern state, and gradually began to manifest itself in the
‘Enlightenment’ principles of equality and democracy. It led to the end of slavery, the end
of autocratic monarchies, women’s rights, workers’ rights, a decline in militarism, and the
like (Wilber, 1995).
It is true that as a result of the later “developments of rationality” in human
evolution the need to assuage injustices arises, as shown by the rise of the idea of human
rights and the ideals of democracy, socialism, sexual equality, etc.; however,
implementation of the idea and ideals in question has not been greatly successful: the
injustices rationality attempts to assuage stem from the development of instrumental,
vertical relations in all fields, and all attempts individuals possessed by these relations
make to put an end to the injustices that stem from the relations in question assert and
conserve the relations at their root, thus failing to put an end to them: slavery was
abolished, but presently it proliferates throughout the world in new (illegal) modalities; the
equality of the sexes was established, but women are fax from upholding the same
positions as men, while domestic and sexist violence is rampant; the idea of human rights
and the ideals of democracy and socialism have become widespread, but to a large extent
they have done so only formally or nominally, for secondary process cannot implant and
enforce ideals that contradict prevailing primary process relations, and so democracy has
become an empty shell of formalities and rituals, while socialism failed to be implemented
in those countries that supposedly adopted it (as Castoriadis has noted, what the ex-Soviet
Union and its satellites implemented was a bureaucratic distortion of State capitalism) and
then its ideals were abandoned in favor of the neo-liberal exacerbation of selfishness and
exploitation (in the term “neo-liberal,” “liberal” has the Smithian sense of “free
competition,” rather than that of “non-conservative,” which is the one the term is usually
given in US politics68). Likewise, Lewis Mumford was right in insisting that modern life as
a whole, although providing possibilities for broader expression and development,
simultaneously subverts those possibilities.a The point is that, as shown in a previous
chapter, the attempt to implant and enforce ideals instrumentally reinforces the
a
Among other works, Mumford (1967/1970).
897
instrumentality—and hence the manifold evils derived from instrumentality—that they are
intended to contain. This is why Lao Tzu wrote the already quoted verse:a69
When the tao is lost, we still have its virtue;70
when its virtue is lost, we have humane attitudes;
having lost humanity, we develop righteousness;
having lost righteousness, [only] propriety and ritual remain.
In the state of Communion corresponding to full Awakening, to the state of
Contemplation of bodhisattvas, and to the state of Communion in which primal human
beings realized the common nature of them all and of the whole universe, there being no
ego-delusion and no Jungian shadow, there is neither egotism nor evil impulses to contain;
since there is no delusory valuation of thought and therefore no subject-object duality, one
does not live on the basis of an illusory “particular intellect” that should decide the course
to follow by taking learned values as a guide, but on the basis of the Logos or tao,71 which
manifests in a condition of total plenitude and in a spontaneous flow of unselfish activity
that equally benefits self and others. Only when the Logos or tao has been lost, does arise
the idea of “value,” and do spring forth the series of values/molds to which human beings
should adapt in order to avoid acting against the common good. This occurs at a certain
stage of the process of degenerative evolution, in human beings in the post-Communion
state; however, since these beings—just like superior bodhisattvas in the postContemplation state—have not developed the ego-delusion to a significant degree, since
they possess an underlying awareness of the fact that all beings share a common nature or
essence that is divine and that as such should be respected,72 and since they have some
awareness of the apparitional character of all reality, the need for them to curb wayward
impulses by means of morality, social pressure or law is not so great. Furthermore, their
need to curb instrumental, selfish, evil impulses is smaller than in superior bodhisattvas in
post-Contemplation, for the latter from very early age developed instrumentality and
selfishness, which will have to be gradually neutralized until the tenth bodhisattva level,
but human beings in relatively early stages of degenerative evolution have not yet
developed instrumentality or a high degree of selfishness.
We have seen that the findings of paleopathology strongly suggest that in the
Paleolithic and even up to some point in the Neolithic there were no wars between groups
or violent conflicts between members of the same group. Likewise, as will be shown
below, there was no vertical structure of power and therefore there was a truer democracy
than the ones we pride ourselves on having today, for it was de facto rather than nominal,
and it was “direct” rather than representative; production and distribution of goods was de
facto based on communist principles; and there was a great degree of equality between men
and women. According to Wilber, since primal peoples have only reached fulcrum-2 or
early 3, they should be warlike, socially stratified, and sexist (and though Wilber
acknowledges that patriarchal characteristics are not apparent in these societies,b he
attributes this fact to the greater economic importance of the labor of women). Though all
peoples have undergone the process of continuous “Fall” that we are considering, going
beyond what I call the “pre-ethical stage,” not all of them have proceeded in the same
a
b
Adapted from various translations.
Wilber (1995).
898
direction as those that developed urbane civilizations (or, even less so, as European
civilization in particular), for some have conserved their tribal structure and function.
Steven Taylor writes with regard to these peoples:”a73
The quality of compassion is so central to Aboriginal culture that mothers take care to
“teach” it to their children. Often, when a child grabs some food or another object and
holds it to its mouth, the mother—or another female relative—pretends to be in need of it,
[in order] to encourage a spirit of sharing. Similarly, whenever a weak or ill person or
animal comes by, the mother makes a point of expressing sympathy for it, and offering it
food (Lawlor, 1991). As Lawlor notes, by these means “the child experiences a world in
which compassion and pity are dramatically directed towards the temporarily less fortunate.
The constant maternal dramatization of compassion in the early years orients a child’s
emotions toward empathy, support, warmth and generosity” (p. 247)...
In terms of Kohlberg’s hierarchy of moral development, primal peoples should—
according to Wilber—only have a pre-conventional morality, with their sole moral
motivation the completely egocentric goal of avoiding punishment and gaining rewards.
But they clearly have a much higher level of morality than this. As Magesa (1997) indicates
above, the main motivation of their morality is not personal or even communal, but
universal: to preserve the harmony of the universe. This clearly suggests that, at least in
some respects, they possess a post-conventional morality.
Above we saw that in the state of Communion in which they did not feel separate
from the universe and the other beings in it, primal peoples of the pre-ethical period
spontaneously took care of the universe as their own body; insofar as they lived in and by
the tao, they did not need righteousness, or even goodness or compassion to be instilled in
them. As a result of realization of the divine in other human beings and in the rest of nature
in the state of Communion, in the post-Communion state empathy, goodness and
compassion manifested in a natural way; though the ego-delusion arose in this state, it was
quite mild, and therefore egotism and the rest of the ill effects of this delusion were equally
mild. When our gradual Fall gave rise to tendencies that needed to be curbed, so that tribal
peoples had to generate a post-conventional morality, this morality was far loftier than that
of modern humans, for rather than being personal or even communal, it was aimed at
preserving the harmony of the cosmos. Since hunter-gatherers and early horticulturalists of
our time have a post-conventional morality of this kind, they must be regarded as being
ethically higher than civilized peoples.
In the preceding chapter, the schema of higher fulcra in Wilber’s spectrum of
consciousness was shown to be mistaken insofar as he intends it to be a universal map of
evolution in all Paths of Awakening, including Dzogchen and other Buddhist Paths, but it
does not fit any Buddhist Path and probably does not fit any existing Path of Awakening.
Therefore the problem with Wilber’s theories does not lie solely in the fact that he applies
to phylogenesis his model of ontogenesis. And yet the lower fulcra in our author’s
spectrum, which are the levels that manifest successively in the lower stages of
ontogenesis, do not seem to be wide off the mark—so long as they are limited to modern,
degenerated societies, and are not extrapolated to phylogenesis:b
a
b
Taylor (2003), pp. 68 & 70.
Taylor (2003), pp. 67-70.
899
Following Piaget, Wilber suggests that before they reach the operational stage, children
are extremely egocentric. Experiments such as Piaget’s famous “Swiss mountain scene”
(Piaget & Inhelder, 1956), purported to demonstrate that children are unable to see the
world from other people’s perspective. As a result, they are—according to Piaget and
Wilber—incapable of empathy and compassion, since these depend on looking at the world
from the perspective of others, and ‘feeling with’ them.
If primal peoples have only reached Wilber’s fulcrum-2, corresponding to Piaget’s
preoperational stage, we would expect them to be similarly egocentric. But the reality could
hardly be more different. In fact, primal peoples are characterized by a pronounced lack of
egocentrism. They generally display a strong sense of empathy and compassion for other
living beings, and for nature in general. The fact that hunter-gatherers obtain 10 to 20
percent of their food through hunting may seem to contradict this, but most primal peoples
approach hunting with great respect and compassion for their prey. Hunting is often seen as
an unfortunate necessity, and the act of killing is never performed with pleasure. Turnbull
(1993) described how, to the Mbuti of Africa, hunting is the ‘original sin’, which occurred
when a mythical ancestor killed an antelope and then ate it to conceal his act. Since then, all
animals—including human beings—have been condemned to die. Partly because of this
philosophy, they are “gentle hunters” who never show “any expression of joy, nor even of
pleasure” (p. 7) when they make a catch. They never kill more than they need for one day,
since “to kill more than is absolutely necessary would be to heighten the consequences of
that original sin and confirm even more firmly their mortality” (Turnbull, 1993, p. 7).
Similarly, Rudgley (1998) compares traditional hunters to modern fox or game hunters and
concludes the former are characterized by “a great degree of respect for their quarry and
even a pang of regret at having to kill animals at all.” There are, he states, “numerous cases
of empathy and even reverence for animals among the hunting peoples of northern Canada
and elsewhere” (p. 113)...
Egocentrism gives rise to a whole host of negative human traits. The individual is
dominated by his or her own needs and desires, and refuses to let the needs of other
individuals or of the community as a whole come before them. After all, since he cannot
“put himself in other people’s shoes,” he cannot understand, or even be aware of, the needs
and desires of others. This leads to behavior that we associate with greed and selfishness.
And according to Piaget and Wilber, for children below the age of 7—at the pre-operational
level—this selfishness is inevitable. Children [in modern societies] are extremely reluctant
to share, and so might eat a whole bag of sweets instead of offering them to their siblings,
or throw away toys they are bored with, without thinking that another child may like them.
But we do not find any behavior resembling this amongst primal peoples. In fact, again,
we find the complete opposite: a powerful spirit of reciprocity and sharing, and ethical
systems which negate any expression of greed. One of the fundamental cultural differences
that made Native Americans unable to adapt to the European way of life was that, whereas
Europeans became successful and respected as a result of accumulating wealth for
themselves, the Indians gained kudos by distributing wealth... The same is true of
traditional African culture, where to hoard any wealth for oneself, and so to deprive the
other members of the community, is regarded as a heinous sin...
Primal peoples are clearly not, then, egocentric to anything like the degree that children
at fulcrums 2 or 3 are. They clearly can take the role of the other—or perhaps more strictly,
their less strong sense of ego means that they experience a shared sense of being with other
holons. Perhaps we are dealing with two different kinds of empathy here, corresponding to
the two different kinds of ecological awareness I mentioned earlier. There is a typically
‘Eurocentric’ empathy, which is the result of heightened rationality, and comes from taking
the perspective of the other. And there is a typically—more powerful—’primal’ kind of
empathy, which does not come from role-taking, but from actually sharing identity with the
900
other, and actually experiencing its state of being and its suffering or joy... Again, this
suggests that Wilber’s ontogenetic model cannot be applied to phylogenesis...
Another conundrum to which the above analysis gives rise is the apparent fact that we
Europeans are more egocentric than primal peoples. This is evident from a number of
factors: our much more pronounced desire for status and power and material goods (i.e.,
greed), the extreme competitiveness of our culture, the emphasis on the individual over the
community, social stratification and—perhaps more emphatically—our lack of empathy
with the natural world, our inability to ‘feel with’ nature. According to Wilber’s analysis—
and those of Habermas and Beck and Cowan—as evolution progresses there should be a
decline in egocentrism. And again, in ontogenetic development this is indisputably the case.
But equally indisputably, in terms of the development of our species this is not the case.
Lenski (1978) has also noted that, rather than showing a forward movement away from
savagery and toward greater democracy and humanity, our cultural evolution actually
shows a regression in this regard. As he states, “as numerous scholars have noted, it is one
of the great ironies of evolution that progress in technology and social structure is often
linked with ethical regress” (p. 176). He noted that the evolution from hunter-gatherer to
horticultural and then agrarian societies is marked by “the decline in the practice of sharing
and the growing acceptance of economic and other kinds of inequality” (Lenski, 1978, p.
176).
I am not trying to turn the tables completely though, by suggesting that our egocentrism
is the same as young children’s. We may say that there are two different kinds of
egocentrism: a pre-egoic level and a post-egoic one...
The term “pre-egoic egocentrism” is not an oxymoron, for in the term “pre-egoic”
the noun “ego” is to be understood in Freudian and similar terms to refer to a developed
ego-functioning, whereas in “egocentrism” “ego” is the Latin translation of the pronoun
“l.” The tropisms that result in the development of ego-delusion (i.e., in taking oneself to
be a self-existing self and feeling one is the most important entity in the universe) gain in
power as degenerative evolution goes on, but also the values of society come to be based to
a greater extent on ego-delusion as degenerative evolution proceeds; therefore, egocentrism
increases with degenerative evolution both at the “pre-egoic” and the “post-egoic” levels:
not only children, but also adults, are far more egocentric in our societies than in the tribal
communities of our time—which in their turn must be assumed to be more egocentric than
true primal peoples. Furthermore, if adults of our time seem to be less egocentric than
children, this is due to the fact that social conventions demand that adults repress (or at
least conceal) their egocentrism, which is so extreme that we have destroyed the planet and
subject fellow human beings to extremely harsh sufferings and humiliations in order to
satisfy our most immediate cravings.
What can be said of evolution in the plane of art? Those who have carried out a
thorough study of the art of the Paleolithic consider that it is not legitimate to speak of an
artistic evolution—in the sense of “perfecting”—of humankind. Andreas Lommel, head of
the Ethnological Museum in Zurich, writes with regard to the art of the period:a
There are some who would rather avoid any speculation [with regard to the spiritual
development of those who created the wondrous Franco-Cantabrian primitive art], for the
problem poses unsolvable questions to the student of prehistory and especially to anyone
naïvely convinced of the march of progress. If ‘primitive man’ was able to produce such
a
Lommel (undated).
901
wonderful works of art with his rough stone and bone instruments, he could not have been
in any sense ‘primitive’ in the artistic and intellectual sense, and, contrariwise, must have
reached an as yet unsurpassed level of development. This demonstrates that mental and
artistic evolution does not develop side by side with the progress of material civilization.
To accept this hypothesis would amount to revolutionizing the picture of human
development as we see it that is, as a more or less linear progression.
On the plane of religion, the vision of human beings was non-substantialistic and
nondual; it was of the type that Dumézil called “magic,” which experienced all things as
manifestations of a single, sacred principle—which was in the world rather than beyond the
world, and that was not the patrimony of gods believed to be above humans. Therefore,
rather than being worshiped outside and above the world, the divine had to be celebrated in
the world, by means of Communion in the unconcealment of the single, true condition of
all entities. Since the sacred was not placed higher up in the form of ruling divinities, and
human beings were not placed lower down as subjects of the divinities, in the religious
plane there were no vertical relations (i.e., relations of dominion) that later on could extend
themselves to other planes. And, in spite of the process of degeneration that has followed,
still in our days tribal peoples conserve this awareness of the divine as manifesting in the
world in the form of a universal animating force of principle. Steven Taylor tells us:a
[Tribal peoples are aware of the existence of] an animating force which pervades all
things. The Iroquois [of North America] called this Orenda, to the Hopi [of North America]
it was Maasauu, the Nuer of Africa call it Kwoth, the Ufaina of the Amazon call it Fufaka,
Melanesian peoples refer to it as Mana, and so on. Every primal culture without exception
has a name for this force. The word of the Plains Indians used for ‘Great Spirit’, Wakataka,
literally means ‘the force which moves all things’. Here a member of the Pawnee tribe
describes their ‘supreme God’:
“We do not think of Tirawa as a person. We think of Tirawa as [a power which is] in
everything and ... moves upon the darkness, the night, and causes her to bring forth the
dawn. It is the breath of the new-born dawn (Eliade, 1967, p. 13).”
In my view this force is clearly one and the same as brahman or consciousness-force...
The passage above invites comparison with any of the passages from the Upanishads which
describe the presence of brahman within the manifest world. For example,
“Shining, yet hidden, Spirit lives in the cavern. Everything that sways, breathes, opens,
closes, lives in Spirit... Spirit is everywhere, upon the right, upon the left, above, below,
behind, in front. What is the world but Spirit (in Happold, 1963, p. 146).”
The attempts anthropologists have made to translate primal peoples’ terms for
‘consciousness-force’ make this connection clearer. The German anthropologist F. Speiser
(speaking of the natives of the New Hebrides) used the term Lebenskraft (lifepower); Dr.
Pechuel-Loesche (speaking of the Loango of Africa) called it Potenz, while another
German anthropologist, R. Neuhaus (speaking of the natives of New Guinea) used the term
Seelenstoff (soulstuff) (Lévy-Bruhl, 1965). Perhaps clearest of all, though, is this
description by the British anthropologist J. H. Holmes of what the natives of the Purari
Delta in New Guinea called Imunu. Holmes translates this as ‘soul’ or ‘living principle’,
and writes:
“[Imunu] was associated with everything, nothing arrived apart from it ...nothing
animate or inanimate could exist apart from it. It was the soul of things ... It was intangible,
but like air, wind, it could manifest its presence. It permeated everything that made up life
a
Taylor (2003), pp. 64-66.
902
to the people of the Purari Delta ... [It was] that which enables everything to exist as we
know it, and distinct from other things which, too, exist by it (in Lévy-Bruhl, 1965, p. 17).”
In other words, consciousness-force doesn’t just pervade all reality, it is the source of
all reality—which is exactly what the Upanishads (and the world’s other mystical
traditions) tell us of brahman...
As Evans-Pritchard (1967) notes of the Nuer, “Spirit-force is not a particular air-spirit
but the [air-]spirit is a figure of Spirit-force ... The spirits are not each other but they are
Spirit-force in different figures (pp. 51-52)...”a
...There seems to be a general recognition that the individual human spirit is in essence
divine too, as a part of the great ocean of Spirit which pervades the whole world. In fact,
since all natural things are seen as divine in essence, it would be very surprising if this were
not the case. As the anthropologist H. Sindima writes of traditional African peoples, for
example, “All life—that of people, plants and animals, and the earth—originates and
therefore shares an intimate relationship of bonded ness with divine life; all life is divine
life (1990, p. 144)...”
This incidentally works against Wilber’s claim that when individuals at lower levels
have peak experiences, the experience will be colored by and interpreted in terms of their
level of development. When individuals at the magic stage experience the transpersonal,
they will, he claims, suffer from massive ego-inflation, and believe that only they are one
with God. This is inevitable since they “cannot take the role of the other and thus realize
that all the people—in fact, all sentient beings—are equally one with God (Wilber, 2000a,
p. 15).” But primal peoples’ recognition that ‘all life is divine life’ strongly suggests that
this does not apply to their experience...
As will be shown below, Wilber could contend that this is the expression of a state
like that of a child in the oceanic feeling, but this is not so, because children in the oceanic
feeling do not and cannot commune in the realization of the sacred universal force that
pervades and moves all things, and they lack a post-Communion state in which they may
celebrate this force.74 According to Wilber’s spectrum of consciousness, which I contested
in the preceding chapter, it is at fulcrum 7, which is what he calls the psychic level, that we
experience nature as divine, but in Wilber’s view this level is barred to primal peoples,
except—he finally accepted in 2000a—in the case of a few exceptional individuals.
With the passing of time, the relational state of post-Communion developed into
what the Bible represented as eating the “fruit of the tree of knowledge of good and evil,”
which consolidated judgment—a term that in German is Urteil, the etymology of which is
“original / originating partition.” In fact, we have seen that the condition for judging is that
there be an illusory mental subject appearing to be separate from its object, that the sensory
continuum be split by human perception into figure and ground, and that the figure be
deemed to be like this or like that (which, in the case of moral or aesthetic judgments,
modifies the individual’s feeling-tone, causing it to become pleasant, unpleasant or
neutral). With the passing of time, the partition in question became ever more firmly
rooted, and so we carne to feel separate from the plenitude of the Self-qua-Base most of the
time, while the unconcealment of the sacred, of the whole, of the all-powerful, became ever
more rare. Finally, in most of us the natural capacity to experience aletheia and
Communion was blocked, and thus we had to project the sacred, the whole and the allpowerful unto a beyond, giving rise to the gods and the heaven they inhabit. This
a
The original had “God,” which in agreement with Taylor’s interpretation and following his terminology I
replaced by “Spirit-force.”
903
degenerative evolution, particularly as manifested in the plane of religion, was reflected in
the evolution of art. Jacques Cauvin has noted:a
Though it is known that religious feeling has accompanied the human species for a long
time, it is not easy to date the appearance of the first gods. Paleolithic art already had a
‘religious’ content, but it seems not to have had reference to gods. The notion of a divinity
manifests itself for the first time in the Near East in the form of female terracotta statuettes,
at the very beginning of the ‘Neolithic revolution’—a very important moment in the history
of humankind. Preceding by a short time the first agricultural experiments, this
psychological mutation could partly explain the formidable transformation of the Neolithic.
Cauvin stresses the fact that the predominantly “animalistic” or zoomorphic
Franco-Cantabrian art of the Paleolithic and the artistic manifestations of the same type and
period in the Near East had a non-theistic, naturalistic religious content reminiscent of the
Chinese yin-yang, and expressed a vision of the universe that excluded vertical relations:
nothing was posited beyond the world and above human beings that the latter should
worship. The psychological transformation represented by the “birth of the gods” (the first
two being a female mother figure and a bull-headed god) had not yet taken place; it was to
take place in the Near East right before the beginning of the Neolithic, giving rise to art
forms placing human beings vertically below the gods, in an adoring and supplicant
attitude. Cauvin says of this transformation:b
At this point, (the transformation of) art seems to reflect an event of psychological
character. The sacred is no longer on the level of man, but ‘over’ him. This translates itself
into the belief in a supreme entity, which may have human or animal form, whereas, from
then on, humankind is below and turns toward it through the effort of praying, expressed by
the arms extended toward the sky...
Not only is then the Goddess the first supreme power in human form—that is, the
origin and supremacy of the natural world is conceived by man, for the first time, ‘in his
image and likeness’, including the psychic power expressed by the ‘gaze’ of the
statuettes—but the divine plane is that on which the opposites unite and tensions are
resolved.
In Biblical terms, the above may be said to have completed the “expulsion from
Eden,” which progressively extended itself through Eurasia and North Africa, and then
through a great deal of the world, as “neolithization” spread. As we have seen, in the
earliest stage of humankind the nonrelational state of Communion in which the single,
divine essence of all essents was realized, alternated with a relational state of postCommunion, in which relations were communicative insofar as there was a residual
awareness that all essents were ultimately divine.75 However, later on the capacity for
Communion diminished, so that the nonrelational state became rarer and the relational state
came to prevail, in which, due to the loss of the capacity of Communion, to the ensuing
inability to recognize the divine in other human beings and in the rest of nature, and to the
origination and development of the vertical relationship expressed in the mutation in art
that Cauvin described in the above passage, human society and the human psyche
structured itself in terms of vertical relations—which manifested in the arising, after a very
a
b
Cauvin (1987); cf. also Cauvin (1998/2000).
Cauvin (1987); cf. also Cauvin (1998/2000).
904
short time, of political power and social and economic differences. Parallel to this, the ego
delusion continued to develop, causing the erroneous experience of ourselves as inherently
separate, limited selves or egos to gradually gain in power, and therefore giving rise to
ever-increasing selfishness / egotism. With the passing of time, the combination of
selfishness, verticality and our incapacity to perceive the divine in nature and other human
beings and to put ourselves in their place led vertical relations to acquire an instrumental
character, initially resulting in the exertion of violence against other sentient beings that
gave rise to the Jungian shadow (as shown above, the Mbuti of Africa view as the “original
sin” the killing of an antelope by a mythical ancestor, who then ate its meat in order to
conceal his act—the consequence of which was that henceforth all sentient beings sooner
or later had to meet death). The gradual development of the shadow, as shown in a previous
chapter, impelled the development of evil, which in its turn was catalyzed by the division
of humankind into shepherding and agricultural peoples, which the Book of Genesis
represented (though inverting their roles) in terms of the myth of Cain and Abel and the
former’s aggression toward the latter—which, with the passing of time, translated itself
into the conquest and domination of the agriculturalists by the shepherds.76 This further
impelled the development of the shadow, modifying the character of the vertical relations
that had developed at that point in such a way that they turned into relations of aggression,
oppression and exploitation—and thus setting the bases for the project of subduing and
exploiting other human beings, as well as what we had come to perceive as an external
environment. Therefore it is paradoxical, to say the least, that Wilbera viewed the
development of polytheistic and monotheistic religions as a surpassing of the “magical”
religion of primal peoples and as progressive steps towards realization of the divine.
In the period when Communion was generalized and, in the post-Communion state,
communicative relations prevailed, these relations predominated in all fields, and so we
may refer to this stage as being pan-communicative. It was because the primary process
relations of primal peoples were communicative rather than instrumental, that they did not
exert violence against other human beings and that they were so gentle and collaborative in
their relations with others. It was for exactly the same reason—which caused them to view
the river, the tree and so on as phenomena having an I like ours and being a manifestation
of the divine, and as such deserving respect—and because of their acute awareness of
interdependences, that they were able to improve biodiversity. When, at a later stage,
instrumental relations replaced communicative ones, they also came to prevail in all fields,
for, as we have seen, relations are established in primary process, in which it is impossible
to establish who is who in the relationship in order to apply some relations to some fields
and other relations to other fields, and in which, since it does not involve negatives, it is
impossible to decide, “these relations will not be applied to that field” (which is one of the
reasons why above I rejected Habermas’ view that relationships with the natural
environment should be instrumental, whereas relationships with other human beings should
be communicative—as well as Engels’ idea that “in communism, rather than dominating
human beings, we would dominate nature and inanimate things”).
Wilber’s spectrum of consciousness and the hierarchies he names “holoarchies,”
reproduce the vertical structure issuing from the psychical mutation that, as Cauvin has
shown, was reflected in art as the “birth of the gods.” Within Buddhism, the gradual
Sutrayana responds to this vertical structure when it posits five paths and eleven levels,
a
Wilber (1981).
905
each being somehow “higher” than the former; however, as shown in the preceding
chapter, this is an expedient devise which arises from the nonrelational state of absolute
equality of the Buddhas, in response to the vertical mentality of potential disciples, and
which is balanced by the explanation of delusion as resulting from conditioning and the
presentation of the Path as a process of discovery of the unconditioned and of undoing of
conditioning (as illustrated in Theravada Buddhism by the Atthasalini’s image of
demolition of whatever is built). The same cannot be said of the spiritual systems invented
on the basis of its own delusion by the deluded mind that is structured in terms of vertical,
instrumental relationships, for the ensuing hierarchical systems are taken to accurately
reflect the structure of the Path and of reality in general, and in general are conceived in
(subtler or coarser) substantialistic terms. Furthermore, it is frequent that in such cases this
vertical, instrumental structure be associated with a moral dualism (the soul is good or
pure, the body evil or impure) and a subtler or coarser anti-ecological antisomatism, as
occurs in the systems of the Orphics and their philosophical heirs (Pythagoras and the
Pythagoreans, Parmenides and the Eleatics, Plato and the Platonists), as well as in those of
the Manicheans and some other Gnostics77—and, to a greater or lesser extent, in the Old
Testament and in many Christian ideologies, in some Brahmanic systems based on
renunciation,78 and in quite a few Western systems of philosophy influenced by
Christianity or Platonism).
Although the degenerative view of evolution presents the “Fall” as an ongoing
process that takes place throughout the whole of the cosmic cycle, it is clear that when
understood, on the basis of a literal interpretation of the Book of Genesis, as a moment
marking the end of the Primordial Age, the Fall roughly corresponds to the arising of the
mother goddess and the bull-headed god that Cauvin referred to in the paper quoted above,
and the “punishment” of human beings took effect when their daily lives ceased being
mainly playful and toil became predominant—which occurred as hunting, fishing and
recollection were replaced by agriculture and animal breeding, which implied the need to
work for many hours every day, “earning one’s bread with the sweat of one’s forehead.”
This came to pass after most human beings lost the ability to commune in the direct,
nonconceptual realization of the physical plane as sacred and paradisal, and therefore
dualistic delusion and the ensuing conflict could no longer be resolved by the unveiling of
the common nature of opposites and the consequent spontaneous liberation of tensions in
what I have been calling Communion—as a result of which the physical plane became that
of duality and of the conflict of opposites, and human beings had to invent a “beyond” into
which they could project the sacred, fancying it as a Paradise, blissful and free of conflict.
(This shows that Washburn’s discussion of the myth of the genesis of “original sin” misses
the point.a) Furthermore, since human beings could no longer resolve their conflicts
spontaneously as they arose, they had to place their hopes in the help of gods. Steven
Taylor tells us with regard to tribal peoples of our time:b
It’s true that, apart from a few exceptions, early human beings and primal peoples like
the (Australian) Aborigines and Native Americans had only rudimentary engineering and
building skills, rudimentary medical science, and no written language. However, to see
Aborigines and Native Americans as ‘backward’ because of their lack of technology
a
b
Washburn (1995, ch. 2, The Body Ego, Conclusion. Spanish Ed. pp. 115-117).
Taylor (2003), pp. 63-64.
906
ignores the fact that most primal peoples were so well adapted to their environments that
they did not actually need technology. The lives of hunter-gatherer tribes were actually
much easier than those of the horticulturalists and agriculturalists who came after them—
even easier, in some respects, than our lives. Far from exhausting themselves in their search
for food, hunter-gatherers actually spent only 12 to 20 hours per week searching for it
(Rudgley, 1993; Sahlins, 1972). The diet of hunter-gatherers was also extremely healthy.
Apart from the small amount of meat they ate (10%-20% of their diet) their diet was
practically identical to that of a modern-day vegan, with no dairy products and a wide
variety of fruits, vegetables, roots, and nuts, all eaten raw (which nutrition experts tell us is
the healthiest way to eat). This partly explains why most of the skeletons of ancient huntergatherers that have been discovered have been surprisingly large and robust, and show few
signs of degenerative diseases and tooth decay (Rudgley, 1998)
As to whether it was demographic pressure or psychological mutation that led
human beings on the path of civilization, according to Cauvin the constant toil that
agriculture requires was not at all necessary from the standpoint of resources, and therefore
must have resulted from a spiritual mutation of humankind. In fact, Cauvin rejects the
theories of American researchers Lewis R. Binford and Kent V. Flannery that attribute to
ecological reasons—namely, to the reduction of the quantity of game, fish and wild
vegetables for recollection—the need to switch to a mode of life based on agriculture, for
his own research allegedly demonstrated that in the Near East, at the time farming
appeared, there was abundant game, fish and wild vegetables, and so there was no
“ecological” need to give up the way of life of hunters-fishermen-gatherers and develop
farming, which demanded many hours of daily toil—instead of the two or three hours that,
in favorable climates, were necessary for hunting, fishing and gathering—and which laid a
heavy full-time responsibility on the shoulders of individuals.79 At any rate, the seeds of
the process of degeneration began sprouting in the Age of Perfection (krityayuga), Age of
Truth (satyayuga) or Golden Age, and degenerative evolution has been but the process of
the plant reaching full maturity: neither idealist nor economist-materialist views of human
evolution can fully explain this process, for the structure and function of the human mind is
inseparable from the social relations in which individuals develop, being molded by them
as much as it molds them.
The fact that primal peoples did not have to toil for their sustenance is reflected in
the philosophy of the Stoics, who asserted that in the Golden Age nature bestowed its fruits
to human beings without them having to toil; in the Silver Age and the Copper Age, a
progressively greater effort was needed in order to obtain the fruits of the earth; and finally,
in the Iron Age, the greatest toil is necessary for obtaining them. The Stoics also made it
clear that in the Golden Age there were no divisions between human beings: the Logos
ruled, and therefore human beings were all free and equal among themselves and were not
divided by national boarders or by distinctions of social class, wealth or ancestry. Private
property was unknown, as were also the individual family, slavery and servitude, or the
State in which a few prevail over the majority. The goods of nature were enjoyed in
common by all human beings, who lacked any sense of possessiveness and lived like true
brothers and sisters, abandoned to the natural flow of the Logos—and therefore free from
any kind of government or control. Thus it is clear that the way the original, pre-IndoEuropean traditions that shared the degenerative vision of human evolution and history
(Himalayan Bön, Chinese Taoism, Persian Zurvanism, the Greek Dionysian tradition, and,
in India, Dravidian Shaivism and later Tantrism) described the primal Golden Age, Era of
907
Perfection or Age of Truth fits our knowledge of the way of life of primal peoples, and, to
a lesser extent, of many hunter-gatherers and even horticulturalists of our time, and in
particular in what regards the absence of State, property and individual family, their
description fits the original and purest forms of primitive communism. (Some
representatives of Brahmanic orthodoxy modified the original version of this view of
human evolution by asserting that in the primordial era the brahmin caste prevailed, in the
era of three the kshatriya caste ruled, in the era of two the vaishya caste was predominant,
in the era of darkness the shudra caste reigned, and at the end of the dark era the
untouchables obtained power. Before the fall of the Soviet state and the dismantling of
Marxist regimes, some attempted to validate this view by claiming that the “dictatorship of
the proletariat” that supposedly existed in Marxist states was the rule of the shudras.a).
Steven Taylor writes with regard to tribal peoples in the last two centuries:b
...lack of egocentrism and selfishness is probably the main reason that both huntergatherers and early horticultural societies are generally completely egalitarian, with no
private property or social stratification. Many primal peoples seem to exist in a natural state
of communism... According to Lenski’s statistics in Human Societies (1978)—based on the
data in Murdock’s Ethnographic Atlas—only 2% of contemporary hunter-gatherer societies
have a class system, while private ownership of land is completely absent in 89% of them
(and only ‘rare’ in the other 11%).
[American aborigines] could not comprehend the concept of private ownership of land,
or the massive inequalities that run through European society. As Sitting Bull complained,
“The While Man knows how to make everything, but he does not know how to distribute it
... The love of possession is a disease with them. They take tithes from the poor and weak
to support the rich who rule” (Wright, 1992, p. 344). While the Europeans, for their part,
saw the ‘communism’ of the natives as a defect which had prevented them from becoming
‘civilized’. As Senator Henry Dawes—whose ‘Dawes Act’ attempted to make Amerindians
into small-scale landowners—said of the Cherokee nation in 1887,
“There is not a pauper in that nation, and the nation does not owe a dollar...Yet the
defect of the system was apparent. They have got as far as they can go, because they hold
their land in common ... There is no selfishness, which is at the bottom of civilization.”
(Wright, 1992, p. 363)
Primitive communism? Marx and Engels grew up in a climate still marked by the
blind enthusiasm for progress proper to Modernity, and thus, though Marx is generally
supposed to have succeeded in completing the inversion of Hegel’s system Feuerbach had
left halfway,80 he and Engels took for granted the view of evolution as a process of
constant perfecting proper to Hegel’s philosophy, which they made no attempts to surpass.
In particular, they viewed primitive communism as being inferior to the subsequent stages
in the process of social evolution, and their mainstream Soviet followers, who turned
Marxism into a strict economic determinism, went further and conceived primitive
communism as characterized by deprivation, hunger and penury (cf., for example, Ernst
Mandel’s Treatise of Marxist Economics,c which expressed the standard Soviet
interpretation of the sequence of economic systems posited by Marxism).81 This outright
contradicts the view of the Golden Age, Era of Perfection or Age of Truth in Wisdom
a
Biès (1985).
Taylor (2003), pp. 68-69.
c
Mandel (1962).
b
908
traditions sharing the degenerative view of social and spiritual evolution, some of which
made it quite clear that, since primal humans communed in the state of aletheia or
unveiling of the undivided Totality that is the true condition of both human beings and the
rest of the universe, which was not sundered by the illusion of a separate mental subject, in
the Communion state their psychological condition was characterized by absolute plenitude
and hence by the greatest degree of “existential wealth.”82a Furthermore, since they had not
been subject to the creation of false needs, and the plenitude inherent in the unveiling of
Totality somehow filtered into their post-Communion state, even in this condition,
existentially speaking they were much richer than beings of subsequent ages.
Also most left-wing anarchists who share the belief in primitive communism reject
the Marxist economist view and accept that beings in the earlier stages of human evolution
did not experience deprivation and did not harbor any idea of accumulating wealth in order
to better their lot. Furthermore, observation of both hunter-gatherers and horticulturalists
after the time of Marx and Engels by anthropologists and researchers of stone age
economics such as Pierre Clastres,b David Marshall Sahlins,c Jacques Lizot,d Richard
Rudgleye and others, led them—as well as like-minded philosophersf—to the conclusion
that, to a sizeable extent, tribal peoples of our time possess an “economy of plenty:” since
their members do not have a pronounced feeling of lack or deprivation, they do not think of
accumulating provisions or riches in order to increase the “level of life.” And if this is so in
hunter-gatherers and horticulturalists of our time, how much more so must it have been in
truly primal societies, long before neolithization started anywhere in this world—i.e., at the
time when our true condition of absolute plenitude and perfection, sameness and equality,
perfectly unveiled in the non-relational state of Communion, and then in the relational
post-Communion state relations were horizontal and communicative, so that there were no
vertical relations (i.e., relations involving the fracture between one side that rules and/or
enjoys privileges and another that is ruled, oppressed or exploited) in any plane
whatsoever: neither in the human psyche, nor in human society, nor in the relationships
between human beings and the “environment.” Steven Taylor writes:g
...Lenski notes that slavery is ‘extremely rare’ amongst hunter-gatherers (in contrast to
‘advanced horticultural’ societies, 83% of which possess it) and that they tend to have a
strikingly democratic system of making decisions. Many societies have nominal chiefs, but
their power is usually very limited, and they can easily be deposed if the rest of the group
are not satisfied with their leadership. Political decisions are not taken by the chief alone,
but are usually “arrived at through informal discussions among the more respected and
influential members, typically the heads of families” (Lenski, 1978, p. 125). As Briggs
(1970) wrote of the Utku Eskimos of northern Canada, for instance,
“The Utku, like other Eskimo bands, have no formal leaders whose authority
transcends that of the separate householders. Moreover, cherishing independence of
thought and action as a natural prerogative, people tend to look askance at anyone who
seems to aspire to tell them what to do. (p. 42)”
a
Weisskopf (1971); Capra (1982); Capriles (1994a).
Clastres (1987, 1974).
c
Sahlins (1974); for more on the views of Sahlins, cf. also Sahlins (1961, 1972, 1976), etc.
d
Lizot (1985, 1992), etc.
e
Rudgley (1993); for more on the views of this author cf. also Rudgley (1998, 2000).
f
Savater (1985) (written before Savater forsook anarchism and political engagement in general).
g
Taylor (2003), p. 69.
b
909
While as Christopher Boehm (1999) summarizes, “This egalitarian approach seems to
be universal for foragers who live in small bands that remain nomadic, suggesting
considerable antiquity for political egalitarianism” (p. 69).
Anthropologist Pierre Clastres notes that, when Guarani aborigines fled their habitat
toward the sea coasts, upon being asked what were they fleeing, they replied, “the One:”
Clastres interpreted this as meaning they were trying to flee the imminent rise of the State.
Taylor goes on:a
As Boehm summarizes again,
“Many other nonliterates [besides hunter-gatherers], people who live in permanent,
settled groups that accumulate food surpluses through agriculture, are quite similar
politically [to hunter-gatherers] ... These tribesmen lack strong leadership and domination
among males, they make their group decisions by consensus and they too exhibit an
egalitarian ideology.” (p. 38)
Democracy and egalitarianism appear somehow natural to primal peoples, whether they
are hunter-gatherers or simple horticulturalists.
According to Marxism, the State and political power in general had to manifest as a
consequence of the rise of private property, for once there was property it was necessary to
protect it. Pierre Clastres, Marshal Sahlins and others have claimed, on the basis of their
observations (e.g., of Sahlins’ field research regarding the genesis of “Polynesian
Monarchies”b) that, in contradiction with the theses of Marxism, it was the rise of political
power (which, as we have seen, reproduces the vertical relationship between humans and
gods that results from the theogenesis), which after some time gave rise to private property.
In fact, Sahlins asserts that the would-be chief exploits his wives in order to be able to give
goods to the community so that he may be appreciated and then at some point may be
appointed chief; though Sahlins does not relate his own observations to the theses of Hegel
and Sartre, his description of the genesis of power is more related with the dialectic of
lover and beloved described by Sartre,c than with the dialectic of the master and the slave
described by Hegel.d
However, the mythology of the pre-Buddhist Himalayan religion known as Bön
(which is worth considering in view of the sizeable antiquity of its traditions) coincides
with Marxism in this regard, for it claims that the introduction of private property by
males—in spite of the protests of females—gave rise to struggles that could only be
suppressed when, finally, all recognized a Sovereign. Though the Bön tradition asserts that
the first Sovereign was of divine origin, it notes that after a short while he became corrupt
and abused power—which resulted in a system of privileges that then gave rise to political,
social and economic stratification.e At any rate, the important point is that primal societies
of the Paleolithic did not exhibit any type or degree of stratification (as we have seen, even
hunter-gatherers of out time fail to exhibit a clear stratification) and that political power,
private property and the separate family arose and developed interdependently as a result of
a
Taylor (2003), p. 69.
Sahlins (1974); cf. also Sahlins (1972, 1961, 1976).
c
Sartre (1980).
d
Hegel (1955).
e
Reynolds (1989).
b
910
the “Fall” (whether it was private property that gave rise to political power or vice-versa
being a secondary question). Steven Taylor writes:a
...we have already seen that social stratification and inequality were generally absent
from primal cultures. Most hunter-gatherer groups, and many sedentary horticultural tribes,
were strikingly democratic to a degree which the modern world has only recently begun to
reach, and is still some way from equaling. In fact there is a very good case for suggesting
that, at least to some extent, the modern concepts of democracy and equality were derived
from primal peoples: specifically, from the native Americans. The authors of the American
constitution borrowed their concept of a union of different states from the centuries-old
‘Six Nations’ confederacy of the Iroquois Indians—in fact the idea was actually
recommended to the Europeans by a leader of the Six Nations at a treaty signing in 1744, at
which Benjamin Franklin was present (Wright, 1992). Similarly, the constitution’s concept
of a non-hierarchical society—which was, after all, completely alien to Europe at that
time—was to a large extent inspired by the authors’ observations of native American
societies. In the words of Alvin M. Josephy Jr (1975),
“Colonial records show that many of the Indian peoples of the Atlantic seaboard taught
the European settlers much with regard to freedom, the dignity of the individual,
democracy, representative government, and the right to participate in the settling of one’s
affairs.” (p. 39)
It’s ironic that, as well as being the originators of modern capitalist democracy, the
Iroquois were also partly responsible for modern communism. In 1851 Lewis Henry
Morgan published his book League of the Iroquois, reporting his anthropological
observations of Iroquois society. Both Karl Marx and Friedrich Engels read the book, and
were inspired by what they saw as an example of a Utopian socialist society. As Engels
wrote to Marx, “This gentle constitution is wonderful! There can be no poor and needy ...
All are free and equal—including the women” (Wright, 1992, p. 276).
Discussions of the concept of communism began long before Morgan published his
book, in the milieu in which Marx and Engels developed their theories, and Marx and
Engels themselves began writing on Communism long before the publication of the book
by Morgan;83 furthermore, we have seen that they did not find in what they referred to as
“primitive communism” the blueprint for the communism that in their view would be the
last stage of human society. However, they certainly were inspired by learning that
communism had existed and somehow still existed in their time in some human groups.
Throughout this chapter, I have been differentiating between primal humans and
hunter-gatherers of our time. The point is that, as Theodore Roszakb has rightly noted, the
tribal societies anthropologists have studied during the last few centuries, including the
ones described by Morgan (whose writings, as we have seen, were used by Engels to
support his theory of social evolution, and were important to Marx), Sahlins, Lizot,
Clastres and many other authors cited and not cited in these pages, are not samples of the
way of life prevailing in the Primordial Age (though their way of life is no doubt more
similar to that of primordial humans that that of the “early Germans” fancied by Swiss
jurist, cultural anthropologist and philosopher of history Johann Jakob Bachoffen [18151887]84). This is so, not only because tribal cultures in existence nowadays have been
disrupted—if not destroyed—by external influences, but also because, as we have seen, all
a
b
Taylor (2003), p. 71.
Roszak (1992).
911
human groups are part of the human species and therefore cannot elude the development,
throughout the cosmic cycle, of the delusion called avidya or lethe—even though this
delusion does not develop in the same direction or at the same pace in all of them. For
example, attending to their technology, Yanomami Amazonian aborigines of our time must
be placed in the Paleolithic; however, we must suppose that before their lands were
penetrated by European missionaries, garimpeiros and other foreigners, their communities
already waged war against each other on a permanent basis, their religion was shamanic
rather than being of the type centered on Communion that I have referred to as
“metashamanic,”a and in general they had strikingly degenerated in relation to primal
peoples of the time when the whole of humankind was in the Paleolithic; though we have
no reports of their personalities and customs before they were encroached by the white
man, according to reports from the 1970s they often exhibited cruelty toward their animals
and many other vices.b (I deem it essential to insist that the religion of the Primordial Age
was not shamanic in the sense in which Michael Harnerc defined the term, which was
reviewed in the preceding chapter: according to the degenerative view of human evolution
and history, and as implied by the above cited studies by Jacques Cauvin and others, primal
religion lay in the dissolution of the illusion of separateness in a state of Communion,
without reference to gods of supernatural entities of any kind; as Sufi Master Idries Shah
rightly noted,d shamanism is a product of the degeneration of primal spirituality, which had
its authentic continuity in genuine Paths of Awakening.e)
In the preceding chapter we saw that Tibetan Buddhism and Bön had special
practices that were taught to some of the ablest students, in which demons and other of the
entities that according to shamanism and quite a few non-shamanic religions could
supernaturally influence the fate of human beings, manifested to the practitioners and then
liberated themselves spontaneously in the reGnition of the Self-qua-Base. Though some
might think that such practices are not appropriate for scientific-minded people like
ourselves and our contemporaries, so long as we have the dispositions that, in the
appropriate conditions, will induce a horror experience in which these demons and likely
entities manifest, appearing not to be any less real than physical entities, these practices
should not be forsaken. Likewise, on the Tantric level, Tibetan traditions conserve
practices involving the visualization of oneself as a deity, such as for example the Tibetan
version of Garuda (the kaldingf or namkhedingg, which is a synthesis of the Indian Garuda
and the Tibetan khyung bird, corresponding to the Persian simurgh—which the Turkish call
kerkes—as well as to the Western phoenix and to the Chinese “red bird,” identified with
the phoenix or feng huang [Jpn. hou-ou]). If we wrongly think these practices belong to a
stage to be categorized as childish / prehistoric in terms of Wilber’s analogy between
ontogenesis and phylogenesis (or, in my own view, that they belong to the shamanic level),
we may think that in our age they should be forsaken; however, in my view we should keep
such practices and forsake the evolutionary views demanding that they be forsaken.
a
This term was introduced in Capriles (1990c); then it was used in several of my more recent works,
including the present book.
b
Lizot (1985).
c
Harner (1973).
d
Shah (1975).
e
Shah (1975).
f
mkha’ lding.
g
nam mkha’i lding.
912
To conclude, let me reproduce Steven Taylor’s summary of his criticisms of
Wilber’s view of phylogenesis:a
To summarize, then, Wilber’s view of prehistoric human beings—and the application
of ontogenesis to phylogenesis which prompts this view—is problematic for the following
reasons. Firstly, primal peoples exhibit higher spiritual characteristics, including (a) an
awareness of Spirit pervading the manifest world, (b) an awareness of the inner Spirit or
atman, and (c) an awareness of the ‘two selves’, the ego and the divine self. This would
paradoxically locate them at fulcrum 7, while their lack of hypothetico-deductive reasoning
and their magical thinking locates them—according to Wilber’s model—at fulcrum-2 or 3.
Secondly, primal peoples show no sign of the egocentrism that, according to Wilber
and Piaget, children at preoperational levels exhibit. Their ‘universal’ empathy suggests
fulcrum-7 or higher, and a post-conventional morality. They experience an intense
intersubjectivity, a shared sense of being with other creatures and with the phenomenal
world in general, which generates compassion and an ecological sensibility.
Thirdly, primal cultures exhibit enlightened social characteristics, such as democracy
and peacefulness, which, according to Wilber, should only emerge at fulcrum-5, or during
the high egoic period.
There is, however, another point I would like to add briefly, which in my view further
undermines the application of ontogenesis to phylogenesis. Following Gebser, Cassirer and
Neumann, Wilber suggests that, like young children, the earliest human beings had no
sense of separation from their environment, and no sense of subject-object duality. As
Wilber (1996) writes, at fulcrum-2 “mind and world are not clearly differentiated, so their
characteristics tend to get fused and confused” (1996, p. 173). Or as he elsewhere puts it
typhonic man would “tend to confuse psychic with external reality, almost as a man does
when he dreams” (1981, p. 46). As we say earlier, this is the basis of Wilber’s
interpretation of animism: because of their pre-personal fusion, children and primal people
see the whole world as an extension of themselves. But if primal peoples really did confuse
internal and external reality, their survival chances would have been drastically impaired.
How could you be sure whether things were really there or just images in your mind? If you
were out hunting and saw a bear, you might find yourself running after an apparition and
throwing your spear into empty space. Or you might see a wolf or a lion and decide that it
was probably only an image in your mind, only to be ripped off into pieces a few seconds
later. And even if you knew that there was something real there, in your dream-like state it
would be difficult to find the alertness to react to it quickly. The business of keeping
yourself alive requires a sense of differentiation between yourself and your environment.
Babies live in a state of ‘pre-personal’ fusion with the world, and obviously wouldn’t
survive without the help of adults—not just because of their physical inability, but also
because of their lack of a sense of subject-object duality.
The truth is probably that, as I have already hinted (e.g., in my discussion of the
aboriginal notion of the ‘two-selves’), early human beings did have a degree of separateself development, but a smaller degree than ours. The difference between them and later
peoples is that the latter developed a sharper and more defined sense of ego. The egos of
primal peoples are not so developed that they result in a sense of disassociation from the
physical body or from nature, or that individual desires take precedence over communal or
universal welfare (or that they possess hypothetico-deductive reasoning powers). However,
later human beings—including us moderns—possess what Barfield describes as “the
individual, sharpened, spatially determined consciousness of today” (Wilber, 1981, p. 28)
and so do experience a painful sense of separation from the world, from other human
a
Taylor (2003), pp. 72-73.
913
beings, and even from our own bodies (and are capable of hypothetico-deductive
reasoning). In other words—again in opposition to the application of ontogenesis to
phylogenesis—primal peoples are not at a pre-personal level, but at a less developed
personal level. And as I suggested earlier, their less developed sense of ego means that
whereas we experience a ‘post-egoic’ egocentrism, they exhibit a lack of egocentrism and
selfishness.
What we really need, in order to fully substantiate the argument of this essay, are two
things. First, we need a different view of spirituality, which could account for the fact that
primal peoples are ‘spiritual’ and pre-rational at the same time... Second, we need a
different view of phylogenesis, to replace the ontogenesis-based models... I would suggest
that the basis of a different view of phylogenesis should be what the myths of many
different cultures describe as a ‘Fall’. As many of the myths indicate, the ‘Fall’ was
precisely the development I referred to earlier: the development of a much stronger and
sharper sense of ego in certain human groups.
This is precisely the view I laid out in greater detail elsewherea and which I have
summarized here. Just as above Taylor recapitulated his criticisms to Wilber’s view of
phylogenesis, I must sum up my main differences with regard to Taylor’s expressions. The
first point is that, as shown in the preceding chapter and as noted throughout this chapter,
Wilber’s spectrum of consciousness—and in particular the higher fulcra of the spectrum—
does not correspond to human ontogenesis. Regarding the alleged post-conventional
morality of primal peoples, let us not forget that Cynics and Stoics, among others in ancient
Greece (which included some of the so-called “sophists”), contrasted physis and nomos,
seeing the former as the source of a life beneficial for both self and others and the latter as
the source of all vices, and let us not forget that the Tao Te Ching and other Taoist books
remind us that morality arises when the tao is lost, and that to a great extent virtuous
actions based on morality are subject to the law of reverse effect that somehow causes them
to increase the evils that morality was intended to contain. I say true primal peoples were at
the pre-ethical stage because, while in the Communion state, these peoples had not lost the
tao and therefore had no selfish or evil impulses that should be contained by morality, and
though in the post-Communion state the tao was not patent and there was some degree of
ego-delusion, experience was pervaded by the savor of the tao to such a degree that there
was no need for a contrived conventional morality of the kind that gives rise to what
following Watts I have been calling the “law of reverse effect:” though in the relational
post-Communion state they experienced intersubjectivity, this experience was pervaded by
the awareness of the sacredness and interdependence of all essents that derived from the
unconcealment of nonseparateness and nonduality in the state of Communion; therefore,
they embodied the virtues that follow from this awareness. Finally, when Taylor denies that
primal peoples experience no sense of separation from the environment and so on, this was
so in the post-Communion state, which, being relational, involves distinctions; however,
also in the state of Communion in which they experienced no separation, these peoples had
some capacity to spontaneously deal with life situations, which is not present in infants.
The succession of the states of Communion and post-Communion is surpassed in
Buddhahood, which can manifest in our time and which actually manifested at the
beginning of the cosmic cycle.85 In fact, according to Mahayana Buddhism, absolute truth,
which is not relational, is first realized in the Contemplation state of superior bodhisattvas,
a
Capriles (1994a).
914
but these do not have either the capacity to remain uninterruptedly in this state, or to deal
most effectively with life situations from it; therefore, they have a relational postContemplation state in which they deal with all sorts of life situations. It is only fully
Awake Buddhas that have gone beyond the succession of a Contemplation and a postContemplation state, for they have totally surpassed relational relative truth and in so doing
have learned to deal with life situations from the nonrelational state of absolute truth—
which they do consummately, for they are not subject to the “centipede effect” inherent in
relational consciousness, and hence their abilities are like those of the artisan who,
according to the Chuang-tzu, drew circles by hand better than with the compass, for his
qualities were integrated and thus he suffered no impediment.
If the Path has evolved with the development of the cosmic cycle, so that in our
time it involves most sophisticated philosophical dissertations and so on, this is not because
everything improves during the unfolding of the kalpa or cosmic cycle, but because as the
cycle unfolds delusion gains in power, giving rise to an extraordinary development of
secondary process and hypothetico-deductive thinking—and in fact the extreme in the
development of delusion is reached when this type of thinking attains its zenith.86 True
spiritual masters respond to this degenerative development by explaining in the greatest
detail possible the Path and the whole of reality in terms of secondary process and
hypothetico-deductive thinking, for at this stage this is a pre-requisite for developing the
faith necessary for effectively moving beyond the delusory valuation of secondary process
and hypothetico-deductive thinking (as otherwise this process and thinking would raise
objections that would prevent us from letting go of self-conscious delusion): this is the
reason why Ashvagosha asserted that we must use words in order to go beyond words, and
though this is not what Wittgenstein had in mind when he employed the simile of using
stairs to get to a place where we no longer need them and can do away with them, it is aptly
expressed by the simile in question.
Everything tends to show that human evolution has been a process of gradual
degeneration consisting in the development of the basic human delusion called lethe or
avidya. As we have seen repeatedly, once ecological crisis reaches a threshold level, this
basic delusion completes its reductio ad absurdum and finally can and must be surpassed.
Thereafter, if the manvantara or cosmic cycle that has ended is not the final one in the
planet, a new cycle starts, beginning with a new Age of Perfection, Age of Truth or Golden
Age (which, it is most important to note, would be qualitatively different from the
preceding one); if the manvantara or cosmic cycle that has ended is the final one in the
planet, there begins the Millennium of harmony, spirituality and fulfillment predicted in the
Kalachakra Tantra, as well as in the John’s Apocalypse, in the Book of Ismailians,a and so
on.
The Ideological Character of the Sciences,
The “New Paradigm” Championed in the 1980s and 1990s,
And the Role of Science and Technology in the New Age
Scientific theories and paradigms are intellectual constructions that, to a great
extent for emotional reasons, human beings feel compelled to force upon reality, and which
no matter how scientifically plausible they may seem, or to what extent we may believe
a
Under the direction of Brice Parain (1972), p. 281.
915
them to faithful describe reality, necessarily distort to a greater or lesser degree what they
are meant to interpret. Nonetheless, scientists present the “findings” of the sciences, and in
particular those they themselves arrive at, as the objective, faithful, exact description of
reality: this is why quite a few authors have concluded that the sciences are but ideologies.
Though this is not the place to carry out a thorough, extensive demonstration of the fact
that the sciences are but ideologies, I deemed it important to provide the following
summary of some of the arguments that have been used to this aim, including some of the
ones I myself used in 1994a (a revised and corrected version of the work in question will
be prepared when conditions make it possible).
One insurmountable difficulty the sciences face in their attempts to establish
definitive truths is that immutable, universal scientific laws cannot be derived from empiric
observation, for, as David Hume showed long ago,a no matter how many observations a
scientist carries out, he or she cannot carry out an infinite number of observations—and
there is no way to make sure what repeats itself in a very high number of cases will repeat
itself in all possible cases. Aware of this, and of the fact that we do not derive our theories
directly from experience, but that we deduce them from our own principles or intellectual
illuminations, and later on we try to validate them by testing them against experience, even
an advocate of the supposed validity of knowledge and certainly no Luddite such as Karl
Popper felt compelled to note that if no experience contradicts a theory, scientists are
entitled to accept it provisionally as a probable truth: Popper rejected the essentialism of
the rationalist philosophy of science, which supposes that the aim of inquiry is a complete
and final knowledge of the essence of things, on the grounds that no scientific theory can
be completely substantiated and that the acceptance of a new theory gives rise to as many
problems as it solved.b87 A weighty piece of evidence supporting the view that no scientific
theory could ever be absolutely substantiated was the theorem that Léon Brillouin
conceived in 1932, purportedly proving that “information is not gratuitous:” any
observation of a physical system increases the system’s entropy in the lab, and hence the
“output” of a given experiment, which must be defined by the relation obtained and the
concomitant increase of entropy, will always be lower than the unit (1), which would
represent exactness of information, and only in rare cases will it approximate it—which
means that the perfect experiment is impossible to achieve, for it would have to involve an
infinite expenditure of human activity.c
For his part, Gregory Bateson noted that divergent sequences, which are those
involving individuals, and particularly individual molecules, cannot be predicted. He
wrote:d
The curious thing is that the more precise my laboratory methods, the more
unpredictable the occurrences will be. If [in predicting the effects of a stone hitting a glass]
I employ the most homogeneous glass I may find, I polish its surface until obtaining the
most exact optical uniformity, and I control as minutely as possible the movement of my
stone, making sure that the impact be perfectly vertical, all that I will achieve with these
efforts is that the occurrences be all the more unpredictable.
a
Hume (1964). This principle was expressed most precisely by physicist Max Born.
Popper (1961).
c
Brillouin (1959); De Sousa Santos (1988).
d
Bateson (1990), p. 37 (I retranslated the passage from the Spanish).
b
916
In contrast, convergent sequences could be universally predictable, but only if we
had access to all the necessary information; since in general we do not have all the
necessary information, it is not possible to prove a hypothesis, except in the abstract realm
of pure tautology.a However, tautologies do not offer new or useful knowledge, and hence
the only hypotheses that may be proved are useless ones.
As the reader surely knows, Kurt Gödel’s incompleteness theorem showed that any
logical system must contain at least one premise that cannot be proven or verified without
the system contradicting itself, and therefore that it is impossible to establish the logical
consistency of any complex deductive system without supposing principles of reasoning
the internal consistency of which is as open to questioning as the system itself.b Therefore,
it is clear that, in all scientific disciplines, formal or empirical, to take a scientific theory for
a definitive universal law or truth would involve a bias and a misrepresentation of reality—
and hence would constitute an ideological operation.
Another point is that the human psyche functions in such a way as to structure its
perception in terms of ideologically conditioned expectations, and hence in their
observations scientists tend to discover what their theories require them to find. Gaston
Bachelard noted that prejudices, such as opinions and previous “knowledge,” condition the
way researchers interpret their empirical observations, becoming epistemological obstacles
that impair their capacity to admit that the results obtained may fail to correspond to the a
priori theoretical construction that caused them to expect a specific outcome.c88 Edgar
Morin, in order to demonstrate that observational judgments are conditioned by ideology,
and that this does not happen solely in the field of scientific experimentation, but in all
walks of life, offered his readers the story of how once he saw a car overlooking a red
traffic light and frontally hitting a small bike. When he stopped to offer his testimony, the
bike’s driver acknowledged it was him who had overlooked the red light, and it was him
who had hit the car with his bike (which was corroborated by the marks on the side of the
car’s body): Morin’s socialist, righteous ideology had conditioned his perception and
caused him to see something different from what actually occurred.d In the case of
scientific experiments planned beforehand, not only is the scientist’s perception likely to be
conditioned in a way similar to Morin’s at the time of the accident, but the way the
experiment is designed and the criteria for the evaluation of its results are determined by
the researcher’s interests and expectations, which in turn are determined by his or her
ideology. This was acknowledged by Italian Marxist philosopher and activist Antonio
Gramsci, who wrote “in truth science is also a superstructure, an ideology”,e and it has
been substantiated with many pages of examples and reasonings in the book The Golem:
What You Should Know about Science, intended to show the circularity in the logic of
science (in Sextus’ sense of the term, corresponding to the fallacy of petitio principii), and
that scientists often see what they want to see.f (I am referring to observations conditioned
by ideologically-determined self-deceit rather than resulting from the fully conscious
attempt to deceive others, but often researchers have also done the latter; as way of
example, in the book under consideration we are reminded that A. S. Eddington subjected
a
Bateson (1990), pp. 39-40.
Gödel (1962, 2001).
c
Bachelard (1957).
d
Morin (1981).
e
Gramsci (1998), p.63.
f
Collins & Pinch (1998).
b
917
his pictures of an eclipse to “cosmetic surgery” in order to demonstrate Einstein’s
predictions...a)
It is universally known that, as Thomas Kuhn showed, all scientific paradigms and
theories so far, even while they were universally accepted, were contradicted in
experimentation by a number of observations, which scientists consistently ignored until
those observations became too abundant—at which point they were compelled to develop a
new paradigm or theory in order to account for the hitherto ignored observations. However,
then the new paradigm or theory was in its turn contradicted by a certain number of
observations, which at some point became too abundant, and so yet another paradigm or
theory had to be developed. Therefore, the process had to repeat itself again and again—
which is the reason why, throughout the history of science, countless theories have been
viewed for given periods as verified through experience, and yet at some point they have
had to be rejected and replaced by new theories. This shows that, so far, taking a scientific
interpretation of reality as perfectly corresponding to it, has involved an ideological
operation—and thus that in this context elusion / bad faith and ideology have lay precisely
in the belief that there are scientific theories that are verifiable through experience (and
that, when verified, they are simply true).b89
Paul K. Feyerabend has consistently argued that there is no scientific rationality,
that the whole of the epistemological rules that sciences impose on themselves are violated
every now and then—and not only are they violated, but they must be violated if the
sciences are to continue progressing—and that (as already shown) the assumption that
theories must adapt themselves to our observations implies overlooking the essentially
ideological character of observational judgments. He concluded that science is no more
than an ideology among many others, that Western reason and science are but belief
systems having no greater validity than alternative systems including magic and witchcraft,
and that “success in science depends not only on rational argument, but also on a mixture
of subterfuge, rhetoric and propaganda.”c90 Not only do human intellectual productions in
general have an ideological character, but for centuries the ideological productions in
question have served for the justification, pseudo-legitimation and implementation of
power; in particular, Michel Foucault and Gilles Deleuzed91 have noted that philosophy and
science are more than ideologies, since for many centuries philosophical systems, and for a
shorter time scientific disciplines and theories (such as psychoanalysis), have had the role
of an “abstract machine or generalized axiomatic” that functions as the matrix that makes
possible the very existence of power—their function being to provide power with the forms
of knowledge necessary to sustain the models on the basis of which it will have to structure
itself in each different period.
So it seems that the only acceptable scientific criterion for determining the validity
of science is the one established by Alfred Julius Ayer, which is that of practice.e He tells
us that we are authorized to have faith in our procedure insofar as it carries out the function
it is destined to perform—that is, so long as it allows us to predict future experience and
therefore to control our environment. However, this criterion suggests the very opposite of
a
Collins & Pinch (1998).
Kuhn (1970).
c
Feyerabend (1984, 1982, 1987).
d
Deleuze (1980); Foucault (1976, 1978).
e
Ayer (1981).
b
918
what Ayer intended to prove, for the sciences have failed in carrying out the function they
were intended to perform: while the avowed aim of the technological applications of
science was the improvement of human life and the welfare of humankind, they have
produced the ecological crisis that has led humankind to the brink of self-destruction.
Furthermore, scientific disciplines have not allowed us to predict future experience, for
rather than predicting that the technological application of science would lead us to the
brink of self-destruction, until very recently, scientists predicted it would greatly improve
human life and give rise to all kinds of marvels. Thus it is clear that Desiderius Erasmus
was quite right when he spoke of a Golden Age at the beginning of time, and of science as
a demonic catalyst of human degeneration.92 Keeping in mind the already quoted saying by
Schumacher that goes, “the devil is not evil, he just follows the wrong star,” consider the
following passage of In Praise of Folly:a
...God, great architect of the Universe, forbade tasting of the tree of Science, as though
it were the poison of happiness, and also Saint Paul condemned it openly as a source of
pride and evil, following the idea that, in my view, inspired Saint Bernard,93 when he called
that mountain where Lucifer took up residence, the “mountain of science.”
The sciences as we know them are a product of the gradual degeneration that took
place throughout the cosmic cycle, and in particular of the development of the inseparable
couple at the root of the law of the samsaric “law of inverted effect:” (a) the prevailing
instrumental interest, and (b) the fragmentary perception that was illustrated by the
Buddhist fable of the men with the elephant—which together cause us to perceive essents
either as threats / obstacles to destroy or as tools to use / goodies to enjoy, and develop a
powerful instrumental technology in order to destroy what we perceive as threats and
obstacles, and appropriate what we perceive as goodies and tools. Thus there can be no
doubt that Herbert Marcuse was right when he claimed that science is ideological insofar as
it has built into its concepts and methods an interest in instrumental action—that is, in the
technical manipulation and control of nature—and hence it is necessarily committed to an
exploitative view of nature and human beings, rather than neutrally and accurately
reflecting an objective reality.b He wrote:c
The science of nature develops under the technological a priori which projects nature
as potential instrumentality, stuff of control and organization. And the apprehension of
nature as (hypothetical) instrumentality precedes the development of all particular
organization.
And also:d
The point which I am trying to make is that science, by virtue of its own method and
concepts, has projected and promoted a universe in which the domination of nature has
a
Erasmus (1984). The excerpt was translated into English from the Spanish translation by the author of this
book.
b
Marcuse (1964), ch. 6: “From Negative to Positive Thinking: Technological Rationality and the Logic of
Domination.”
c
Marcuse (1964), ch. 6, p. 126.
d
Marcuse (1964), ch. 6, p. 135.
919
remained linked to the domination of man—a link that tends to be fatal to this universe as a
whole.
In terms of the worldview expressed in this book, the above is so because so long as
we function in terms of communicative relations, we cannot perceive—and therefore we
cannot examine—the essents we relate with, in the objectifying, dissecting manner proper
to the instrumental science that steadily developed in the last five millennia, and in
particular over the last five centuries,94 which could only be conceived and implemented
after human reason structured itself in terms of instrumental primary process relations,
becoming “instrumental reason.” Since, as explained in a previous section of this chapter,
once instrumental primary process relations and reason develop, it is impossible to limit
their ambit to particular sets of relations, this type of science inevitably had to produce the
instrumental technology that then was applied indistinctly to the non-human environment
and to other human beings, destroying the former and dehumanizing the latter and the
subject who applied it as well—a key result of which Henry David Thoreau observed as
early as one and a half century ago, expressing it in Walden with the phrase, “Men have
become the tools of their tools.”a In fact, as Lewis Mumford more recently was right to
note, the modern ethos released a Pandora’s box of mechanical marvels that has absorbed
all human purposes into The Myth of the Machine.b95 And yet this does not mean there is a
culprit, to be identified as technology: despite the nihilistic and shallow character of most
of his views, Cioran was right in noting that it is not the machines that are leading
humankind to its ruin and damnation, for these were invented by us humans because we
were already on the way to ruin and damnation: it was because of this that we devised
means which would help us attain it more rapidly and effectively.c
The above does not mean that we should simply do away with science and
technology: given the enormous population of the world, science and technology would
inevitably continue to be part of the environment of our species, and thus survival and the
transition to a New Age of plenitude and perfection would not imply our regression to a
savage yet idyllic Garden of Eden. As Tibetan Lama Chögyam Trungpa Rinpoche noted
with regard to what he christened “Shambhala vision:”d
Shambhala vision does not reject technology or simplistically advocate that we go
“back to nature.”
Since the vision of spiritual and social evolution as a degenerative process came to
us through the awareness of Awake Ones—who are beyond judgment and, insofar as they
do not feel separate from becoming, are aware that all that arises in the course of becoming
may be turned into the Path—this vision does not dwell on judgment and rejection of the
products of degenerative evolution.
As we have seen, the progressive exacerbation of perceptual fragmentation and the
generalization of instrumental relations (which together gave rise to instrumental
technology and which this technology in its turn has helped develop) have achieved the
reductio ad absurdum of human delusion; if the immediately following stage of human
a
Thoreau (1970), p. 175 (original Ed., p. 142).
Mumford (1967/1970).
c
Cioran (1964). Cited in Calinescu (1987), p. 149.
d
Trungpa (1984).
b
920
evolution were catalyzed by the wisdom that results from generalized advancement on the
Path of Awakening within genuine wisdom traditions, the outcome would be the
widespread restoration of the nonrelational state of Communion. And since this state would
alternate with a relational post-Communion state,96 into which the realization of the sacred
character of the universe proper to the state of Communion would somehow filter down,
imbuing our relational experience with a sense of sacredness, as heralded by Morris
Berman a re-enchantment of the world would take placea97—which would go along with
the restoration of communicative relations in all fields. (However, this re-enchantment of
the world would not amount to a restoration of shamanic experience and spiritual practice,
making our vicissitudes depend on the whims of elemental spirits and other powerful
beings, for its nature would be metashamanic and as such it would have the diametrically
opposite result of freeing us from the power of the beings ruling the lands of our psyches.)
As a result of the above, for the first time in recorded history our species would
engage in wisdom-imbued, pancommunicative dealings with an environment involving
science and technology—which would automatically result in a radical transformation of
these two, in a manner not too different from the one foreseen by Marcuse, who asserted
that the liberation of both human beings and the rest of nature (and, I find it necessary to
add, the survival of both) would require a new science grounded in a non-instrumental
interest (and therefore in a “non-instrumental rationality”) and involving a view of nature
as “a totality of life to be protected and cultivated” rather than as a utility to use and
manipulate.b98 (Habermas accepted some and rejected other of Marcuse’s theses as to the
ideological character of science; as observed in the preceding section of this chapter, he
rejected the claim that relations with the nonhuman environment would also have to
become communicative, and thus he could but reject Marcuse’s thesis that science and
technology must cease responding to an instrumental interest [and to the corresponding
rationality], and undergo the radical transformation being discussed.c99)
If, as warned above, the transformation necessary for survival could not consist in a
regression to a savage yet idyllic Garden of Eden as yet unspoiled by degeneration, far less
could it consist in a return to a stage in the process of evolution in which degeneration had
developed to a considerable degree, but was slightly less advanced than in our time. In
particular, it could not involve the reinstatement of a universal theocratic state, as explicitly
proposed by Frithjof Schuon in a book in which he made an apology of imperialism,d and
as implicit in works by other members of the Traditionalist movement. To begin with, I
find it extremely difficult to understand that anyone may aspire at the restoration of a state
of affairs involving extreme degeneration and oppression, featuring the most oppressive
forms of the “right-wing institutions” that developed as delusion unfolded100 (and possibly
even an Inquisition or its equivalents101), and being more distant than the present state of
affairs from the end of the cosmic cycle and hence from the prophesized restoration of the
ubiquity of the Communion of all human beings in the unconcealment of our common
nature, and the perfect condition that would follow from this. Furthermore, were this
regress possible, delusion would restart its development toward its reductio ad absurdum,
again leading us to a condition roughly analogous to the one we face today. Fortunately,
a
Berman (1984).
Marcuse (1972), p. 61.
c
Habermas (1984).
d
Schuon (1984).
b
921
however, the dynamics of the relations between primary process and secondary process
would not permit the reversion of evolution and history, and the reproduction of an already
surpassed stage in the process of negative spiritual and social evolution.
The essence of the upcoming New Age will be the restoration of the ubiquity of
Communion in the unconcealment of our common nature, characterized by total plenitude
and perfection, and therefore of the virtues that spontaneously manifest out of this
Communion, and the total surpassing of the right-wing institutions that arose in the course
of the process of degeneration. In order to institute the Age in question, rather than
returning to the past, we must go ahead without ever turning back—so long as we fulfill
two requirements: (1) that on the individual plane we tread the Path of Awakening in the
context of a genuine Wisdom-tradition, so as to surpass the basic human delusion that at
this stage has developed into a condition of extreme perceptual fragmentation and
instrumentality, and achieve the “transference of world” (Tib., chi phowaa) of the evil,
harmful and instrumental beings which are our own evil, harmful and instrumental
thoughts;102 and (2) that we fully engage in achieving the necessary changes on the social,
economic, political, cultural and religious planes. (These two planes are indivisible, for
insofar as the psyche is structured in terms of the internalized relations of human beings
with other human beings and the rest of the environment, for the psyche to change, these
relations must change, and since the way human beings relate with other human beings and
the rest of the environment reproduces the relations structuring the human psyche, an
effective transformation of the “material” relations of human beings is only possible in the
measure in which the psyche has undergone an equally real transformation.)
In the second half of the twentieth century, ecologists and holistic thinkers made the
point that mechanist paradigms and theories elicit and justify the instrumental manipulation
of the ecosphere and human beings, and at the same time cause this manipulation to ignore
the structure and function of living systems, interfering with them and eventually
destroying them. Thus in the 1980s and 1990s they enthusiastically proposed that such
paradigms and theories be replaced by what they referred to as a nonmechanist, holistic,
systemic “New Paradigm,” which they saw as the panacea for the evils produced by the
current type of science and technology—but which has often incurred in the reductionism,
denounced in the preceding chapter, of applying to all levels of reality the models of the
New Physics and cybernetics (and in general of the sciences that according to Deleuze have
become the official language and knowledge of contemporary apparatuses of power, which
these apparatuses find appealing, to a great extent because they do not have to
acknowledge human subjectivity). Furthermore, though the substitution of processes for
entities typical of systemic theories of the kind developed by the school of Norbert
Wiener103 may under some conditions be a step in surpassing the illusion of substantiality,
the mandatory transformation of science and technology cannot be reduced to the
replacement of the old mechanist paradigm with the “New Paradigm” (provided it is
permissible to speak of such a thing as a paradigm shift, which Walt Anderson thinks is
notb), for this would but place a more powerful tool in the hands of instrumental reason /
fragmentary perception. And, in fact, as Don Michael noted in the New Paradigm
Symposium organized by the Elmwood Institute toward the end of 1985 at Esalen Institute,
systems thinking is at work in current US weapons programs and war strategies (including
a
b
’chi ’pho ba.
Anderson (1986).
922
those designed for the protection of Middle East oil), as well as in lobbying for weapons
producers and so on—all of which is contrary to the avowed aims of the advocates of New
Paradigm thinking.a The transformation of science and technology that is mandatory cannot
be implemented by the instrumental rationality / fragmentary perception at the root of the
predicament we currently face, for these would use for their destructive aims whichever
paradigm proves most effective. However, if this delusion, rationality and perception were
surpassed, and the alternation of a state of Communion and one of post-Communion were
restored, the necessary transformation of science and technology would occur
automatically.104 And if this transformation could be said to entail a paradigm shift, this
shift will not lie merely in the replacement of the old mechanistic theories by Wienierian
system theories, but mainly in the replacement of the fragmentary approach for a holistic
one, of the instrumental approach for a communicative one, of the quantitative approach
for a qualitative one, and of the approach based on values such as competition, growth,
consumption, level of life and so on, for one based on Communion, homeostasis, quality of
life, wholesomeness of the ecosphere, equity, freedom, peace and so on—corresponding to
some extent to the way the “New Paradigm” was defined by Klaus Offe and Elías Díaz.b105
Furthermore, we have seen that Kuhn showed that all past paradigms required
scientists to ignore evidence in order to continue to believe in their validity, and yet at
some point such evidence became so abundant that a new paradigm had to be devised.
There seem to be no reason to assume the same could not happen with the so-called “New
Paradigm”—and, in fact, authors including Walt Andersonc have adduced the ideological
character of science in order to warn that the systemic, so-called “New Paradigm” is not the
suddenly discovered final truth regarding the structure and function of reality, but simply
another interpretation of it, not necessarily less biased, flawed and ideological than its
predecessors. (A wider discussion of works proposing a paradigm shift—such Capra’s The
Turning Point and subsequent worksd—in which we denounce, on the one hand, Niklas
Luhmann’s instrumental, conservative, nearly fascist theory of society as an autopoietic
system,106 and, on the other, Jürgen Habermas’ rejection of all systemic theories of society
on the grounds that they automatically lead to flaws like the ones inherent in Luhmann’s
theory,e was carried out in three older works of mine.f)107
To conclude the discussion of modern science, it seems important to consider what
I see as Ken Wilber’s error in the Preface to Quantum Questions:g his rejection of the usage
of findings of physics to demonstrate mysticism as an error detrimental to real mysticism,
which he accompanied by the warning that it would be a grave mistake to believe that
internalizing a worldview might suffice as a means to attain some form of mystic
awareness. To begin with, this warning seems to be out of the point, for among those who
have resorted to findings of physics to lend force to the views of mystical systems, to my
knowledge no serious, thorough author has asserted that internalizing a worldview may
suffice as a means to attain some form of mystic awareness.
a
Michael (1986).
Offe (1985); Díaz (1989).
c
Anderson (1986).
d
Capra (1982, 1986, 1988, 1996).
e
Luhmann & Habermas (1971); Luhmann (1982, 1990a, 1990b); Maturana (1985); Rodriguez (1987); von
Foerster (1985).
f
Capriles & Hočevar (1991, 1992), and Capriles (1994a).
g
Wilber (1984).
b
923
Belief in the absolute veracity of syllogisms of the kind samsara generally holds as
valid is a core fetter holding us in samsara, and thus in itself and by itself the use of words
and syllogisms cannot lead beyond samsara. However, we have seen that the Mahayana
sage Ashvagosha asserted that we have to use words in order to go beyond words: in an
initial stage of the Path the use of words and syllogisms may be extremely important for
neutralizing the doubts and objections delusive human reason may raise in order to
discourage potential practitioners from engaging in the main practices of the Path of
Awakening and thus from having the possibility of breaking loose of the fetters this
delusive reason imposes on us. In particular, words and syllogisms are essential means for
developing the unshakeable conviction that we are possessed by delusion, that this delusion
is the root not only of duhkha but also of the ecological crisis that threatens our survival,
that there is a nirvana consisting in the dissolution of delusion, that there is a Path leading
to this dissolution, and that this Path must have a given structure and function.
In Ch’an or Zen Buddhism, and in the original Madhyamaka Prasangika school of
“Thoroughly Nonabiding Madhyamikas” [Skt., sarwadharmapratisthanavadin; Tib., rabtu
minepar mawaa]),108 paradox has been used regularly to lead the practitioner’s attempt to
understand in terms of delusorily valued concepts to collapse, so that the mind may have
the possibility of temporarily collapsing together with the samsara that springs from it. It is
well known that in present-day physics seeming paradoxes have to be faced again and
again, which physicists try hard to understand, and Fritjof Caprab has implied that while so
doing extraordinary individuals might have an initial experience of voidness. Even if this
were truly possible, it certainly would not make physics into a Path of Awakening;
however, it could lead the physicist to look for an authentic teacher in a genuine tradition
of Awakening and thus set on a Path—which would certainly be most valuable. And, at
any rate, nothing forbids both physicists and laymen from using the findings of physics as
words “in order to go beyond words.”
Does the above mean that physics can prove the worldview of systems such as
Mahayana Buddhism and the like? The sciences cannot demonstrate a worldview, for as
shown in this section, it is not correct to claim that the sciences discover the “truth:” as
noted in the context of Kuhn’s findings, throughout the development of the sciences, new
theories contradicting older ones have always replaced the latter. Even though some claim
that at some point definitive theories that will not be replaced by new ones may be found,
we have no indications that this has come to pass so far—and, at any rate, we have seen
that no digital map can correspond exactly to the analog territory it describes. However, in
our time we have been indoctrinated to believe that the findings of the hard sciences are
truer than the assumptions of common sense, and hence, insofar as most physicists who
have indirectly “observed” subatomic reality through the tools devised to that aim, and
who, employing mathematics, have conceived comprehensive theories of matter, have
contradicted the view of common sense that takes as absolute truth our samsaric experience
of the world as a plurality of substances, as a concrete reality, and so on, and have seemed
to agree with the nonsubstantialistic and holistic worldview of nondual wisdom traditions
(such as the “higher” forms of Buddhism and the like), provided that we keep aware of the
fact that the sciences cannot deliver the truth, that the truth is unthinkable, that no map can
correspond exactly to the territory it interprets and so on, we may use the theories of these
a
b
rab tu mi gnas par smra ba.
Capra (1983).
924
physicists as provisory antidotes to the assumptions of common sense and equally
provisory supports for the theoretical views of the genuine nonsubstantialistic, nondual
wisdom traditions.109 In “postmodern” terminology, we may be allowed to use
metanarratives based on physics as antidotes to the metanarratives of common sense, so
long as we do not lose sight of the fact that both are but metanarratives.
It is well known that Einstein concluded that all entities were manifestations of a
single universal energy field, and implied that their limits were indeterminate and that they
were not substantial in a most important Aristotelian sense of the term, for they did not
continuously conserve the matter/energy constituting them.110 He concluded as well that
dimensionality was relative, but his theories still presupposed the existence of an objective
space through which the particles passed, an objective time that enabled them to pass
through space, and a maximum speed for this passing; furthermore, in the belief that, if this
were not so, God would be “playing dice with the universe,” together with Podolski and
Rosen he devised the EPR imaginary experiment in order to discard the existence of the
subatomic nonlocal connections that seemingly could be inferred from the views of
quantum physicists such as Heisenberg and Bohr. However, in 1964 John Bell discovered
the theorem bearing his name,111 and in the following decades the development of a
sufficiently precise measuring technology made it possible for French physicist Alain
Aspect to carry out in 1982, at the University of Paris-Sud, a real experiment roughly
equivalent to the EPR. The results of this experiment led quite a few physicists to agree
that, on the dimensional level of Plank’s constant, reality seems to be holistic rather than
consist of a plurality of discrete substances (physicist John Wheeler devised what he called
Recognition Physics, which was intended to establish how dimensionality arose out of a
nondimensional reality,a whereas physicist David Bohm developed his holonomic theory,
which attempted to show that space and time arise out of a holistic reality in which they
have no objective existenceb). So far as we do not take any of these theories to be proven
facts, we should be allowed to use them all as counterweights to our usual, discrete
experience of the realm of intermediate dimensions, so that we take neither of them to be
absolutely real and thus we become free from the nose pulling rope of blind belief.
Ken Wilber objected to the above on the basis of Fritjof Capra’s usage of Geoffrey
Chew’s bootstrap hypothesis, according to which there were no irreducible building blocks
of matter but sets of relations, and which therefore seemed to be a paradigmatic example of
the way systems theories and similar approaches may be used for undoing the illusion of
substantiality and concreteness. Systems approaches deal with subsystems of relations
between entities, which in their turn may be considered as subsystems of relations between
smaller-scale entities, which in their turn may be seen as relations between entities of an
even smaller scale... Since the “smallest” material entity posited by physics is the quark,
which does not occupy any space whatsoever, all reality should be made up of relations
between quarks. Well, the bootstrap hypothesis claimed that the quark, rather than being a
material entity, was but a postulate of fragmentary thinking, and that our perception of the
universe as a sum of material parts arose due to the self-consistence of the whole. Since
this view was such an excellent example of the systems thinking at the root of the so-called
New Paradigm and seemed to be in agreement with various Eastern mystical philosophies,
Fritjof Capra used it in order to substantiate these philosophies. However, it seems that
a
b
Gliedman (1984).
Cf. Bohm (1980); Weber (1982a, 1982b).
925
recent findings do not support the bootstrap theory, but at any rate this theory is no longer
en vogue among physicists; since a discarded hypothesis, rather than being seen as
evidence of truth, may be seen as evidence of untruth, Wilber concluded Capra’s use of
Chew’s theory was detrimental to the cause of mysticism.
Something similar could happen with other theories dealing with the seemingly
holistic reality of the dimensional level of Plank’s constant. As we have seen, one of these
is Bohm’s holonomic theory, which, besides running the risk of being refuted in the future,
involves significant logical defects. In particular, in the writings in which he describes his
theory, Bohm does not separate the phenomenal from the nonphenomenal, and thus incurs
in inconsistencies similar to the one that Kant found in Leibniz’s Monadology.a (Leibniz
claimed that space is no more than relations between monads, and made it clear that the
latter were nonphenomenal. Kant objected that if there were such a thing as
nonphenomenal monads, positing phenomenal space as the result of the relations between
monads would amount to mixing up two unmixable levels of reality: the phenomenal and
one that would be absolutely other with regard to it. According to Russell and Whitehead’s
theory of logical types,b contradictions between terms are “real” only when both terms
belong to the same logical type; in terms of this theory, Leibniz incurred in a breach of
logic, for he infringed the rule according to which what belongs to a logical type different
from that of the class being considered may neither be included nor be excluded in the
class—a breach that was neither nullified nor mitigated by Gödel’s logical objections to the
theory in question and similar systems,c or by Gregory Bateson’s objecting in simpler
terms that, for the theory of logical types to be applied, its rules have to be violated112—all
of which implies that anyone who may have thought this theory did away with the
contradictions that have been perceived in Aristotelian logic, would have been utterly
wrong.) David Bohm posited what he called an “implicate order,” which he defined as not
involving space and time, but which he referred to by compounds such as “holomovement”
and “holoflux,” involving the terms “movement” and “flux,” which in their turn imply
space and time; in order to justify the use of these terms, he noted that in this realm there
was a movement “from here to here”—which is absurd, for movement has to take place
between a “here” and a “there,” or else it not movement at all. Furthermore, in addition to
the explicate order involving apparently separate space and time and apparently discrete
essents, and the implicate order that in his view does not involve any of these, Bohm
posited a third category, which in his view was like the matrix from the other two arose,
and which he called “the spirit”—this category, if left unsubstantiated and unexplained,
being an unnecessary metaphysical postulate that would place Bohm’s theories both
beyond the realm of positive science, and beyond those of philosophical phenomenism and
phenomenology.
There can be no doubt that employing theories involving logical inconsistencies as
proofs of the views of mystical systems is detrimental to the cause of mysticism. However,
as noted above, the same will not be the case if the physical theories used do not exhibit
logical inconsistencies of this kind, and so it would be perfectly admissible to use Bohm’s
theory if it were depurated of concepts such as a movement or flux taking place in a realm
a
Kant (1966), Part I, Ch. 3, Appendix on the Amphibology of the Concepts of Reflection.
Russell & Whitehead (1910-1913).
c
Cf. Gödel (1962).
d
Bateson (1972).
b
926
not involving continuous space or time, or occurring “from here to here,” and so on.113
However, no matter what theory of physics we may use as an antidote to those of common
sense, it would be mandatory to warn our readers or interlocutors that science cannot
access absolute reality, that scientific theories are uncertain and sooner or later are replaced
for new theories, that science is no more than ideology, and that one is using a scientific
theory merely in order to show that current scientific beliefs contradict the beliefs of
common sense. This would amount to using scientific theories as dispensable antidotes to
erroneous commonsense, rather than as positive theses to be conserved after use in the
mistaken belief that they faithfully reflect the structure and function of reality: if we use a
nail to extract another nail, the new nail must not be left in situ, and if we use a ghost to
chase away another ghost, we must realize the new ghost not to be truly existent.
The above is the essence of the via oppositionisa that has been widely applied in
both East and West. In the East, two most striking examples of this method are the dialectic
of Lao-tzu and Madhyamika dialectic—and in particular Hui-neng’s dialogical use of
interrelated opposites, which he expressed as follows:b
When you are questioned, if someone asks about being, reply in terms of nonbeing. If
someone asks about nonbeing, reply in terms of being. If you are questioned about the
ordinary individual, reply by describing the sage. If you are asked about the sage, reply in
terms of the ordinary individual. From this method of reciprocal opposition there arises the
comprehension of the Middle Way (Madhyamaka). Each and every time you are
questioned, give an answer implying the opposite [of what you are expected to reply].
In the West, Heraclitus often affirmed interrelated opposites in the same paragraphs
of his book—seemingly not in order to assert reality to be conceptual but contradictory, as
Hegel did, but in order to cause the attempt to understand reality in terms of concepts to
trip, tumble and collapse together with the mind that, as we have seen, is the root of
samsara (the already quoted fr. 206 DK of Heraclitus’ is a good example of this: “Things
as a whole are whole and non-whole, identical and non-identical, harmonic and nonharmonic; the one is born from the whole and from the one all things are born”). An even
more striking instance of the via oppositionis in Greece was the method of isosthenia
(which Democritus of Abdera allegedly transmitted to Anaxarchus of Abdera, who for his
part supposedly transmitted it to Pyrrho of Elis, founder of the Skeptic School of
Hellenistic philosophy, and which reputedly was also applied by Protagoras, as well as by
Arcesilas, who purportedly introduced into the Academy), which seemed to be just the
same as Hui-neng’s method of interrelated opposites, for it consisted in balancing evidence
with contradictory evidence so as to lead beings to cease taking one view as true and its
opposite as untrue—and possibly to lead the mind to collapse. Another instance of this
method is the argument in utramque partem or “in favor of both sides” (applied by
Carneades when, in Rome, one day he preached the need for justice and the next day
preached against itc). Etc.114
Wilber says the true battle is not fought between science and religion, but between
(a) the forms of both that are verifiable or refutable through experience, and (b) the
a
This concept was emphasized in Elorduy (1983).
A shorter version of this appears in Wong-Mou-Lam (1969), p. 99. For the longer versions see: Suzuki
(1972); Watts (1956).
c
BénatouïI (2001), p. 34.
b
927
spurious forms of both, which are dogmatic and can neither be verified not be refuted
through experience. Actually, as we have already seen, the ideological character of the
sciences lies precisely in the mistaken belief that theories can be verified through
experience, and the condition for the sciences not to be ideologies is that scientists never
lose awareness of the fact that experience cannot absolutely verify their theories (though it
may certainly refute them). With regard to spirituality, the experiences of the formless
realms are themselves the verification of the existence of these realms, but they do not in
any way demonstrate the authenticity of the mystic systems that transmit methods for
attaining those experiences and that posit them as the highest spiritual accomplishments; on
the contrary, such systems are sources of error and falsehood, for they help practitioners
improve their self-deceit mechanisms in order to ascend in samsara, finally leading them to
take spurious, transient and conditioned achievements to be the true, definitive realization
of the unconditioned.
In case there is a battle, it is fought, on the one hand, between science that is
ideology insofar as it does not know its real nature and its real limits, and science that is not
ideology insofar as it knows its real nature and its real limits; and on the other hand,
between the pseudo-mysticism that leads its practitioners to establish themselves in
apparently non-dual states that in truth are transient and spurious, and the genuine non-dual
mysticism that allows us to discover the unborn, which is undying and absolutely true, and
thus constitutes the only true Refuge.
The Current Decadence and reductio ad absurdum of Modernity
Vs the Upcoming, Truly Postmodern New Age
In the last decades of the last century, it became fashionable for philosophers and
sociologists to interpret the current, advanced stage of modernity in which all that has to do
with this period has entered a stage of decadence and achieved its reductio ad absurdum, as
constituting a stage beyond modernity to be known as “postmodernity.” However,
modernity, characterized by the false idea that change and innovation are good in
themselves, and that industrial and economic growth, technological progress and so on
would give rise to ever greater human perfection, is the stage of the cosmic cycle that sets
the conditions that make it possible for basic human delusion and all that developed along
with it throughout the cosmic cycle to complete their reductio ad absurdum, so that they
may be surpassed and the cosmic cycle may come to an end. Therefore, postmodernity
must necessarily be a period posterior to the end of the current cosmic cycle, in which the
states of consciousness, relational structures and institutions that developed throughout this
cosmic cycle have been surpassed and a New Age of Communion, plenitude and harmony
has started. As I write these words, it is clear that the old cosmic cycle has not yet ended
and the New Age has not yet started, for basic delusion, perceptual fragmentation and
instrumentality are still rampant, right wing institutions continue to prevail, the ideals of
modernity (such as industrial and economic growth, technological progress, and history as
a process of perfecting) continue to be the guiding principles of most of our species, and
Communion is far from becoming widespread. Furthermore, the fact that some intellectual
circles disenchanted with the ideals of modernity have fancied the current decadence and
reductio ad absurdum of modernity to be a new period beyond modernity to be called
“postmodernity”—even though this period is marked by characteristics distinctive of
modernity, others that are characteristic of the decadence of modernity, and some that are
928
clearly a reaction against modernity resulting from the reductio ad absurdum of the latter,
and even though none of these features could become stable over the centuries (as proven
by the fact that, if all continues to be as it is now, our species could possibly disappear
from this planet during the current century)—shows that still in our time phases and
fashions succeed each other with great momentum, as is characteristic of modernity, which
rejects tradition and values innovation and change.
For us to set wholeheartedly to apply the traditional methods for having access to
the state of Communion, the generalization of which would mark the starting of the
upcoming New Age, it is imperative that a thinking becomes widespread that shows
substantiality, plurality and discreteness to be illusions, and that shows concepts,
judgments, ideas and ideals not to be absolute insofar as all that may be thought must
necessarily have a genus proximum and a differentia specifica (or at least the latter) and
hence be relative to these. However, the acknowledgment of the relativity of the relative
must not leave us without a guiding principle and reference point: it must go along with the
acknowledgement of the absoluteness of the true condition of reality that cannot be
conceived by thought, and of the fact that the various relative courses of action are not just
equal, for among these only the Path that unveils the true condition of reality and then
consolidates this unveiling can make our survival possible, endow our lives with true
meaning, and give rise to a new era of plenitude, Communion and harmony. I do not know
any trend of thought declaring itself “postmodern” that does this, and so I do not know any
such trend that can lead us into the truly postmodern New Age of plenitude, peace,
harmony and equality in frugality.
An example of a postmodern method that has been mistakenly taken to lead to some
kind of spiritual realization, and, furthermore, has been compared to the method of
Nagarjuna, is Jacques Derrida’s method of deconstruction in literary criticism. Using texts
as pretexts, a metaphysical clôture that limits human discourse and in particular restricts
the concepts applied (being, meaning, presence) in order to think the articulation of a
discourse and a related historic totality, is to be questioned, deconstructed and broken. But
what is a clôture? It is a closure (in the sense of “closing in on the outside”) of the logos (in
a non-Heraclitian sense) within the boundaries of a way of thinking and attributing
meaning, which can never be wholly self-sufficient and complete due to the powerful
double logic of reversal / displacement and postponement (déferance) in différance.115 But
what is différance? This term was made to differ in spelling but not in pronunciation from
the French term différence (“difference”), in order to mark a sharp difference of meaning.
Différance is not merely difference; it is supposed to be that which makes differences
possible and which constitutes all signs as signs (i.e., as something that refers to something
supposedly different from itself). As de Saussure made it clear, signs “mean” by differing
from other signs; however, for Derrida the key point is that they may differ, opening a
space from that which they represent, and they may also defer, opening up a temporal
chain, or participating in temporality—a double sense emphasized by Derrida’s
neologism.116 According to the French thinker, ontologically speaking the differing and
deferring of signs from what they mean, signifies that every sign repeats the creation of
space and time, and that différance is the ultimate phenomenon: we are told that it is an
operation that is not an operation; that it is both active and passive; that it is at once what
makes being itself possible and what results from it. Deconstruction is supposed to be
achieved through the identification, achieved in the analysis of the manifold levels and
articulations of a theory’s conceptual and rhetoric framework, of the unjustified binary,
929
black-and-white distinctions that are posited as pseudoabsolute dualities or dichotomies.
By these means the essentialist discourse of metaphysics is supposed to be bypassed, if not
altogether transcended, and harmful misunderstandings are supposed to be undone (for
example, that of ethnology arising as a science critique of ethnocentrism yet accepting in
its discourse and in its denunciation of ethnocentrism the premises of ethnocentrism, and
not being critique of itself). Deconstruction is always textual deconstruction, but this does
not set a limit to it insofar as Derrida insisted that language was always written language:
aware that at least since Plato and until the French Structuralists writing has been seen as a
degeneration of oral language, Derrida set out to demolish the contraposition between oral
and written language and the valorization of the former and contempt toward the latter,
intending to show at once that this contrast is an unjustified black-and-white distortion, and
that written language has a much greater extension than generally assumed—as well as
being beginningless (a view that, unlike often believed, is rooted to a greater extent in
genetics and cybernetics than it is in a radicalization of the hermeneutical tradition—which,
Derrida has hinted, remains attached to the old metaphysics of presence, and of which
mainly the Nietzschian subspecies seems to have influenced Derrida117).
Robert Magliolaa has claimed Derrida’s différance is the same as Nagarjuna’s
shunyata. Though it is clear that all differences may be said to result from negations
(suffice with remembering Spinoza’s Omnis determinatio negatio est), and différance
understood as the movement according to which language, or any code, any system of
forwarding in general ‘historically’ constitutes itself as a tissue of differences, may be
though to amount to the movement at the root of negation(s), elsewhereb I have shown
shunyata, when viewed as an experience occurring on the Path and in particular in the
practice of the Madhyamaka-Prasangika school, of Ch’an or Zen, or of the Dzogchen
teachings, not to be a negation, but a derealization that may take place when we are left
with no possibility of conceptualizing reality in terms of any of the extremes in which we
usually try to make it fit.118 It was the lower Madhyamaka-Swatantrika-Yogachara
school—that of Shantarakshita, Kamalashila and Arya Vimuktasena—which identified
shunyata with a negation; the Madhyamika-Prasangikas objected that this negation was an
affirming or implicative negation (Skt., paryudasapratisedha; Tib., mayingagc) that due to
its very nature immediately would give rise to a new assertion, keeping us in the alternation
of assertions and negations characteristic of “conventional truth”—a “truth” that pertains to
samsara and, as it is evident in the etymology of the Sanskrit term for “conventional,”
which is samvriti, rather than a truth is an “obscuration to correctness” or a “thoroughly
confused” condition.d119 It was in order to prevent practitioners from dwelling on a
negation (or on anything else, for that matter), that the Prasangika method used
nonaffirming or nonimplicative negations (Skt., prasajyapratisedha: Tib., megage) such as
the chatushkoti or simultaneous negation of all possibilities regarding a topic, which leave
nothing standing that we may hold to, but, on the contrary, may induce a derealization and
possibly result in the direct realization of the absolute truth—this being the reason why
adherents of this system were called “Thoroughly Nonabiding Madhyamikas.”f120 In Tibet,
a
Magliola (1984).
Capriles (2005, 2004).
c
ma yin dgag.
d
Chöphel (2005).
e
med dgag.
f
Skt., sarwadharmapratisthanavadin; Tib., rabtu minepar mawa (rab tu mi gnas par smra ba).
b
930
the true, original method and view of the Prasangikas became obscured when, influenced
by the mainstream literature on the allegedly imaginary debate of Samye eulogizing the
lower Madhyamaka-Swatantrika-Yogachara school and demonizing whatever looked
similar to the view supposedly defended by the Hwashan Mahayana, Je Tsongkhapa denied
Thoroughly Nonabiding Madhyamikas were true Prasangikas, and adopted the Swatantrika
method of Shantarakshita, Kamalashila and Arya Vimuktasena on the basis of a
reformulation of the shunyata to be arrived at, giving rise to a misinterpretation of
Prasangika that viewed shunyata as a negation on which the meditator should come to
abide, and which was supposed to be a nonaffirming or nonimplicative negation.121 Finally,
it is important to emphasize that, if shunyata is not a negation, far less could it be an
absolute negation, for negation is by its nature relative to that which it negates and to the
subject that negates it.
Derrida’s method of deconstruction has been considered to be similar to
Nagarjuna’s method of reductio ad absurdum (Skt., prasanga; Tib., thalgyura), which the
originator of the Madhyamaka school and his disciple Aryadeva, and later on the
Prasangika subschool, employed in refuting the basic premises of common sense—which
are the basic elements of samsaric experience and which involve such principles as
substantiality, independence, causality and space and time—and of metaphysical and
religious truths, insofar as these were based on the same premises, and in particular on
ideas such as those of essence, duality, identity and so on. Among those who have so
viewed Derrida’s method, Robert Magliola has asserted that in his destruction of the
principle of identity Nagarjuna used the same logical strategy as Derrida, and often the
same arguments later used by Derridab122 (which has probably epatéc the French author,
who has derided Eastern thought). However, Derrida’s method is incomplete, for it
deconstructs the principle of identity without destroying that of difference, and by
maintaining the latter keeps us indefinitely in the realm of delusorily valued meanings,
which as de Saussure made it clear are all based on difference: as David Loy has noted,d
Derrida “remains in the halfway-house of proliferating ‘pure textuality’;” he remains stuck
in language with its ineluctable duality. Conversely, the raison d’être of Nagarjuna’s
method is to provide us with an opportunity to go beyond all delusorily valued meanings;
in fact, Loy was right in noting that deconstruction à la Nagarjuna completely dismounts
both poles of the conceptual dualities that compose language and condition human
experience, as a result of which a radical transformation in one’s mode of experiencing the
world—or, in the more precise terminology I employ in this book, a going beyond
experiencing—might take place, which would constitute an effective release. Derrida’s
basic error lies in his insistence on conserving difference and in positing différance as the
most basic truth, for difference only makes sense in terms of its contrast with identity; the
very moment identity is negated, provided that this negation is carried out with immaculate
logic, difference has been negated by the same stroke. David Loy writes:e
The interdependence of both terms in such dualities implies that the negation of either
must also lead to negation of the other. We use “cause-and-effect” to explain the
a
thal ’gyur.
Magliola (1984).
c
Shocked.
d
Loy (1987), p. 59.
e
Loy (1987), p. 60.
b
931
relationships between supposedly discrete things, which means that our concepts of objects
and causal relations, being relative to each other, must stand or fall together: if there are no
objects, then there can be no causality (as usually understood). We shall see that the same
paradox holds true for time: if there is only time, because there are no objects “in” time,
then there is no time. Each pole deconstructs the other. It is the necessity for this second
and reverse movement that Derrida does not see. Expressed in his categories, Derrida,
although aware that each term of a duality is the différance of the other, does not fully
realize how deconstruction one term (transcendental signified, self-presence, reference,
etc.) must also transform the other (différance, temporization, supplementation, etc.).
What is the result of this double-deconstruction of “commonsense” dualities? Derrida’s
single-deconstruction leads to the “temporary” reversal ... and/or to a discontinuous,
irruptive “liberation” from reference grounded in the search for unattainable origins, into
the dissemination of a free-floating meaning beyond any conceptual clôture. For
Nagarjuna, this would only be the illusion of liberation, while remaining trapped in a
textual “bad infinity” which tends to become increasingly playful.
Loy notes that, since Derrida’s deconstruction ends up with difference, it
necessarily initiates a new swing of the pendulum of dualistic conceptualization requiring
yet another deconstruction effort. Loy notes that this seemingly endless proliferation (or
dissemination, which is Derrida’s term) is nihilistic if it has no other purpose than to
engage in “linguistic free play.” However, he believes this nihilistic end might be given a
more positive Nietzschian interpretation in that for Nietzsche nihilism opens the way to a
necessary revaluation of all valuesa (as will be seen below, in terms of Vattimo’s thinking
this is a modern reading of Nietzsche, the postmodern reading not involving such
revaluation). Harold Cowardb retorts that Loy is wrong in asserting that to Derrida spiritual
freedom lies in the free play of words Nietzsche refers to, for in the French author such
freedom is somehow related to silence; he writes:
In his essay “Cogito and the History of Madness,” Derrida says that “silence plays the
irreducible role of that that bears and haunts language, outside and against which language
can emerge... Like nonmeaning silence is the work’s limit and profound resource.c This line
of thought is given a spiritual resonance when in “Edmond Jabès and the Question of the
Book” Derrida observes that the God of the Jews constantly questions out of silence—that
meaning emerges not in propositions, but in the silences, the blanks...d Rather than being
the result of the cessation of language, Derrida’s silence is the origin, the source of all
speaking, and yet a source that locates itself in the quiet between the sounds of God’s voice
and the spaces between the letters of his writing. And it is here, not in Nietzsche’s free play
of words (as suggested by Loy earlier) that Derrida seems to locate spiritual freedom.
Language both ours and God’s originates not in his speaking but in his keeping still—it
“starts with the stifling of his voice and the dissimilation of its face. This difference, this
negativity in God is our freedom, the transcendence and the verb which can relocate the
purity of their negative origin only in the possibility of the Question.e This theme reappears
in Derrida’s “Violence and Metaphysics: An Essay on the Thought of Emmanuel
a
Nietzsche (1967 [e.g., II:9], 1968 [e.g., pp. 55, 674], 1997b [e.g., Preface, p. 4]); Loy (1987), p. 80.
Coward (1990), chapter six, “Derrida and Nagarjuna,” pp. 125-146.
c
“Cogito and the History of Madness.” In Derrida (1978), p. 54.
d
“Edmond Jabès and the Question of the Book.” In Derrida (1978), p. 71.
e
“Edmond Jabès and the Question of the Book.” In Derrida (1978), p. 67.
b
932
Levinas”...a Indeed in a very recent essay, “Comment ne pas parler: Dénégations,” Derrida
deals head on with negative theology as an interpretation of silence.b
Of course, silence makes the difference with regard to words and letters and is a
necessary contrast for these to have their meanings, and we may opt for silence just as we
may opt for text, word, letter; therefore, if we understand silence to be the space where
Derrida places freedom and emancipation, it will be clear that this freedom and
emancipation are false insofar as they lie in something that, being relative to words and
letters, lies within the dualistic trap of conventional truth or samvriti satya which, as we
have seen, is a thoroughly confused condition involving an obscuration to correctness. It
should be clear by now that emancipation, freedom and absolute correctness lie solely in
the realization of absolute truth, which takes place only when the delusory valuation of
thought comes to an end and thus we cannot grasp at any extreme; in other words, it is
realized when we go beyond the duality between texts and textuality, on the one hand, and
silence, on the other, in the unveiling of what the Mahayana calls achintya or the
Unthinkable (which rather than being a mere absence of thought [is] the true nature of both
thought and the absence of thought), and which in Derridian language should be called the
Unwrittable (which, rather than being a mere absence of text, [is] the true nature of both
text and the absence of text).
Harold Coward believes the result of Derridian deconstruction makes people
sensible to the interdependent (pratitya samutpada) universe and therefore “is in many
ways similar to the goal of Nagarjuna’s chatushkoti or negation of the four extreme views;”
however, this could not be farther from the truth, for the universe viewed in terms of
interdependences (either qua concatenation of the twelve links or nidana as in the
Pratyekabuddhayana, or qua simultaneous interdependence, as in the Madhyamaka school)
constitutes the relative truth, whereas the aim of the chatushkoti is to make it impossible
for the mind to adhere to any conceptual view, so that relative truth may collapse and
absolute truth may have a chance to unveil. This unveiling temporarily puts and end to
samsara and constitutes an instance of nirvana, and hence represents an interruption of
interdependent origination qua succession of the twelve links or nidana, for only in
samsara there manifests the basic delusion called avidya (first of the twelve links), only in
samsara is there death as such (which together with old age makes up the twelfth and last
link, jaramarana)—and the same applies to the remaining ten links or nidanas. Likewise, it
represents an interruption of simultaneous interdependence, for it temporarily puts an end
to the illusion of multiplicity. The point is that realization of the interdependence of relative
truth may be useful in (though it is certainly not sufficient for) fostering communicative
relations and promoting respect, but is utterly different from the realization of absolute
truth that disconnects the delusory valuation of thought that is responsible for the illusions
of plurality and oneness and in general for all drishtis or viewpoints, and which therefore
(is) beyond plurality and interdependence, just as much as it (is) beyond unity and identity,
and in general beyond all drishtis or viewpoints. Thus “killing the Greek father, the
Platonic logos; killing speech until there is a primordial solitude out of which our ethical
a
“Violence and Metaphysics: An Essay on the Thought of Emmanuel Levinas.” In Derrida (1978) p. 89 et
seq.
b
English version (trans. Ken Frieden): “How to Avoid Speaking: Denials.” In Budick (1989), pp. 3-70.
933
relationship to the other arises”a belongs to relative truth and lies within the ambit of the
conventional that, insofar as it involves an obscuration to correctness, is thoroughly
confused. Furthermore, as will be shown below, unless it alternates with the state of
Communion in which the relative / conventional temporarily dissolves, the realization of
interdependence will not give rise to pancommunicative relations and deep-seated respect,
for these can only manifest in the state of post-Communion, as a spontaneous result of the
realization, in the state of Communion, of the divine, common nature of all entities.
Thus it is not difficult to understand the reasons why absolutely relativistic,
nihilistic consequences have been drawn from Derrida’s thought. Since Derrida rejects
identity but accepts difference, and he never even entertained the idea that true liberation
may lie in going beyond difference and identity upon the self-liberation of delusorily
valued thought, Derrida-inspired social constructivists and those that make of “political
correctness” their guiding principle and reference point, on the grounds that all ways of
thinking and all ways of acting result from differences that must be equally honored and
respected, often make a point of considering all human individuals and all ideologies as
equally worthy of respect and acceptance—which implies we should place on the same
footing a hatred-blinded Bin Laden and a bodhisattva like the Dalai Lama, those who
promote abuse and intolerance and those who promote respect and tolerance, Nazis and
engaged Buddhists, those who are eager to cut environmental regulations and invade other
peoples in order to control their resources, and those who work for survival and for the
establishment of the upcoming New Age. However, if we honored those who are eager to
trample on the respect of differences, a Bin Laden might obtain power and kill all of those
who refuse to convert to his faith, or the extremist ruling elite of the single superpower
might continue to receive the votes of most US citizens and thus lead to its consummation
the process of destruction of our planet.123
According to many social constructivists, just to place on equal footing, in a nonWestern civilization of culture, the prevailing scientific views and the traditional views of
that civilization or culture, is a progressive action, for then neither set of views will be able
to claim absolute truth and so in the long run tradition will end up losing its grip over the
civilization or culture in question. However, this very hope shows that those who promote
this approach do not really place on equal footing the scientific views prevailing in their
own cultural settings and the traditional views of other civilizations or cultures; that they
believe the former to be superior to the latter and wish the former may come to replace
what they view as “inferior” or “backward” traditional views. The point is that the moral
imperative that minority cultures be respected cannot beget true respect, for it would
amount to conserving the delusory valuation of differences and then concealing it with the
cloak of respect toward differences—which would have the same inverted effect that, as
the Tao-Te-Ching showed, has had the enforcement of morality and so on. The only way to
develop genuine, deep-seated respect, both toward the cultural differences that deserve
respect and toward the natural environment and other human beings, is by gaining access to
the state of Communion that temporarily puts an end to the delusory valuation of
differences, for then, in the post-Communion state, one would maintain an underlying
awareness of the illusoriness of all differences, as well as of the fact that the essents
resulting from these differences are aspects of the single, universal divine body which
a
Derrida (1978), “Violence and Metaphysics: An Essay on the Thought of Emmanuel Levinas,” pp. 89 et
seq.
934
unveiled in the state of Communion—and which is naturally celebrated and venerated in
the state of post-Communion. The paradox is that while on the one hand only the
prevalence of Communion can result in a genuine, deep-seated respect of cultural and other
differences, on the other hand the prevalence of Communion would in the long run give
rise to a homogenization of humankind.124
For Derrida the whole, which he calls the sign, is a whole of language, for language
is the only reality he accepts: it is assumed to refer to itself rather than to an extratextual
reality. On the other hand, for the Madhyamikas the whole involves all that language
interprets and that is not language, as well as the whole of language; insofar as, there being
nothing larger to include it and nothing that it may exclude, the whole cannot have either
genus proximum or differentia specifica, it cannot be thought; and since the true nature of
all parts of this whole is that of the unthinkable whole, their true nature can only be realized
in a nonconceptual unconcealment.125 Whereas this is for Nagarjuna the absolute truth,
insofar as language can never manifest the whole of the sign, for Derrida there is no
absolute truth. Coward proposes a critique of Nagarjuna from the standpoint of Derrida and
tells us that Derrida would object Nagarjuna’s complete separation of language from the
true condition of reality on the grounds that it privileges one opposite or extreme over the
other, and hence is just as unsatisfactory as the extreme logocentric position that identifies
speech with truth. He writes:a
Nagarjuna... takes the inherent nature of language in its subject-object conceptualizing
of all experience to be the major obstacle to the experience of the real. Whereas for Derrida
language is the means for the experience of the real, for Nagarjuna language as vikalpa or
imaginary construction is the obstacle (avidya) to be removed, if the real is to be seen.
This is a complete misunderstanding of Madhyamaka, which does not deem the
obstacle that prevents the unconcealment of the true condition of reality to be language: the
obstacle is the illusory manifestation of the subject (the grasper) and the object (the
grasped), and our unrelenting grasping at concepts (i.e., what here I have been calling the
delusory valuation of concepts), and the problem is not that language conceptualizes all
experience in terms of subject and object, for this implies the erroneous assumption that
human experience is not structured in terms of the illusory subject-object schism, of the
illusion of space and time as separate, objective dimensions, of the illusion of
substantiality, of the illusion of causality, etc., and that then, a posteriori, language
conceptualizes this experience in terms of subject and object, etc. On the contrary, it is our
experience that conceals the true condition of reality, for it is conditioned by the delusory
valuation of the three types of concepts—the delusory valuation of the supersubtle thoughtstructure known as the threefold thought-structure, which as we have seen repeatedly is a
super-subtle concept, giving rise to the delusive subject-object schism that pervades
samsaric experience. Language does reflect the imaginary constructions manifesting in our
experience as a result of the delusory valuation of the three types of thoughts, and in this
sense it has been said to be vikalpa, but this does not at all mean that Nagarjuna ever
claimed language to be separate from the true condition of reality: as we have seen, the
map language draws is part of the unthinkable, indivisible territory of the given, which
involves no differences, and so the true condition of reality is also the true condition of
a
Coward (1990), p. 138.
935
language; it is the delusory valuation of the map that is responsible for all illusory
differences—including the one between territory and map. Coward also says Nagarjuna
identified silence with shunyata, which is not at all the case; even if by silence we
understood the silence of the mind, this silence would be the condition the Dzogchen
teachings call kunzhi or base-of-all, which is neither the experience of shunyata, nor the
absolute truth posited by Nagarjuna: the error of identifying silence as a trait of absolute
reality is extraneous to Buddhism and proper to a Hindu muni sadhu who remain silent
because “the absolute does not speak.”126 Hence the arguments on the basis of which
Coward says Derrida would have retorted that it is his own system that does not privilege
an extreme over the other, and that it is Nagarjuna who is missing the middle path and
hence is a suitable candidate for deconstruction, rather than being Nagarjuna’s arguments,
are extremely coarse misinterpretations of the arguments of Nagarjuna.
David Loy says that Nagarjuna intends shunyata to be a soteriological therapy
rather than an ultimate truth or ontological category, and that emptiness, the relativity of all
things, is itself relative (and the ultimate truth, like the conventional, is devoid of
independent being). Loy is right in this, for, contrarily to Tsongkhapa’s interpretation, the
absolute truth is not shunyata appearing as object to a subject; however, we cannot infer
from it that for Nagarjuna there is no absolute truth: the great Indian Master posited an
absolute truth (Skt., paramarthasatya; Tib., döndam dempaa), which may be arrived at
when the mind can no longer adhere to any conceptual extreme (i.e., to any concept, for all
concepts are extremes: hence the name Madhyamaka), provided that the true condition of
all phenomena (Skt., dharmata; Tib., chönyib) becomes patent—which can only take place
beyond the subject-object duality. Loy is right that this ultimate truth, like the
conventional, is devoid of being, for, as we have seen throughout this book, being is the
most basic phenomenon of human delusion: qua Base, ultimate truth is devoid of being
insofar as being is a delusion that does not correspond to the true nature of all essents,
which is what I am calling the ultimate truth qua Base; qua Path and qua Fruit, ultimate
truth is devoid of being in a different sense as well, for in the condition of ultimate truth
qua Path and Fruit the delusive phenomenon of being simply does not manifest.
Furthermore, in itself this absolute truth is not an ontological category, for categories are
creations of thought; however, when absolute truth is referred to by language in the state of
relative truth, there arises a relative representation of absolute truth, which is what I call a
“metaontological category.” Finally, though Loy is right in saying that all phenomena,
including words, are tathata or thatness, and hence there is no discontinuity between
language and what it interprets, he failed to note that the point in Zen dialogues is to “pull
the carpet from under the mind’s feet” so that, in the impossibility of adhering to any
concept, the dharmata may become patent beyond all conceptually-tinged perception. He
also failed to note that, as we have seen, in fully Awake Ones words and thoughts manifest
beyond delusory valuation, qua so-called other-directed assertions (and the same may
occur in really advanced Dzogchen practitioners), and that otherwise Shakyamuni could
not have spoken the sutras—or, since he spoke them, he would not have been fully Awake.
The core of the matter is that whoever is affected by the delusory valuation of
thought will necessarily experience the constructions of thought as ultimately real, and
hence if she or he engages in deconstruction à la Derrida, this process would have to be
a
b
don dam bdem pa.
chos nyid.
936
endless, for the result of every stage of deconstruction will be a construction suitable for
deconstruction, and at no point in this process will she or he arrive at the state of aletheia in
which the constructions of thought are not experienced as ultimately real. Since the
delusion to be overcome involves taking the constructed (Pali, sankhata; Skt., samskrita;
Tib., düjea) as given (Pali, asankhata; Skt., asamskrita; Tib., dümajeb), this delusion is only
overcome in the realization proper to systems like the higher forms of Buddhism, which
lies in the unveiling of the truly given, unborn and unconstructed (Pali, asankhata; Skt.,
asamskrita; Tib., dümajec). Therefore, Nagarjuna would be right in seeing Derrida as a
suitable candidate for refutation through reductio ad absurdum, which is the method that
Nagarjuna taught in his Sutric teachings (as different from his Tantric teachings and his
Dzogchen teachings,127 in which he taught more powerful methods) in order to draw the
veil concealing the given, unborn and unconstructed. Loy is thus right in asserting that
Derrida’s critique of Western philosophy fails only in that it does not go far enough, and
that the way to lead it to completion is found in Nagarjuna.d128
The advent of postmodernity as I understand the term—as the end of the present
cosmic cycle and the advent of the upcoming New Age—depends on the generalization of
the practice of the Paths of Awakening that can effectively help restore Communion and
make it widespread. Among such Paths, the Buddhist one responds best to the spirit or our
time, for, among other things: (1) it was one of the first two religions to reject the caste
system which is the backbone of Hinduism (which the Indo-Europeans imposed after their
conquest of India in order to maintain their power and privileges) and to ban the ritual
suicide (sati) of widows, and the first to admit women into the practice of the Path of
Awakening;129 (2) it never posited a God or soul; (3) it consistently deconstructs
metaphysical and religious fictions, and (4) it asks us to believe only that which, after
investigation, we have ourselves tested and found reasonable, and that is for our own good
and for that of others. The Kalama Sutra (belonging to the First Promulgation or
dharmachakra) tells us:
Do not believe in the strength of traditions, however much they may have been honored
for many generations and in many places; do not believe anything because many people
speak of it; do not believe in the power of sages of old times; do not believe that which you
yourselves have imagined, thinking that a god has inspired you. Believe nothing that
depends solely on the authority of your teachers or priests. After investigation, believe that
which you yourselves have tested and found reasonable, and that is for your good and that of
others.
Above, two of the supposed similarities some authors have perceived between
Nagarjuna and Derrida were discussed; another apparent similarity between Buddhism, on
the one hand, and Derrida and other so-called “postmodern” thinkers, on the other, lies in
the fact that Buddhism asserts the human subject (and, in the case of higher Buddhist
systems, even the mental subject) to be an illusion that must dissolve for the true condition
of reality to be realized—which has been perceived as being alike to the assertion that
a
’dus byas.
’dus ma byas.
c
’dus ma byas.
d
Loy (1987).
b
937
postmodernity represents the death of the subject. Derrida, in particular, has noted that his
deconstruction of the claims of objectivity goes hand in hand with the deconstruction of
subjectivity,a for just as claims to objective truth are a narrative that must be dispelled, so
too is subjectivity a myth that as such is to be deconstructed. In a later work,b the French
author goes so far as to criticize the narratives of freedom and democracy on the grounds
that they imply the emancipation of a Subject (in this case a “people”), and to claim that
this appeal to the “metaphysics of Subjectivity” puts these narratives on a par with fascism,
insofar as fascism, as represented by Martin Heidegger, also appeals to a Subject, which in
this case is the supposed “Spirit of the West.” However, Derrida’s deconstruction of the
subject involves the same limitations that were pointed out in the discussion of general
Derridian deconstruction: they lead toward difference, which, in the thought of Derrida, is
prior to the subject, but lack the potentiality to lead, as Nagarjuna’s reductio ad absurdum,
to the effective dissolution of the appearance of there being a subject (an appearance that
may be disassembled into the illusion that the “subject” understood qua body-speech-mind
complex is a self-existent, substantial individual; the illusion that the mental subject
produced by the delusory valuation of the “threefold thought-structure” is a self-existent
soul or mind; and several other onesc). Only if understood as the Dionysian dissolution of
the illusion of there being a self-existent subject in the manifestation of the state of
Communion—in which there is no illusion of selfhood, of separation (difference), of
duality or of plurality, and in which interpretations in terms of thoughts do not manifest—
will the death of the subject mark the start of the genuine postmodernity corresponding to
the upcoming New Age. Though in post-Communion the illusory subject manifests anew,
the feeling of apparitionality and the erosion of the third sense avidya / marigpa has in the
Dzogchen teachings proper to post-Communion no longer allows us to fully take to be
absolutely or inherently true.
Louis Althusser, who taught at the École Normale Supérieure in the same period as
Foucault and Derrida, set out to reinterpret Marx in terms of Lévi-Strauss, giving rise to a
Structuralist reading that emphasized the “scientific” Marx and rejected the humanist Marx.
Althusser radicalized the idea that the subject is socially bound and does not exist before
society, by arguing that “ideology has the function of ‘constituting’ concrete individuals as
subjects:”d rather than being the creator of ideology, the Subject that is fancied to be the
author of its own destiny is an illusion manifesting as an effect of ideology, and rather than
being the author and protagonist of history, the Subject is at once an effect and a support of
the structures and relations of the social formation. This appears to coincide with Derrida’s
doing away, by one and the same stroke, with the subject of emancipation in the narratives
of freedom and democracy, and the spirit of the West in Nazi-Heideggerianism—as well as
with the stances of other “postmodern” thinkers according to whom history does not have
the human subject as its protagonist. At first sight this idea may seem similar to the
Buddhist view according to which there is no truly existing self, and even the mental
subject is not a substantial existent but a spurious appearance that, because of the delusory
valuation of the threefold thought-structure, arises with each and every cognition and
a
Derrida (1967). Heartfield (2002).
Derrida (1991). Heartfield (2002).
c
For a list of several such illusions, cf. Capriles (1986).
d
“Ideología y aparatos ideológicos del Estado.” In Althusser (1981), pp. 97-141. English version in Žižek
(Ed., 1994), pp. 129 et seq. For a general discussion of the subject cf. Heartfield (2002).
b
938
immediately dissolves, or to the Buddhist aim of achieving the dissolution in Awakening of
both the illusion of a self and the mental subject that seems to be separate and different
from its object.130 However, the view of history without a subject does not involve the
understanding that on all levels of reality the self is no more than an illusion, or, even less
so, that the illusion in question must dissolve in Communion for history to reach its end
together with the present cosmic cycle and for the upcoming New Age to start.
Another apparent coincidence between Buddhism and “postmodern” thinking lies in
the fact that, on the one hand, Gianni Vattimo reiterated Nietzsche’s idea that all values
must be surpassed, which he radicalized in order to make sure that surpassing the old
values will not amount to the creation of new values, and on the other hand Buddhism
makes it clear that full Awakening involves the surpassing of all values in a condition in
which they are no longer needed, for the individual can no longer do harm and, on the
contrary, spontaneously benefits all beings. However, the surpassing of all values that
Nietzsche posited and that Vattimo radicalized does not at all correspond to Awakening,
and does not result in doing no harm and spontaneously benefiting all beings (Nietzsche
himself considered that the collapse of values could either represent a problem or a
solution to the problems humankind faces in modern times, according to the attitude
individuals adopted in face of it). Let us take a closer look at Nietzsche’s views on nihilism
and the “postmo” interpretation Gianni Vattimo makes of them.
Nietzsche asserted the need for a secure foundation for thought and cultural practice
to be the root cause of decadence in modernity. Christianity gives meaning to human life
by positing supposedly objective grounds of value beyond the human individual in the
form of God the Father, the divine source and legislator of value, the spider of finality and
morality which is supposed to exist behind the great net and web of causality, of which
Nietzsche wrote, “there is no eternal reason-spider and reason-cobweb.”a In its turn,
metaphysics is mainly a compound of Christianity and Platonism positing a “true world”—
a metaphysical world that, like Plato’s eidos, lies behind this physical world of mere
appearances, in relation to which the latter has little value.131 Christianity and metaphysics
make up Nietzsche’s first form of nihilism, which the German philologist-philosopher
called “religious nihilism” and which carries within itself the seed of the forms of nihilism
and the decadence that are to follow; at its heart are the longing for a rational justification
of life and the corresponding notion of a foundation (which Nietzsche deemed to be of
Socratic origin132), which by seeing life as being in need of justification makes a negative
judgment on life—and which is at work both in the moral Christian interpretation of the
world and in the modernist ideology of progress. The moral Christian and metaphysical
Platonic interpretations of the world carry in themselves the seeds of their own destruction,
to a great extent because one of their main values is Truth, and when the quest for Truth
and the pursuit of Knowledge are applied to these two interpretations of the world, at some
point they will be revealed to be untrue: the pursuit of “Truth” leads to the truth that there
is no “Truth,” and the pursuit of “Knowledge” leads to knowledge that there is no “True
Reality” in the Platonic sense, no “Kingdom of God” and not even God: all that was
formerly viewed as transcendent sources of value beyond the human individual is
discovered to be but a myth. This is the “Death of God,” which implies the death of a
world-view and of the whole set of values of all kinds that were inherent in that worldview, and which announces the advent of the Age of Nihilism, in which the term nihilism
a
Nietzsche (undated 2), section 48.
939
has a new sense: it is the disease characteristic of an age of cultural barrenness arising from
this loss of belief, which Nietzsche himself did not welcome insofar as he foresaw that one
of its consequences would be that all that we regard as human civilization and culture, all
that we hold as most worthy and valuable and that is a source of human self-esteem, may
very easily be destroyed by an extremely brutal and animal-like age—which might end up
giving rise to a catastrophe in what concerns truly human existence. Nietzsche wrote:a133
What I relate is the history of the next two centuries. I describe what is coming, what
can no longer come differently: the advent of nihilism... For some time now our whole
European culture has been moving as toward a catastrophe, with a tortured tension that is
growing from decade to decade: restlessly, violently, headlong, like a river that wants to
reach the end...
This, which is characteristic of late modernity, is according to Nietzsche the second
stage of nihilism, which may be called radical nihilism, which is usually a social fact
related with the decay of a civilization, and which Vattimo and other so-called
“postmodern” thinkers assert to be the condition pertaining to the present stage of
humankind, in which individuals may find themselves incapable to find valid criteria for
choosing one value, truth or course of action over another. Radical nihilism may be faced
either passively or actively: if we face it passively we become apathetic and depressed due
to lack of a sense of meaning, values and so on; however, if we face it actively, as
Nietzsche proposed we do, we carry out “the radical repudiation of value, meaning and
desirability”b and set out to destroy all values, including the ones traditionally attached to
God, the supposedly “true world” and metaphysics itself—such as truth, compassion,
humility, pity, and even the very distinction between good and evil (which fosters the
absolute relativism criticized in the discussion the concept of “politically correct”).
According to Vattimo’s Nietzsche, if humankind faced this stage of nihilism actively,
beginning in Nietzsche’s time and for a couple of centuries, nihilism would radicalize
itself—which would lead to the third stage of nihilism, which would be that of
“accomplished” or “complete” nihilism, and which would be finally attained when no
values whatever remained, for it would consist in the completion of the process of
destruction of all values.
Vattimo sees Nietzsche’s critique of truth as a strategy of nihilist radicalization that
at once dissolves the belief in truth and the notion of an origin. In “On Truth and Lie in a
Nonmoral Sense,” Nietzsche presents as metaphors what most people so far have taken to
be truths:c rather than knowing things in themselves as they truly are, we know them
through a series of metaphorizations—from thing-in-itself to sense-data, to mental image,
to word, to mediation in a cultural sphere of meaning, and back to reference to the thing.
Each transformation is a metaphor of what it transforms, without relatedness to an origin or
foundation; there are only metaphoric transformations. In this way, what are normally
taken to be truths are shown to be errors, or rather results of processes of erring—which is
very similar to the way Mahayana Buddhism views them.134 However, Nietzsche does not
seem to contemplate a “real Truth” that would lie in Seeing through the errors hitherto
taken as truths—such as the Heraclitian aletheia as understood in previous chapters of this
a
Nietzsche (1968), p. 3.
Nietzsche (1968), p. 7.
c
Nietzsche (undated 1). This paper remained unpublished for a long time.
b
940
book, which, rather than lying in the experience of a delusorily valued concept that we
wrongly take to be absolutely true (as is the case with the pseudo-truths accepted by
metaphysics, religion or common sense, regardless of whether they are understood as
adæquatio rei et intellectus, as clara et distincta perception or whatever), lies in the
spontaneous liberation of delusory valued concepts, which shows them to be mere fictions,
and which can only be achieved by treading the Path of Awakening in the context of a true
wisdom tradition. Failure to acknowledge this “real Truth,” as in the case of Vattimo, can
but give rise to a most harmful type of nihilism, which would doom humankind to despair
and ultimately self-destruction.
As is so often the case in Nietzsche, he shares a basic view of Buddhism—in this
case, that metaphysical and religious fictions must be seen for what they are and left
behind—but draws from it a series of conclusions absolutely contrary to Buddhism and
proper to the most inflated ego, which are harmful to both the individual and the species.
The above-mentioned rejection of pity, compassion and humility manifests as the most
extreme selfishness and arrogance, which are evident in many of Nietzsche’s leitmotifs,
including his pseudoaristocratic, elitist contempt for the “rabble”a135 (which seems to
constitute his Jungian shadow), the tone and the terms in which the traits that would
supposedly characterize the Übermensch are proclaimed, the contempt for the values,
virtues and the “feminine ideals of Christianity,” etc. Furthermore, the merely intellectual
rejection of the distinction between good and evil by human beings who, rather than
finding themselves in the state of Communion beyond ego-delusion, are possessed by
egotism and the evil tendencies resulting from the development of the Jungian shadow as
explained in a previous chapter, is simply a recipe for evil. These and other of Nietzsche’s
scandalous views seem to be symptoms of a basic tension resulting from the contradiction
between, on the one hand, the assertion of the need to get rid of the illusion of ego in
Dionysian Communion and the concomitant negation of the ego’s supposedly true
existence, and on the other, the manifestation of the most inflated ego possible, which is
patent in the delirious statements of the most extreme arrogance that run throughout his
writings. I believe this contradiction may be a result of having superficial glimpses of
nonego without the due preparation, which makes the subsequent manifestation of ego
believe itself superior to all other egos insofar as “it has attained nonego” (roughly like the
massive ego-inflation that, according to Wilber’s mistaken view, would supposedly be
experienced by individuals at the magical stage if they experienced the transpersonal
realmsb)—and I also believe the contradiction in question to be an essential element of his
madness and of the fact that this madness ended up in a cul-de-sac (independently of the
role his syphilis may have had in the organic changes related to his psychotic
derealization).
Gianni Vattimoc claims the diverse theories of postmodernism only gain clarity and
rigor when situated in relation to the philosophies of Nietzsche and Heidegger,136 and in
particular to the nihilistic aspects of their thought, and to this aim he identifies two types of
reading of Nietzsche’s nihilism:
(1) One that is modern and proper to the Enlightenment (in the sense of the modern
European belief that reason and education will result in individual and social perfection)
a
Nietzsche (undated 2).
Wilber (2000a), p. 15.
c
Vattimo (1988).
b
941
insofar as it regards history as lineal and as leading to a specific outcome—namely the
surpassing of nihilism in the attainment of accomplished or complete nihilism. According
to this interpretation, the surpassing of all traditional, transcendent values in accomplished
or complete nihilism would paradoxically result in a wholly new era in which nihilism
could be left behind and new categories of valuation would be actively created which
would be immanent and apply exclusively to this world, and which would be wholly
affirmative and free from nihilism. Since this reading involves harboring hopes with regard
to the advent of a condition that it will lead to a regeneration of humankind, Vattimo sees it
as involving the narrative of progress qua constant creation of the new and overcoming of
the old, and qua process leading to a future triumph and perfecting of reason in an idealized
condition that he views as being suspiciously similar to the Enlightenment, for there is a
tendency to conceive it as illumined by a rationality that could well be viewed as an origin
providing a secure ground or foundation (as we have seen, Vattimo considers this longing
for a secure ground or foundation to be precisely what is coming to an end in
postmodernity, and Nietzsche saw it as the first stage of nihilism, source of all subsequent
stages). See where to insert this: Nietzsche —to whom the divorce between human
begins and nature was the “human degeneration—seems to have intuited that history
developed like a process of reductio ad absurdum, for he asserted nihilism to advance
toward an extreme at which it could be surpassed, and insisted that the human—or,
in the macho terminology of his time, “man”—was “something that must be
surpassed.” (Perhaps not even here but in discussion of reductio; perhaps here;
perhaps in Low’s reference to surpassing nihilism... or wherever.)
(2) One that is postmodern in that it does not foresee a salvation resulting from the
end of linear history, which includes his own reading of Nietzsche and which he views as
the correct interpretation of the latter’s nihilism insofar as the Prussian author responded to
the decadence of modernity by rejecting the category of overcoming along with the ideal of
the origin understood as ground or foundation. This view calls for discarding what Lyotard
called “metanarratives”a (including all interpretations that endow history with meaning—
such as for example the view of human evolution and history expounded in this book), for
rejecting “modern” views, for abandoning hope, and for dissolving (or deconstructing) the
construction of the origin as ground.
In order to bring out the “postmodern” elements of Nietzsche’s though, Vattimo
analyzes his views on history, which he sees as contributing to a philosophy appropriate for
the postmodern age in which history is supposed to have ended (and which he believes to
be the present period).b In Human, All Too Human,c concerned with the decadence of
modernity and how the ensuing cultural ills might be cured, Nietzsche problematizes the
concept of “overcoming” that is essential to what Vattimo views as the modernist
interpretation of his theory of nihilism. Since Vattimo does not consider overcoming
modernity to be a viable solution, for the concept of “overcoming” is to him thoroughly
modernist and concomitant with the idea of a progressive return to the origin, he insists
nihilism cannot be “overcome” by an overcoming; what can actually happen is that
modernity dissolves through a radicalization of its tendencies in radical nihilism. In fact, in
contrast to the modernist interpretations, which posit a purely affirmative state to be
a
Lyotard (1994).
Vattimo (1988).
c
Nietzsche (1986).
b
942
achieved after the overcoming of nihilism, Vattimo presents Nietzsche as stopping, in some
sense, with accomplished nihilism, rather than positing an overcoming of nihilism beyond
it. Or, more precisely, he interprets Nietzsche’s overcoming of nihilism as not being really
a stage different from that of complete nihilism, which may lie beyond it. For Vattimo,
once the highest values have been devalued, we cannot posit new values that would in any
sense be more authentic than the ones we have deposed, and once we have lost belief in the
“true” world, this world cannot simply take its place with an equal sense of reality. This is
so because the old, transcendent values, and in particular the sense of ultimate reality we
had associated with the belief in a true world, worked as foundations, and hence we cannot
pose new categories of value without realizing that they are just as empty as those we have
deposed. Therefore Vattimo’s Nietzsche does not contemplate a simple overcoming of
nihilism as a revaluation of values resting on secure foundations; insofar as nihilism is the
radical lack of a foundation, complete nihilism cannot be overcome (in the sense of going
beyond it): the overcoming of nihilism consists in the overcoming of the desire to
overcome nihilism itself. While we may in a sense be stuck with a complete nihilism, this
nihilism is not one of despair and life-negation, but of joyous affirmation: the “philosophy
of morning.”a
The idea that, once we have lost belief in the “true” world, this world cannot simply
take its place with an equal sense of reality, seems to imply a derealization of our
experience of “this world.” On the basis of Nietzsche’s statement in the Genealogy of
Moralsb according to which there are no facts, but only interpretations, Vattimo tells us:c
Nihilism means in Nietzsche “de-valorization of the supreme values” and fabulation of
the world: there are no facts, only interpretations, and this is also an interpretation.
What I am calling “derealization of this world” must be explained in relation to the
stages of Communion and post-Communion, and their preamble. (1) According to the
gradual Mahayana, before we have access to the state that I am referring to by the term
“Communion” and that manifests for the first time in the Third Path / first level, we may
experience fear of voidness, which is overcome in the stage of the Second Path known as
“the tolerance of birthlessness.” This implies that already in the Second Path we experience
some degree of derealization of both ourselves and the world. (2) When the state of
Communion manifests, marking the transition to the Third Path / first level, our sense of
reality and our values completely dissolve; however, this state does not in any sense
involve fabulation of the world, for the experience of the world as fable is a form of
perception conditioned by an interpretation, but Communion is utterly beyond
interpretations and perception. (3) Except in the case of those who have reached final
Awakening, the state of Communion is always followed by a state of post-Communion in
which, as a natural after-effect of Communion, reality is perceived to some extent as
apparition-like, illusion-like or fabulous. Therefore, Vattimo’s term “fabulation of the
world” may seem to refer to this condition. However, the experience of the world as
apparition-like, illusion-like and fabulous can only result from the manifestation of the
state of Communion through the practices of a Path of Awakening, or from putting into
a
Vattimo (1988), p. 171.
Nietzsche (1999).
c
Vattimo (1995), p. 50.
b
943
practice traditional practices of the Path of Awakening such as that of the illusory body or
gyulüa, that of conscious dreaming or milamb, etc. (which may also be used to boost the
feeling of apparitionality that manifests spontaneously in post-Communion); since Vattimo
does not view what he refers to by the term we are considering as being the outcome of any
spiritual practice, it is clear that what he announced is no more than a figment of his own
wishful thinking.137
Since in its turn the state of Communion involves the absence of all values and
ideals, it may seem to coincide with the final result of the process of active destruction of
all values advocated by Nietzsche. However, this state, (1) being unproduced and beyond
the cause-effect relation, cannot result from a process of active destruction; (2) as stressed
above, it can only result from the practice of the teachings of a Path of Awakening, to
which Vattimo makes no reference whatsoever; (3) (being) a condition of perfection that
becomes widespread after the end of history and of the time cycle itself, it involves both
the overcoming of modernity and the idea of an end that Vattimo rejects, as well as the
recovery of the origin and secure foundation—which in this case is immanent, as in the
“modern” reading of Nietzsche—with regard to which, according to Vattimo, we should
give up all longing. It is true that insofar as the state of Communion involves the absence
of all values and ideals, traditional Western philosophy would view it as a nihilist
condition, just as it would view the fact that in that state no desire to create values or ideals
manifests, as the absence of any desire of overcoming nihilism— just as in Vattimo’s
postmodern reading of Nietzsche’s nihilism. However, as we have seen repeatedly, except
in the case of those who have attained irreversible Awakening, the state of Communion is
always followed by that of post-Communion,138 and in the latter, though we do not set out
to actively produce new values, in the long run moral, political, social, economic and
cultural values naturally manifest—which are initially implicit, but which, as degeneration
develops, become explicit. Furthermore, unlike the values of European religion and
metaphysics in the two first millennia CE, those that spontaneously manifest in the state of
post-Communion are not be based on religious or metaphysical fictions, but result from
turning the spontaneously wholesome patterns of behavior proper to the state of
Communion (which as such are part of what the Tao-Te-Ching called the te of the tao) into
moral imperatives to be observed, and from the need to maintain the natural order of the
cosmos—and, moreover, they correspond to the values implicit in the utopias that were
conceived in the modern age. This was the case with the values that arose in the postCommunion state in the past primordial age139 and which continued to be harbored by
many later hunters-fishers-gatherers and even some horticulturalists, and this will no doubt
be the case with the ones that will arise in the post-Communion state during the next
primordial era. Though originally the value enthroned as supreme and as conferring
meaning to human existence is the quest for Awakening, with the development of
degeneration this value is confined to the elite that practices the Paths of Awakening.140
Vattimo would be right with regard to the fact that the disappearance of all values
will not give rise to new values, only in the case of the few special individuals who, after
dedicating themselves exclusively to the practice of the Path of Awakening over a period of
many years, come to maintain the state of Communion uninterruptedly—and yet if these
individuals come to teach, just as Shakyamuni did, they will set up values for sentient
a
b
sgyu lus.
rmi lam.
944
beings to uphold. In relation to Vattimo’s calling the philosophy that does not call for the
overcoming of nihilism the “philosophy of morning,” it must be noted that, though the
succession of the Communion state that involves not values whatsoever and the postCommunion state in which values are implicit (etc.) is not a philosophy, it is characteristic
of “morning” in that it manifests in the earliest stages of all cosmic cycles;141 therefore,
though it would be improper to refer to this as a philosophy of morning, it may be properly
called the “condition of morning.”
In order to deter his readers from deriving from his unrelenting demolition of
religious and metaphysical fictions a senseless nihilism or an absolute relativism like the
ones that are the ultimate consequence of various trends of “postmodern” thought,
including Vattimo’s, the unequalled spiritual Master and philosopher Nagarjuna wrote in
the Rajaparikatharatnamala:a142
Upon seeing, thus, how effects arise
from causes, one affirms what appears
in the conventionalities of the world
and does not accept nihilism...
A follower of nonexistence suffers bad migrations,
but happy ones accrue to the followers of existence;
one who knows what is correct and true does not rely
on dualism and thus becomes liberated.
Despite the fact that conventional truth (samvriti satya) is a thoroughly confused
condition involving an obscuration to correctness, so long as we find ourselves within its
sphere we experience pleasure and pain, happiness and sadness, and so do those whom we
affect through our actions so long as they are within its sphere; furthermore, since we are
bound to experience the karmic effects of our actions, if these are evil we will suffer the
ensuing consequences, and if they are good we will enjoy their results. Though the
Buddhist ideal consists in going beyond the dualistic sphere of conventional truth into the
nondual sphere of absolute truth (paramartha satya), so long as we find ourselves within
the sphere of conventional truth we will be wise if we affirm what appears in the latter and,
rather than giving ourselves to wayward courses of behavior, we respect conventional
values, most carefully observing the law of cause and effect, and reject nihilism. It was for
these reasons that the great Master Padmasambhava of Oddiyana said, “Though my Vision
is ampler than the sky, my observation of the law of cause and effect is finer than sand.”
And it was also because of this that Atisha’s guru from Suvarnadwipa (i.e., from Sumatra)
known as Dharmakirti or Dharmapala told his excellent disciple: “So long as there is the
slightest grasping [in you], you must carefully observe the law of cause and effect.”
Postmodern nihilism as emphasized by Vattimo, and Derrida-influenced social
constructivism insofar as it posits the subject as the “meaning of meaning” without
emphasizing the need to dissolve the subject in the state of Communion, may justify and
foster instrumental attitudes. Hence the historical and philosophical link between
“postmodern” constructivism and fascism pointed out by Gene Edward Veithb might be no
coincidence, for both reject objective truth and yet do not provide us with the means for
a
b
Nagarjuna & Seventh Dalai Lama (1975).
Veith (1993).
945
going beyond subjective illusions; both assert that there is no essential human nature or
inherent human rights and yet do not contemplate an unveiling of the tao, the concealment
of which gave rise to these fictitious ideas and values; and both celebrate the substitution of
power for truth (though this is far from applying to the whole of social constructivism). At
any rate, it is a fact that forefathers of postmodern ideology, such as Martin Heidegger, and
actual postmodern ideologists such as Derrida’s close associate Paul de Mann, have been
deeply committed fascists.
According to Vattimo, modernity is characterized by the concept of progress, which
rests on a unilinear view of history: if we posit a goal towards which mankind is supposed
to progress—such as the European Enlightenment’s goal of emancipation—we view the
whole of history in relation to this goal; hence we have but one view of history, and this
view is constructed as a line along which the whole of society moves through time.
Furthermore, in modernity, being “modern” or “new” is itself a value, for it is seen as
overcoming and leaving behind the old, and thus moving further along the fine towards the
desired goal. According to Vattimo, modernity comes to an end when we are no longer
able to view history as unilinear, which in his view represents the end of history inherent in
the notion of postmodernity,a and which is achieved by increased awareness of a plurality
of views of history, partly due to the media explosion (which he interprets contrarily to
Adorno and Horkheimer,b who believed that it would lead to a fully homogenized society,
and in a sense to Baudrillard as well143)—but, we must add, in general as an effect of the
process of globalization (which was intended to homogenize the values of humankind on
the basis of those of capitalism and of the US in order to exacerbate domination and
exploitation, but which may have had the opposite result, as the projects of delusion are
subject to the law of inverted effect). Vattimo sees this “end of history” as something that
has already been reached in our time, which in his view is the postmodern age; however, all
human beings in the prevalent civilization have a sense of moving ahead in lineal history,
and so long as this is so it would be ridiculous to claim that history has come to an end: this
end will come to pass when the very sense of progressing in time be surpassed in the
timelessness of the state of Communion, while in the state of post-Communion the modern
myth of eternal progress is replaced by the archaic myth of the eternal return (neither
conceived à la pythagoricienne, nor à la Heines, nor à la Nietzsche, but understood in a
sense much nearer to the one Mircea Eliade gave the term)c144—so that history be
overcome in an ahistorical condition featuring the essential characteristics of the Primordial
Age.
The European Enlightenment replaced the myth of a perfect condition preceding
history with the new myth of progress qua the means for building the future paradise of
fully developed modernity. This new myth was then contested by the Romantics, who
idealized the origins, often placing myth above reason. Now that the myth of progress has
been unmasked, revealed as such and reduced to absurdity by the ecological crisis that had
not yet developed in the Romantic period, our task does not lie in contrasting myth and
reason, romantically glorifying the former and deriding the latter, for myth and reason are
successive stages in the development of delusion. A meta-ontological hermeneutics of the
a
Vattimo (1986), p. 22.
Adorno & Horkheimer (1997).
c
Eliade (1959). A view similar to the one I propose here was advanced in Armand (1998), which the author
asked me to present at a National Conference on Philosophy (Venezuela).
b
946
development of delusion and an archeology of the degenerative evolution of human
thought shows that in an initial stage the development of the analog thinking of primary
process gave rise to the distortion derived from the delusory valuation of what we call
“mythic thinking;” then, in an ulterior stage, the development of the digital thinking of
secondary process which we wrongly call “rational” gave rise to the distortion derived
from the delusory valuation of this kind of thinking, which pretends not to be mythic. It
was at this stage that a Pascal was able to say that le cœur a ses raisons que la raison ne
connaît pas (the heart has its reasons, which reason does not know), but it would be more
precise to say that the digital rationality of secondary process, upon becoming filter and
judge of all experience, is unable to understand or even perceive the analog rationality of
primary process—even though the computations of the former always take place over and
against the set of relations (structure) and the dynamics (function) established by the
computations of the latter. This is why the digital rationality of secondary process also
functions in terms of myths, such as that of eternal progress—though we are compelled to
become of bad faith with regard to this fact so that we ourselves and others may adhere to
these myths in the belief that, rather than myths, they are faithful descriptions of the
objective structure of reality as revealed by “reason”—and why the replacement of the
myth of eternal progress by that of eternal return would not represent a regression from
“reason” to “myth.” Furthermore, since progress on the Path of Awakening requires the
undermining of self-deceit, and since this progress also implies become ever more aware of
illusion as such while in the relational state, our myths—including metanarratives such as
the one expounded here—must be acknowledged to be such rather than being disguised as
“objective scientific descriptions.”
At any rate, romantic regress is impossible, for, as we have seen, insofar as primary
process contemplates no negatives, there is no way to put a lid on degenerative evolution
through intentional, conscious actions: the basic delusion that has developed throughout the
time cycle must achieve its reductio ad absurdum so that, if properly catalyzed by wisdom,
it may spontaneously break together with history and time itself. (As noted in the
Nyingmapa Buddhist teachings of Tibet and as seen in the preceding chapter, our sense of
temporality results from the vibratory activity in the organism at the root of delusory
valuation; this activity progressively increases its rate throughout the cosmic cycle, until at
the end of the cycle it becomes so fast that it collapses, together with our experience of
time and with the delusory valuation of thought.a) Only at that point will we enter true
postmodernity, which will result from surpassing all that developed in the process of
human evolution and history culminating in modernity.
Thus it is clear that true postmodernity would imply the end of history, not in the
Fukuyamian sense of “completion of the ideological evolution of humankind and
disappearance of alternatives to capitalist, economic liberalism (in which “liberalism” has
the sense of ‘free competition’145),” nor in any of the three senses contemplated by
Baudrillard,b but in the sense announced by Marcuse in a conference at the Free University
of Berlin in July 1967 in which he asserted the new possibilities of human society and its
environment to be no longer conceivable as a continuation of the old ones, for they cannot
be represented in the same historical continuum insofar as they presuppose a radical
rupture with this historical continuum. In fact, the end of history must involve the
a
b
Padmasambhava (1977), Introduction, section “The Experience of Time,” Italian: pp. 17-19.
Baudrillard (1992). In relation to this notion cf. also (1994b, 1995, 1996a, 1997a, 1997b, 1998a, 1998b).
947
surpassing of the human condition that was conceived in different terms by Nietzsche,
Aurobindo, Teilhard, and Foucault, among others,146 as well as the end of time announced
by the Nyingmapa Buddhist teachings of Tibet and a tradition associated with the
Kalachakra Tantra.a There can be no surpassing of what Foucault called the modern
episteme unless there is a surpassing of that of which this episteme is the last stage: the
human condition as constituted (in Mayda Hočevar’s image) once the mask of Apollo
covered the facelessness of Dionysus.147
I have expounded a metanarrative endowing human evolution and history with
meaning, which furthermore contradicts the modern, scientist views that (despite their
contempt for modernity) lie at the back of the minds of the advocates of postmodernity; I
have been referring to a condition of Communion and to a New Age characterized by
Meaning, plenitude, peace, harmony and equality in frugality, which might be viewed both
as an end and as return to the origin; I have claimed that averting the destruction of our
species and generating the positive features that would characterize the upcoming New Age
depend on Communion becoming widespread; I have asserted that so long as we are not in
the state of Communion we need values—and in general I have laid down a worldview
contradicting many of the shared bases of “postmo” thought, and having an overly mystical
and mythic character. A great deal of this would shock, not only advocates of
postmodernity who, like Vattimo, call for the definitive extinction of all values, but also
other left-wing postmodern theorists sharing my emphasis on egalitarianism and on the
need for a radical transformation of society, such as Jameson,b Harvey,c Laclau & Mouffe,d
perhaps to some extent Negri & Hardt,e etc. And the emphasis I place on mysticism has
also shocked professors of philosophy adhering to the mainstream European philosophical
tradition (which is paradoxical, for a chief modern Western philosopher like Hegel posited
as the paramount attainment of the human spirit the self-recognition of self-consciousness
in nature—which is a mystical experience, the only difference between it and the one I am
concerned with here being that the one Hegel posited is spurious and unauthentic, whereas
the one I am dealing with is true and authentic—and premodern Western philosophers such
as Nicholas of Cusa,148 Plotinus and the other Neo-Platonists, Augustine of Hippo,
Boethius, Pseudo-Dionysius, Anselm of Canterbury, members of the School of Chartres,
John of Fidanza [Bonaventure], Meister Eckhart and quite a few others posited as the
highest spiritual attainment what were overly explained to be mystical intuitions beyond
the principle of noncontradiction149).
Having criticized Vattimo’s views, I must note that I was very pleasantly surprised
because of his human quality when I met him in 2006 at the II International Forum of
Philosophy of Venezuela. In fact, rather than being an exalted, bellicose character full of
hubris and with a sense of superiority, as one perceives Nietzsche to be from reading his
works, he is one of the kindest and mildest characters I have ever met in the universe of
academic philosophy. Furthermore, rather than, with Nietzsche, attacking the “feminine
values of Christianity,” he declares himself to be a “Catocommunist”—an Italian term that
combines “Catholic” with “Communist.” Our meeting was for me quite pleasant indeed.
a
Padmasambhava (1977); the tradition related to the Kalachakra Tantra is the same one discussed in
Tarthang Tulku (1977a).
b
For an example of Jameson’s thought, cf. Jameson (1991).
c
For an example of Harvey’s thought, cf. Harvey (1990).
d
For an example of the thought of Laclau and Mouche, cf. Laclau & Mouffe (2001).
e
I have in mind Hardt & Negri (2001, 2004).
948
We have seen that many elements of pseudopostmodern thought may seem to be
similar to aspects of the true postmodern condition that will come after the end of the
cycle, for the condition in question will involve: the death of the subject (in the state of
Communion); the derealization of metaphysical and religious fictions, and not only of these
fictions, but also of the fiction constituted by our perception of “this world” of immediate
experience as self-existent and concrete, giving rise to something similar to Vattimo’s
“fabulation of the world” (in the state of post-Communion); and a surpassing of history,
time and so on. Likewise, we have seen that some have mistakenly perceived coincidences
between elements of pseudopostmodern thought and aspects of systems such as Buddhism,
which are among the principal means to achieve the transition to the authentically
postmodern age: the Derridian method of textual deconstruction has been mistakenly
identified with Nagarjuna’s method of reductio ad absurdum, Derrida’s différance has
been taken to be the same as shunyata, and so on. All of these apparent coincidences may
have been the result of “postmodern” thinkers having had an intuition of the needs of the
present historical moment without having gone beyond all that must be surpassed (or, at
least, being familiar with the wisdom-traditions that could help us go beyond all that must
be surpassed), and while being conditioned by the mood of the present decadence and
reductio ad absurdum of modernity—all of which would have caused them to wrongly
interpreted the needs in question in terms of their own beliefs and prejudices. As a result of
this, the thinking that goes under the label “postmodern” is a caricature, a grotesque
mockery, of the thinking our time requires.
Modern thinkers developed what Lyotard called metanarratives (comprehensive
world views endowing human existence and history with meaning), which as we have seen
were mythic yet were believed to be objective descriptions of all walks of human life and
evolution, as well as of all aspects of the universe and so on, achieved by unfailing reason.
Since all such systems were produced by individuals belonging to the culture that had
come to prevail over the rest of cultures, and which had given rise to modernity, which it
took to be the summit of a supposed process of perfecting, their claims to objectivity and
universality conjugated with the arrogance of the belief in the indisputably superiority of
the Western modernity they represented—which in itself did violence to the members of
other cultures, and, furthermore, was often used to justify the use of coarser kinds of
violence against members of those cultures. However, all such systems proved wrong when
their predictions failed to be fulfilled and occurrences contrary to what they had forecast
came to pass, by the same stroke refuting the belief in the superiority of modernity and of
the culture that gave rise to it, and the central metaphysical fictions of modern
philosophy—such as the human subject qua Cartesian cogito, which was shown to be
socially and linguistically decentered and fragmented rather than centered or unified—and
thus removing the foundations of the project of modernity. Therefore, many of those who
advocated “postmodernity” concluded that reason could not explain everything and should
acknowledge its own limits—which they wrongly took to mean that in our time we had to
resist the temptation of producing totalizing, universalizing, legitimating theories, and
instead set out to develop fragmentary microtheories or micropolitical studies favoring
multiplicity, plurality, fragmentation, and indeterminacy, and not pretending to have a
legitimating function.150 Likewise, they assumed that rather than producing
“metanarratives” involving claims to objective truth, they should show the utmost respect
toward “local narratives,” or stories about reality that “work” for particular communities,
but have no validity whatsoever beyond those communities.
949
However, the failure of the grand systems of modernity and the violence they did to
groups other than the one to which the creators of such systems pertained, rather than lying
in the fact that they were all-embracing explanations of reality, was due to the fact that they
were produced by inherently arrogant ego, fragmentary perception and instrumental reason,
and rather than being acknowledged to be myths, they were taken to be objective, universal
truths perfectly matching and exhausting their objects—all of which is a manifestation and
development of the basic human delusion that gave rise to the current ecological crisis and
that was reduced to absurdity by the crisis in question. If no interpretation can be true or
correspond to reality, for so-called reality is all about interpretation, and all interpretations
are narratives or stories, then what really matters is whether a given narrative or story
produces good or bad results—and thus we must determine what is it that makes narratives
or stories to produce good results. Some of the conditions for this to be so is that the
narrative or story be acknowledged to be a mere narrative or story—for then it is likely to
give rise to a playful attitude rather than producing the fixed ideas at the root of violence
toward others—and that they promote Communion and all that issues from it—such as
respect toward the natural order and other human beings, contentment, frugality, peace and
so on. Wayward metanarratives that are not acknowledged to be mere stories but are seen
either as objective truth or as the commands of God or the like, may allow a Bin Laden to
subdue ecologists and seekers of Awakening and force them to become fundamentalist
Wahabite Muslims, or provide a justification for the single superpower to invade
whichever peoples it may find fit, and to do away with environmental restraints and thus
accelerate the self-destruction of our species.
The above explains why the great systems (or metanarratives if we prefer) that
should give rise to the true Postmodern Age must result from the manifestation of the Selfqua-Path (or, ideally, of the Self-qua-Fruit), and as such arise from the global, allembracing awareness that puts an end to fragmentation, from the Communion that puts and
end to instrumentality, and from the surpassing of delusory valuation that shows that no
interpretation of reality (including the one provided by such systems) can perfectly
correspond to it or exhaust it. This means that they will be anti-systems in the sense of
being acknowledged to be myths leading beyond the belief that interpretations, either
systemic or fragmentary, may correspond precisely to what they interpret, and thus work as
nails that are functional in extracting previous nails but which are not left in situ.151
Furthermore, such antisystems must make it clear that it is imperative to surpass all that
developed throughout the cosmic cycle and that achieved its reductio ad absurdum in the
current crisis; that it is necessary to make the state of Communion become ubiquitous; that
it is indispensable for us to get rid of all the institutions, modes of rationality and so on that
developed throughout the cycle until our time; that it is crucial to explain the way in which
delusion works and hence what is the necessary dynamics of the Path that to be tread in
order to uproot it; and so on.152 Such views may be seen as postmodern insofar as it they
would be re-editions of the most ancient views of history known to humankind; as truly
postmodern insofar as they can give rise to the true postmodernity of the upcoming New
Age, and as anti-modern insofar as they see the evolutionary and historical process as being
characterized by degeneration rather than progress. (And if such views were nonetheless to
be considered modern, then also Nietzsche’s view of the surpassing of humankind in the
advent of the Übermensch should be considered modern, for it implies the transition to an
ideal condition at the end of human evolution, and is also much older than modernity—
though not as old as the degenerative view that I develop in this book.153) On the contrary,
950
fragmentary treatises that fail to do what the systems entertained here are supposed to do,
and which, rather than leading us beyond fashions and back into the customs and rituals of
“eternal return,” eulogize the adoption of new pseudopostmodern, decadent, nihilist
fashions, can only lead us further on the path toward destruction.
951
BIBLIOGRAPHYa
(INCLUDES WORKS QUOTED IN CITATIONS)
Abramson, J. (in press). A reply to Capriles. San Francisco, CA: The International Journal
of Transpersonal Studies (probably to appear in Vol. 29, 1 or 2).
Adorno, Theodor W. & Horkheimer, Max (1997). Dialectic of Enlightenment (English
trans. John Cumming). London and New York, NY: Verso.
Alam, Shamsul (1980). Abdul Quader Ghilani. Dacca (Bangladesh): Islamic Foundation.
Althusser, Louis (1981). La filosofía como arma de la revolución (original Spanish edition
1968; sixth Ed. corrected and expanded 1974; 11th Ed. 1981). Mexico: Cuadernos de
Pasado y Presente, 4.
Ames, Roger T. (1983). Is Political Taoism Anarchism? Journal of Chinese Philosophy, 10,
pp. 27-47.
Anagarika Govinda, Lama (1928). Introductory Foreword. In Padmasambhava according to
Karma Lingpa (1928). Tibetan Book of the Dead. (Kazi-Dawa Samdup, trans.; W. E.
Evans-Wentz, Ed.) London: Oxford University Press.
Anderson, Walter Truett (1986). A Critical Response. In Anderson, Walter Truett; Ernest
Callenbach; Fritjof Capra; Charlene Spretnak; Eds. (1986). Critical Questions About
New Paradigm Thinking, Section Is this Notion of a Paradigm and of Paradigm Shifts
Appropriate to Describe Social Change? Washington, DC: ReVISION magazine, Vol.
9, No. 1, Summer/Fall 1986.
Annas, Julia (1981). An Introduction to Plato’s Republic. Oxford, UK: Clarendon Press,
1981.
Anonymous (2004-2006). Religion Facts: Just the Facts on the World’s Religions.
http://www.religionfacts.com/a-z-religion-index/bon.htm
Aristotle (1983). Aristotle’s Poetics. New York, NY: W W Norton & Co Inc.
Armand, Jorge (1998). Más allá de la modernidad: Del mito del eterno progreso al mito
del eterno retorno. Mérida, Venezuela: Ediciones Actual, Colección Va de Ensayo,
DIGECEX, ULA.
Assagioli, Roberto (1965). Psychosynthesis. New York, NY: Viking.
Assoun, Paul-Laurent (1982a). Introducción a la epistemología freudiana. México: Siglo
XXI Editores.
Assoun, Paul-Laurent (1982b). Freud. La filosofía y los filósofos. Barcelona, Spain: Paidós.
Ayer, Alfred Julius (1981). Lenguaje, verdad y lógica (Language, Truth and Logic:
1936/1946/1976). Barcelona: Martínez Roca.
Aurobindo, Shri (1955). La vie divine (Jean Herbert, director of the translation). Paris:
Albin Michel.
Bachelard, Gaston (1957). La formation de l’esprit scientifique: Contribution à une
Psychanalyse de la connaissance objective (1st Ed., 1938). Paris: Librairie
Philosophique J. Vrin (Collection Bibliothèque des Textes Philosophiques, dirigée par
Henri Gouhier).
a
Whenever in this book 1 refer to another author’s notion without reproducing an excerpt from the work in
which she or he developed that notion, t refer to the English edition of the work even if 1 don’t have access to
it. When 1 reproduce an excerpt from a work, if 1 do not have the English edition I provide the data of the
foreign language edition from which 1 translated (or retranslated) the excerpt into English.
953
Bachoffen, Johann Jakob (1967). Myth, Religion and Mother Right: Selected Writings of J.
J. Bachoffen (this English trans., Ralph Manheim). Princeton, NJ: Princeton University
Press.
Bacon, Francis (1603; this ed. 1966). The masculine birth of time. In Farrington, Benjamin
(1964; this ed. 1966). The philosophy of Francis Bacon: An essay on its development
from 1603 to 1609, with new translations of fundamental texts, 61–72. Chicago, IL,
U.S.A.: Phoenix Books / The University of Chicago Press (First Phoenix Edition).
Bacon, Francis (G.W.Kitchin, Ed.; Arthur Johnson, Intro.) (1981). The Advancement of
Learning. London: J.M. Dent and Sons Ltd. (Original Ed. 1605; original form of this
Ed., 1913: Everymans ed.)
Bairoch, Paul (1995). Economics and World History: Myths and Paradoxes (1st Ed., 1993).
Chicago, Il: University of Chicago Press.
Barnes, Mary & Berke, Joseph (1972). Mary Barnes: Two Accounts of a Journey Through
Madness. New York, NY: Harcourt Brace Jovanovich.
Baroetto, Giuseppe (1990). L’insegnamento esoterico di Padmasambhava: La collana delle
visioni. Arcidosso (GR), Italy: Shang Shung Edizioni.
Barrett, William (Ed.) (1956). Zen Buddhism: Selected Writings of D. T. Suzuki. Garden
City, NY: Doubleday Anchor Books.
Basaglia, Franco (1971). La maggioranza deviante. Turin: Einaudi.
Basaglia, Franco (1982). Scritti II. 1968-1980. Turin: o. Vlg.
Basseches, Michael (1980). Dialectical Schemata: A Framework for the Empirical Study of
the Development of Dialectical Thinking. Human Development 23:400-421.
Basseches, Michael (1984a). Dialectical Thinking and Adult Development. Norwood, N.J.:
Ablex.
Basseches, Michael (1984b). Dialectical Thinking as a Metasystematic Form of Cognitive
Organization. In Commons, M. L., Richards, F. A. & Armon, C. (1984). Beyond
Formal Operations: Late Adolescent and Adult Cognitive Development. New York,
N.Y.: Praeger.
Basseches, Michael (1989). Dialectical Thinking as an Organized Whole: Comments on
Irwin and Kramer. In Commons, M. L., Sinnot, J. D., Richards, F. A. & Armon, C.
(1989). Adult Development, vol. I: Comparisons and Applications of Developmental
Models. New York, N.Y.: Praeger.
Batchelor, Steven (1983). Alone With Others: An Existential Approach to Buddhism. New
York, NY: Grove Weidenfeld.
Bateson, Gregory (Ed. and Introduction) (1961). Perceval’s Narrative: A Patient’s Account
of his Psychosis, 1830-1832 (by John Perceval). Stanford, CA: Stanford University
Press.
Bateson, Gregory (1968). Conscious Purpose Versus Nature. In Cooper, David (Ed.). The
Dialectics of Liberation, 34-49. Harmondsworth, Middlesex, England, UK: Pelican
Books.
Bateson, Gregory (1972). Steps to an Ecology of Mind. New York, NY: Ballantine Books.
Bateson, Gregory (1990). Espíritu y naturaleza. Buenos Aires: Amorrortu editores S. A.
(1st Spanish Ed. 1982). (1979. Mind and Nature: A Necessary Unity. New York [NY]:
Dutton).
Baudrillard, Jean (1992). L’lllusion de la fin: ou La grève des événements. Paris: Galilée.
(English Ed. 1994a, Chris Turner, trans. The Illusion of the End. Cambridge, UK: Polity
Press / Blackwell.)
954
Baudrillard, Jean (English 1994b). Simulacra and Simulation. Ann Arbor, MI: University
of Michigan Press.
Baudrillard, Jean (1995). The Gulf War Did Not Take Place (English trans. by Paul Patton)
Bloomington and Indianapolis, IN: Indiana University Press.
Baudrillard, Jean (1996a). Cool Memories II: 1987-1990. Durham, NC: Duke University
Press.
Baudrillard, Jean (1996b). The Perfect Crime. London and New York, NY: Verso.
Baudrillard, Jean (1997a). Fragments: Cool Memories III 1991-95. London and New York,
NY: Verso.
Baudrillard, Jean (1997b). The End of the Millennium or the Countdown. Oxford, UK:
Routledge: Economy and Society 26(4). November 1997, 447-455. Available in Internet
at the URL: www.uta.edu/english/apt/collab/texts/millennium.html; cf. also the URL
http://www.egs.edu/faculty/baudrillard/baudrillard-the-end-of-the-millennium-or-thecountdown.html
Baudrillard, Jean (1998a). Paroxysm: Interviews with Philippe Petit. London and New
York, NY: Verso.
Baudrillard, Jean (1998b). In the Shadow of the Millennium (Or the Suspense of the Year
2000). Internet: http://www.egs.edu/faculty/baudrillard/baudrillard-in-the-shadow-ofthe-millennium.html
Bausani, Alessandro (1988), El islam en su cultura. México, Fondo de Cultura Económica
(Breviarios). (Original Italian Ed. 1980.)
Beck, Don Edward & Cowan, Christopher C. (1995). Spiral Dynamics: Mastering Values,
Leadership and Change. Oxford, UK / Malden MA: Blackwell Publishers.
Bénatouil, Thomas (2001). La trousse à pharmacie sceptique. (The Skeptical
Pharmaceutical Case.) Paris: Magazine Littéraire, 394, January 2001, 32-34.
Bender, Frederic L. (1983). Taoism and Western Anarchism. Journal of Chinese
Philosophy, 10, pp. 5-26.
Benson, Herbert, J. W. Lehmann, M. S. Malhotra, R. F. Goldman, J. Hopkins, and M. D.
Epstein (1982). Body Temperature Changes during the Practice of gTum-mo (Heat)
Yoga. Houndmills, Basingstoke, Hampshire, England: Nature, No. 295: 234-6.
Bentov, Itzak (1977). Stalking the Wild Pendulum. New York, NY: Dutton.
Bentov, I. y M Bentov (1982). A Cosmic Book: On the Mechanics of Creation. New York,
NY: Dutton.
Berman, Morris (1984). Re-Enchantment of the World. New York, NY: Bantam.
Biès, Jean (1985). Resurgencias del espíritu en un tiempo de destrucción. Caracas:
Editorial Mandorla.
Binswanger, Ludwig (1963). (Trans. J. Needleman) Being-in-the-World: Selected papers of
Ludwig Binswanger. New York, NY: Basic Books.
Binswanger, Ludwig (1987). Mélancolie et manie (trad. J.-M. Azorin, Y. Totoyan, A.
Tatossian). Paris: Presses Universitaires de France, collection ”Psychiatrie ouverte.”
Blake, William (1975). The Marriage of Heaven and Hell. Paris: Oxford University Press
in association with The Trianon Press.
Blofeld, John (1962). The Zen Teaching of Hui-Hai on Sudden Illumination. London:
Rider.
Blofeld, John (1968). I Ching. New York, NY: E. P. Dutton & Co., Inc., 1968.
Bloch, Henrriette; Postel, Jacques; & Others (1996). Gran Diccionario de Psicología.
Madrid: Ediciones del Prado.
955
Bloss, Peter (1962). On Adolescence: A Psychoanalytic Interpretation. New York, NY: The
Free Press.
Bloss, Peter (1972). The Function of the Ego Ideal in Adolescence. New Haven, CT: The
Psychoanalytic Study of the Child 27:93-97.
Bloss, Peter (1974). The Genealogy of the Ego Ideal. In Kielholz, P., Ed (1974) The
Adolescent Passage: Developmental Issues. Baltimore, MA: Williams & Wilkins.
Bocchi, Gianluca & Ceruti, Mauro (1993). Origini di storie. Milan, Italy: Giangiacomo
Feltrinelli Editore.
Boehm, Christopher (1999). Hierarchy in the Forest. Cambridge, MA: Harvard University
Press.
Bohm, D., & Hiley, B. (1975). On the Intuitive Understanding of Nonlocality as Implied by
Quantum Theory. In Foundations of Physics, 5, 1975, 93-109.
Bohm, David (1976), Fragmentation and Wholeness. Jerusalem, Israel: The Van Leer
Jerusalem Foundation.
Bohm, David (1980). Wholeness and the Implicate Order. London: Routledge.
Bohm, David (1982). Interviews. In Wilber, Ken (Ed.) (1982). The Holographic Paradigm
and Other Paradoxes. Boulder, CO and London: Shambhala.
Boyers, Robert & Orrill, Robert (Eds.) (1971). R. D. Laing and Anti-Psychiatry (includes
papers by Peter Sedgwick, Leslie Farber, Joseph Berke, Edgar Friedenberg, Mary
Barnes and others). Harmondsworth, Middlesex, UK: Penguin.
Bracho, Frank (2005). Sesquicentenario de Seattle, el gran profeta indígena (150 years of
Seattle, the Great Indigenous Prophet). Caracas: Question (monthly magazine), January
2005, 28-29.
Bracht Branham, R. & Goulet-Cazé, M. O. (1996). The Cynics: The Cynic Movement in
Antiquity and its Legacy. Berkeley and Los Angeles, CA: University of California Press
by arrangement with The Regents of the University of California.
Braga, Capone (1931). L ‘Eraclitismo di Enesidemo. Milan, Italy: Rivista di Filosofía
1931, 33-47.
Brask, Per K. (undated). Jung’s Shadow: Two Troubling Essays by Jung. http://www.metareligion.com/Psychiatry/Analvtícal_psychology/iwlgs shadow.htm
Bray, Jim (1998). Rethinking Grof's Basic Perinatal Matrices. Internet; freely accessible at
the URL http://as220.org/jb/trans/bpm.html
Bréhier, Emile (1961). La philosophie de Plotin. Paris: Vrin.
Bréhier, Emile (1988). Historia de la filosofía. (2 vol.) (1931/1938. Histoire de la
philosophie.) Madrid: Tecnos.
Briggs, Jean L. (1970). Never in Anger. Cambridge, MA: Harvard University Press.
Brillouin, Léon (1959). La science et la théorie de 1’information. Paris: Masson Léon.
(English 1964. Scientific Uncertainty and Information. New York, NY: Academic
Press.)
Brown, Lester (1990). Picturing a Sustainable Society. Berkeley, CA: The Elmwood
Newsletter, Vol. 6, N° 1, Spring Equinox.
Brown, N. O. (1968). Life against death: The psychoanalytical meaning of history.
London: Sphere. (Original Ed. 1959: Middletown, CT: Wesleyan University Press.)
Brown, T. S. (1949). Onesicritus: A Study in Hellenistic Historiography. Berkeley and Los
Angeles, CA: University of California Press.
Bryan, William L. (1996). Montana’s Indians: Yesterday and Today. Helena, MT:
American & World Geographic Publishing.
956
Buchner, Hartmut (Ed.) (1989). Japan und Heidegger. Sigmaringen, Germany: Thorbecke
Verlag.
Buckley, Walter (1993) La sociología y la teoría moderna de los sistemas (Aníbal Leal,
trans.). Buenos Aires: Amorrortu. (Original Ed. [1967]. Sociology and Modern Systems
Theory. Englewood Cliffs, NJ: Prentice-Hall. Original Spanish Ed. 1970.)
Buddha Shakyamuni (ed. P. Steinthal) (1885, 1982). Udaana. London: The Pali Text
Society. (This is the third text of the Khuddaka-nikaaya of the Sutta-pi.taka.)
Buddha Shakyamuni (trans. from the Chinese, K. C. Oon) (undated). The Vajrasamadhi
Sutra (The Diamond-Absorption Sutra [or Sutra of Adamantine Absorption]). Internet:
http://www.zhaxizhuoma.net/DHARMA/Tripitaka/VajrasamadhiSutra.htm
Budick, Sanford (1989). Languages of the Unsayable: The Play of Negativity in Literature
and Literary Theory. New York, NY: Columbia University Press.
Burnet, John (1964). Early Greek Philosophy (original Ed. 1892). Cleveland, OH: The
World Publishing Company.
Butler, Alan (2000). The Templar Continuum. Toronto, Ontario, Canada: Templar Books.
Calinescu, Matei (1987). Five Faces of Modernity: Modernity, Avant-Garde, Decadence,
Kitsch, Postmodernism. Durham, NC: Duke University Press.
Cappelletti, Angel J. (1969). La filosofía de Heráclito de Éfeso (The Philosophy of
Heraclitus of Ephesus). Caracas: Monte Avila.
Cappelletti, Angel J. (1972a). Los fragmentos de Heráclito (Heraclitus’ Fragments).
Caracas: Editorial Tiempo Nuevo.
Cappelletti, Angel J. (1972b). Inicios de la filosofía griega. Caracas: Editorial Magisterio.
Cappelletti, Angel J. (1978). El pensamiento de Kropotkin. Ciencia, ética y anarquía.
Madrid: Zero, S. A.
Cappelletti, Angel J. (2d. Ed. 2000). La estética griega. Mérida, Venezuela: FAHE. (1st.
Ed. 1991. Mérida: Consejo de Publicaciondes de la ULA.)
Capra, Fritjof (1983). The Tao of Physics (1st Ed, 1975). Boulder, CO: Shambhala.
Capra, Fritjof (1982). The Turning Point. New York, NY: Bantam New Age Books.
Capra, Fritjof (1986). The Santiago Theory of Life and Cognition. Washington, DC: Re
VISION Journal, 9(1), summer / fall 1986.
Capra, Fritjof (1988). Uncommon Wisdom. New York, NY: Simon & Schuster.
Capra, Fritjof (1996). The Web of Life. New York, NY: Anchor.
Capriles, Elías (1977). The Direct Path. Providing a Background for Approaching the
Practice of rDzogs-chen. Kathmandu: Mudra Publishing.
Capriles, Elías (1986). Qué somos y adónde vamos (What Are We and Where Are We
Going). Caracas: Unidad de Extensión de la Facultad de Humanidades y Educación de
la Universidad Central de Venezuela.
Capriles, Elías (1988), Sabiduría, equidad y paz / Wisdom, Equity and Peace: paper read in
the International Encounter for Peace, Disarmament and Life (Mérida, Venezuela).
Longer abstracts in Italian and English: Saggezza, uguaglianza e pace / Wisdom,
Equality and Peace. Arcidosso (GR), Italia: Shang Shung Edizioni, Rivista Merigar /
Merigar Review, No. 1, October 1988, pp. 53-58. Shorter abstracts in Spanish and
English: Sabiduría, equidad y paz / Wisdom, Equity and Peace. Mérida, Venezuela:
Dirección de Cultura de la Universidad de Los Andes, Encuentro International por la
Paz, el Desarme y la Vida, Resúmenes de las ponencias I, pp. 144-145.
957
Capriles, Elías (1990a). The Source of Danger is Fear. Paradoxes of the Realm of Delusion
and Instructions for the Practice of the Dzogchen Upadesha. Mérida, Venezuela:
Editorial Reflejos.
Capriles, Elías (1990b). Las aventuras del fabuloso hombre-máquina. Contra Habermas y
la ratio technica (The Adventures of the Fabulous Machine-Man: Against Habermas
and Ratio Technica). Mérida, Venezuela: Revista Actual de la Universidad de Los
Andes, números 16-17.
Capriles, Elías (1990c). Ciencia, chamanismo y metachamanismo (Science, Shamanism
and Metashamanism). Mérida, Venezuela: Boletín Antropológico 19(6), Museo
Arqueológico, Universidad de Los Andes.
Capriles, Elías & Hočevar, Mayda (1991). Enfoques sistémicos en sociología. Discusión de
algunas de las tesis de Capra, Luhmann y Habermas (Systemic Approaches in
sociology. Discussion of Some Theses by Capra, Luhmann and Habermas). San
Sebastian, Euskadi, Spain: Anuario Vasco de Sociología del Derecho (Eskubidearen
Soziologiako Euskal Urtekaria), 3, 151-86.
Capriles, Elías & Hočevar, Mayda (1992). Enfoques sistémicos en sociología. Discusión de
algunas de las tesis de Capra, Luhmann y Habermas (Systemic Approaches in
Sociology. Discussion of Some Theses by Capra, Luhmann and Habermas). (Revised,
corrected and expanded version of Capriles, Elías & Hočevar, Mayda, 1991.) Mérida,
Venezuela: Trasiego, Faculty of Humanities and Education of the University of The
Andes, 4/5, 38-57.
Capriles, Elías (1992). La inversión hegeliana de la historia (The Hegelian Inversion of
History). Mérida, Venezuela: Filosofía, Journal of the Master Degree on Philosophy of
the University of The Andes, 4, 87-106.
Capriles, Elías (1993). El valor y los valores como resultado de la caída: parte I (Value and
values as a consequence of the Fall: Part I). Mérida, Venezuela: Filosofía, Journal of
the Master Degree on Philosophy of the University of The Andes, 5, 55-86.
Capriles, Elías (1994a). Individuo, sociedad, ecosistema: Ensayos sobre filosofía, política y
mística (Individual, Society, Ecosystem: Essays on Philosophy, Politics and Mysticism).
Mérida, Venezuela: Consejo de Publicaciones de la Universidad de Los Andes.
Capriles, Elías (1994b). El valor y los valores como resultado de la caída: parte II (Value
and Values as a Consequence of the Fall: Part II). Mérida, Venezuela: Filosofía,
Journal of the Master Degree on Philosophy of the University of The Andes, No. 6,
117-142.
Capriles, Elías (1997a). Pasos hacia una fenomenología metaexistencial de los estados de
conciencia (Steps to a Metaexistential Phenomenology of Mental States). Maracaibo,
Venezuela, Utopía y praxis latinoamericana, 2(2) Jan.-Jun. 1997.
Capriles, Elías (1997b). Steps to a Comparative Evolutionary Aesthetics (China, India,
Tibet and Europe). In Marchianò, Grazia (Ed.), East and West in Aesthetics. Pisa /
Rome: Istituti Editoriali e Poligrafici Internazionali.
Capriles, Elías (1997c). Mohandas K. Gandhi, precursor de nuevos paradigmas sociales,
económicos y políticos (Mohandas K. Gandhi, Precursor of New Social, Economic and
Political Paradigms). In Cejas, Ismael, Ed., Gandhi, 81-115. Mérida, Venezuela:
Consejo de Publicaciones / CDCHT, Universidad de Los Andes.
Capriles, Elías (1998a). India: ¿Qué tradición? ¿Continuidad en cuál cambio? In Cejas,
Ismael, Ed., India: Tradición y modernidad ¿continuidad en el cambio? 33-69. Mérida,
Venezuela: Ediciones GIEAA y CDCHT de la Universidad de Los Andes.
958
Capriles, Elías (1998b). En torno a los estudios asiáticos. In Capriles, Elías & Hernán
Lucena, Eds., África y Asia: Diálogos en Venezuela, 139-170. Mérida, Venezuela:
Ediciones GIEAA / CDCHT, Universidad de Los Andes.
Capriles, Elías (1999a). Más allá de la mente. Pasos hacia una psicología
metatranspersonal. Mérida, Venezuela: Trasiego, Faculty of Humanities and Education
of the University of The Andes, 9.
Capriles, Elías (1999b). El anarquismo político y gnoseológico de Antístenes en el hilo de
Ariadna de una antigua tradición soteriológica (The Political and Epistemological
Anarchism of Antisthenes in the Thread of an Ancient Soteriological Tradition).
Mérida Venezuela: Dikaiosyne (Journal of Grupo Logos—Filosofía, Derecho y
Sociedad, Faculty of Legal and Political Sciences, University of The Andes), 2, 67-134.
Capriles, Elías (1999c). Aportes de la India hacia la solución de la crisis global. In Capriles,
Elías & Hernán Lucena, Eds., India: De su contribución universal a los pensadores de
la independencia, 45-90. Mérida, Venezuela: Ediciones GIEAA / CDCHT, Universidad
de Los Andes.
Capriles, Elías (unpublished). Estética del eterno retorno y arte visionario. Paper read at the
IIId International Symposium on Aesthetics, held in Mérida, Venezuela, in November
1999.
Capriles, Elías (undated). Pasos hacia una hermenéutica metaontológica (Steps to a
metaontological hermeneutics). Caracas: Proceedings of the 5th National Conference
on Philosophy, held in November 1999 at the Central University of Venezuela.
Internet:
http://150.185.88.116/humanitas2/temas/Filosof%C3%ADa/Eventos/Pro/ONTOLOGIC
O.htm
Capriles, Elías (2000a). Budismo y dzogchén (Buddhism and Dzogchen): Vitoria, Euskadi,
Spain: Ediciones La Llave.
Capriles, Elías (2000b). Estética primordial y arte visionario: Un enfoque cíclico-evolutivo
comparado (Primordial Aesthetics and Visionary Art: A Comparative CyclicEvolutionary Approach). Mérida, Venezuela: Publicaciones del Grupo de Investigación
en Estudios de Asia y Africa (GIEAA) / CDCHT-ULA.
Capriles, Elías (2000c). Beyond Mind: Steps to a Metatranspersonal Psychology. Honolulu,
HI: The International Journal of Transpersonal Studies, Vol. 19, 163-184.
Capriles, Elías (2000d). Heráclito y el Oriente. Mérida, Venezuela: Filosofía, 11.
Capriles, Elías (2000e). La crisis ecológica: ¿una respuesta educativa? (Ecological Crisis:
An Educations Response?) (Paper read at the 3d Iberoamerican Conference on
Environmental Education, held in Caracas, Venezuela). Caracas: Serie Educación,
Participación y Ambiente, Dirección General de Educación Ambiental y Participación
Comunitaria / Ministerio del Ambiente y de los Recursos Naturales, 10(4), Agosto de
2000.
Capriles, Elías (2001). The Meaning of Self-Liberation and Loops from The source of
danger is fear. Honolulu, HI: The International Journal of Transpersonal Studies, 20.
Capriles, Elías (2003). Buddhism and Dzogchen: Volume One: Buddhism: A Dzogchen
Outlook. Mérida, Venezuela: Website for professors of the University of The Andes,
http://www.webdelprofesor.ula.ve/humanidades/elicap/ and Moscow (possibly earlier
version): http://www.eliascapriles.dzogchen.ru
Capriles, Elías (2004). Clear Discrimination of Views Pointing at the Definitive Meaning:
The Four Philosophical Schools of the Sutrayana Traditionally Taught in Tibet (With
959
Reference to the Dzogchen Teachings). Mérida, Venezuela: Website for professors of
the University of The Andes, http://www.webdelprofesor.ula.ve/humanidades/elicap/
and Moscow (possibly earlier version): http://www.eliascapriles.dzogchen.ru
Capriles, Elías (2005). Editor’s Introduction to: Gendün Chöphel (2005). Clarifying the
Core of Madhyamaka: Ornament of the Thought of Nagarjuna (English trans., Pema
Wangjié & Mulligan, Jean; Elías Capriles Ed. and Introduction). Arcidosso, GR, Italy:
Shang Shung Edizioni.
Capriles, Elías (2006a). Beyond Mind II: Further Steps to a Metatranspersonal Philosophy
and Psychology. San Francisco, CA: The International Journal of Transpersonal
Studies, vol. 24. (Saybrook Graduate School and Research Center.)
Capriles, Elías (2006b). El proyecto nuclear de Venezuela, el “derecho” de Irán a la energía
nuclear, y la contraposición de dos tipos de religiosidad (Venezuela’s Nuclear Project,
Iran’s “Right” to Nuclear Energy, and the Contrast Between Two Types of Religiosity).
Mérida, Venezuela: Humania del Sur, 1:1, pp. 99-126.
Capriles, E., (2007a), “From Primal to Postmodern Ecommunism.” In Kumar, Corinne
(Ed.) (2007) Asking, we Walk (2 vols.) Bangalore, India: Streelekha Publications.
Capriles, Elías (2007b). Hacia el ecomunismo: Una respuesta mítica a algunos problemas
del marxismo. (Toward Ecommunism: A Mythic Response to Some of the Problems of
Marxism.) San Salvador: Realidad: Revista de Ciencias Sociales y Humanidades 112,
abril-junio 2007 (Universidad Centroamericana “José Simeón Cañas”).
Capriles, Elías (2007c). ¿El ecosocialismo como vía hacia el ecomunismo? Una propuesta
pragmática (Ecosocialism as the Way to Ecommunism? A Pragmatic Proposal).
Mérida, Venezuela: Humania del Sur, 2:1, pp. 85-125.
Capriles, E. (2009a). Una tesis sobre el origen y los desarrollos del daoísmo a la luz de
antiguos textos del Bön tibetano [A thesis about the origin and developments of Daoism
in the light of ancient texts of Tibetan Bön]. Mérida, Venezuela: Humania del Sur, 4(7),
pp. 113-136. Available at http://www.saber.ula.ve/handle/123456789/30224
Capriles, E. (2009b). Beyond Mind III: Further Steps to a Metatranspersonal Philosophy
and Psychology: Continuation of the Discussion of the Three Best Known Transpersonal
Paradigms, with the Focus on Washburn’s and Grof’s. San Francisco, CA: The
International Journal of Transpersonal Studies, 28:2, 2009 (special issue devoted in its
entirety to this paper). Internet http://transpersonalstudies.org/index.cfm?page_id=10174
(also in http://www.transpersonalstudies.org/current_issue.html Aug. 2010 through Feb.
2011; thereon http://www.transpersonalstudies.org/ImagesRepository/ijts/Downloads/)
Capriles, E. (2010a). Gandhi, Ambedkar y el nacionalismo religioso casteísta: Paradigmas
de la India ante la mundialización y el belicismo contemporáneos (Gandhi, Ambedkar,
and casteist religious nationalism: India’s paradigms in face of globalization). In Lucena,
H. (Ed.). Bolívar y Gandhi: paradigmas liberadores (Bolivar and Gandhi: Liberating
paradigms). Merida, Venezuela: Consejo de Estudios de Postgrado, Consejo de
Desarrollo Científico, Humanístico y Tecnológico (CDCHT), Centro de Estudios de
África, Asia y Diásporas Latinoamericanas y Caribeñas “José Manuel Briceño
Monzillo” and Cátedra Libre India Siglo XXI, Universidad de Los Andes. Also in the
Internet: http://www.human.ula.ve/ceaa/documentos/libro_bolivar_ghandi.pdf
Capriles, E. (2010b). Nondual awareness, dualistic consciousness and the path to absolute
sanity. Wittnau, Germany / Madrid, Spain: Journal of Transpersonal Research, Vol. 2,
pp.
97-107.
Internet:
http://www.transpersonaljournal.com/pdf/vol2sep10/Capriles%20Elias.pdf
960
Capriles, E. (2010c). Preliminary reflections on Wilber V. Amsterdam, Holland: Integral
World Website. Internet: http://www.integralworld.net/capriles4.html
Capriles, Elías (work in progress 1). Estética primordial y arte visionario (Primordial
Aesthetics and Visionary Art). (2d Edition, revised, corrected and expanded, of
Capriles, Elías, 2000b.)
Capriles, Elías (work in progress 2). Individuo, sociedad, ecosistema. (Individual, Society,
Ecosystem.) (2d Edition, revised, corrected and expanded, of Capriles, Elías, 1994a.)
Capriles, Elias (work in progress 3). Greek Philosophy and the East.
Capriles, Elías (work in progress 4). Buddhism and Dzogchen: Volume Two: Dzogchen: A
Buddhist Outlook.
Capriles, Elías (work in progress 5). Buddhism and Dzogchen: Volume Three:
Complementary Ideas and Practices.
Capriles, Elías (planed work to be undertaken at some point). Psychology of Samsara and
Metapsychology of Nirvana.
Carré, Patrick (1999). Nostalgie de la vacuité (Nostalgia of Voidness). Paris: Pauvert.
(Revised and amended version of [1991] D’Elis à Taxila, eloge de la vacuité [From
Elis to Taxila: In Praise of Voidness]. Paris: Éd. Criterion.)
Carré, Patrick (2001). Pyrrhon: ‘Abolir tous les étants’ (Pyrrho: ‘Abolishing all entities’).
Paris: Magazine Littéraire, No. 394, January 2001, 25-27.
Castañeda, Carlos (1971). A Separate Reality. Further Conversations with Don Juan. New
York, NY: Pocket Books.
Castenedo Secadas, Celedonio (1988; 3d. revised Ed. 1997). Terapia Gestalt: Enfoque
centrado en el aquí y el ahora. Barcelona, Spain: Herder.
Castenedo Secadas, Celedonio (1990; 2d. Ed. 1997). Grupos de encuentro en terapia
Gestalt: De la “silla vacía” and círculo gestáltico. Barcelona, Spain: Herder.
Cauvin, Jacques (1987). L’apparition des premières divinités (The Appearance of the First
Divinities). Paris: La Recherche, 195, December 1987.
Cauvin, Jacques (1998). Naissance des divinités, naissance de l'agriculture. París:
Flammarion. English translation by Trevor Watkins (2000): The Birth of Gods and the
Origins of Agriculture. Cambridge University Press.
Chandrakirti (1974). Analysis of Going and Coming: The Second Chapter of Chandrakirti’s
Clear Words, a Commentary on Nagarjuna’s Treatise on the Middle Way (trans. Jeffrey
Hopkins). Dharamsala (India): Library of Tibetan Works and Archives.
Châtelet, François (1965). Platon, Paris: Gallimard/NRF-Idées.
Chomsky, Noam & Dieterich, Heinz (1997). La aldea global. Tafalla, Navarra, Spain:
Txalaparta. (1st Spanish Ed. 1996.)
Chöphel, Gendün (2005). Clarifying the Core of Madhyamaka: Ornament of the Thought of
Nagarjuna (English trans., Pema Wangjié & Mulligan, Jean; Elías Capriles Ed. and
Introduction). Arcidosso, GR, Italy: Shang Shung Edizioni.
Cioran, Émile M. (1964). La chûte dans le temps. Paris: Gallimard. (English 1970. The Fall
into Time. New York, NY: Quadrangle.)
Clastres, Pierre (1985). Chronique des indiens Guayaki: Ce que savent les Aché, chasseurs
nomades du Paraguay (original Ed. 1972. Paris: Plon, Terre humaine.)
Clastres, Pierre (1974). La société contre l’état: Recherches d’anthropologie politique.
Paris: Les Éditions de Minuit.
Clastres, Pierre (1987). La economía de la abundancia en la sociedad indivisa (The
Economy of Plenty in the Undivided Society). (Originally published as a Preface to
961
Marshall Sahlins’ Stone Age Economics.) Mexico: supplement to Testimonios, N° 4,
October 1987 (Reproduced from Buenos Aires: ediciones Antropos, Supplement to
Aletheya, 6, 1985).
Clastres, Pierre (1993). La palabra luminosa. Buenos Aires: Ediciones Colihue SRL.
Claudel Paul (1943) Art Poétique. Connaissance du temps. Traité de la co-naissance au
monde et de soi-même. Développement de l'église. Paris: Mercure de France. (Original
Ed. 1907 by the same publishers.)
Cleary, Thomas S. & Cleary, J. C. (Trans.) (1977). The Blue Cliff Record (3 vol.). Boulder,
CO and London: Shambhala.
Cleary, Thomas (1990). Tao of Politics: Lessons of the Masters of Huainan. Boston, MA:
Shambhala Dragon Editions.
Cleary, Tom S. & Shapiro, Sam I. (1996). Abraham Maslow and Asian Psychology. Kyoto:
Psychologia, 1996, 39, 213-222.
Collins, Harry & Pinch, Trevor (1998). The Golem. What You Should Know about Science.
Cambridge, UK: Cambridge University Press.
Conche, Marcel (1994). Pyrrhon ou l’apparence (Pyrrho or Appearance). Paris, Editions
P.U.F. (2d. Ed. of 1973. Villers-sur-Mer, France: Éditions du Mégare).
Cooper, David E. (1967). Psychiatry and Antipsychiatry. New York, NY: Ballantine.
Cooper, David E. (Ed.) (1968). The Dialectics of Liberation. Harmondsworth, Middlesex,
UK: Pelican Books.
Cooper, David E. (1971). The Death of the Family. Harmondsworth, Middlesex, UK:
Pelican Books.
Cooper, David E. (1974). The Grammar of Living. New York, NY: Pantheon.
Cooper, David E. (1980). The Language of Madness. Harmondsworth, Middlesex, UK:
Penguin Books.
Copleston, Frederick (1993). A History of Philosophy. Vol. I, Greece and Rome: From the
Pre-Socratics to Plotinus. New York, NY: Doubleday.
Corbin, Henry. Cyclical Time and Ismaili Gnosis. Translated by Ralph Manheim & James
W. Morris. Boston: Kegan Paul International, 1983.
Cornu, Philippe (translator and commentator) (1995). Le miroir du cœur: Tantra du
Dzogchen. Paris: Éditions du Seuil, collection Points-Sagesses Sa82.
Cornu, Philippe (2001). Dictionnaire Encyclopédique du Bouddhisme. Paris: Éditions du
Seuil.
Correa, Paulo & Correa, Alexandra (2002). Pulse of the Planet Taken to Task: Review of
James Demeo’s Pulse of the Planet #5, 2002 (or, The End of the Road for
Orgonomism). Internet: http://www.aetherometry.com/PP5.html
Coward, Harold (1990). Derrida and Indian Philosophy. Albany, NY: SUNY Press.
Creel, Herrlee G. (1970), What is Taoism? and Other Studies in Chinese Cultural History.
Chicago, IL: University of Chicago Press.
Critchley, Simon (1999). The Ethics of Deconstruction: Derrida and Levinas. Edinburgh,
Scotland, UK: University of Edinburgh Press.
Dabrowski, K. (1964a). Personality Shaping through Positive Disintegration. London:
Little Brown & Co.
Dabrowski, K., Kawczak, A. & Piechowski, M. M. (1964). Mental Growth through
Positive Disintegration. London: Gryf Publications.
Dabrowski, Kazimierz (1964b). Positive Disintegration. Boston, MA: Little, Brown and
Company.
962
Dabrowski, Kazimierz (1980). La psiconeurosis no es una enfermedad (1972.
Psychoneurosis is not an Illness). Lima: Ediciones Unife.
Dalai Lama, Fourteenth (1990). Teaching Given at Merigar Gompa, Arcidosso, Grosseto,
Italy, in the last days of May 1990. Arcidosso, GR, Italy: The Mirror, 3, July 1990, 2-3.
Dale, Tom & Carter, Vernon Gill (1955). Topsoil and Civilization. Oklahoma, OK:
University of Oklahoma Press.
Daniélou, Alain (1992). Gods of Love and Ecstasy: The Traditions of Shiva and Dionysus
(original French Ed. 1979). Rochester, VT: Inner Traditions International.
Daniels, B. (2004). “The trans/trans fallacy and the dichotomy debate.” San Francisco, CA:
The International Journal of Transpersonal Studies, 23, pp. 75-90.
Dante Alighieri (1979/1983). La divina commedia. Milan, Italy: Ulrico Hoepli.
David-Neel, Alexandra and Lama Yongden (1967). The Secret Oral Teachings in Tibetan
Buddhist Sects (trans. Capt. H. N. M. Hardy, foreword by Alan Watts). San Francisco,
CA: City Lights Books.
David-Neel, Alexandra and Lama Yongden (1981). The Superhuman Life of Gesar of Ling
(Preface: Chögyam Trungpa.). Boulder, CO: Prajña Press. (New French Ed.: [1968], La
vie surhumaine de Guésar de Ling. Paris: Plon Éditeurs, Collection Gnose.)
Dear, G. F. (1961). Determinism in Classical Physics. Oxford, UK: Oxford University
Press, British Journal for the Philosophy of Science, 11, 289-304.
Deleuze, Gilles (1980). Psicoanálisis muerto analiza (Dead Psychoanalysis Analyzes). In
Deleuze, Gilles & Parnet, C. (1980) Diálogos (original French Ed. 1977). Valencia,
Spain: Editorial Pre-Textos.
Deleuze, Gilles (1995). Difference and Repetition. New York, NY: Columbia University
Press.
DeMeo, James (1998). Saharasia. Ashland, OR: Natural Energy Works (Orgone
Biophysical Research Lab).
Derrida, Jacques (1967). De la grammatologie. Paris: Éditions de Minuit. (English Ed.,
1976/1998). Of Grammatology. Baltimore, MA: Johns Hopkins University Press.
Derrida, Jacques (1972a). Marges de la philosophie. Paris: Éditions de Minuit.
Derrida, Jacques (1972b). Positions. Paris: Éditions de Minuit.
Derrida, Jacques (1967). La voix et le phenomene. Introduction au problème du signe dans
la phénomenologie de Husserl. Paris: Presses Universitaires de France. (English Ed.,
1973. Speech and Phenomena' and Other Essays on Husserl’s Theory of Signs.
Evanston, IL: Northwestern University Press.)
Derrida, Jacques (1978). Writing and Difference (English trans. Alan Bass). Chicago, IL:
University of Chicago Press.
Derrida, Jacques (1991). Of Spirit: Heidegger and the Question. Chicago, IL: Chicago
University Press.
Dershowitz, Alan M. (1992). Harvard Witch Hunt Burns the Incorrect at the Stake. Los
Angeles, CA: Los Angeles Times, Washington Ed., 22 April 1992, p. A11.
Descamps, Marc-Alain (1987). Qu’est-ce-que le Transpersonnel? Paris: Trimegiste.
Descartes, René (1990). Les passions de 1’âme. Paris: Le Livre de Poche.
Descola, Philippe (1996). Les cosmologies des indiens d’Amazonie. Comme pour leurs
frères du nord, la nature est une construction sociale. (The Cosmologies of Amazonian
Indians: As is the Case with their Brothers to the North, Nature is a Social
Construction). Paris: La Recherche, 292, November 1996, 62-7.
963
De Sousa Santos, Boaventura (1988). Um discurso sobre as ciências (1st Ed. 1987). Porto,
Portugal: Edições Afrontamento.
Díaz, Elías (1989). The New Social Contract. Political Institutions and Social Movements.
In Oñati Proceedings, 1, 1989, Legal Culture and Everyday Life. Oñati, Guipuzkoa,
Euskadi, Spain: Oñati International Institute for the Sociology of Law.
Diogenes Laërtius (1972-1979). Lives of eminent philosophers. With an English translation
by R.D.Hicks (2 vols). Cambridge, Mass: Harvard University Press, Loeb Classical
Library.
Dowman, Keith (Ed. & Trans.) (1980). The Divine Madman. London: Rider & Company.
Dowman, Keith (Ed. & Trans.) (1984). Sky Dancer: The Secret Life and Songs of the Lady
Yeshe Tsogyel. London: Routledge & Kegan Paul.
Dowman, Keith (1992), The Flight of the Garuda. Ithaca: Snow Lion.
Drake, Richard (1986). Julius Evola and the Ideological Origins of the Radical Right in
Contemporary Italy, in Peter Merkl (Ed.), Political Violence and Terror: Motifs and
Motivations. Berkeley, CA: University of California Press, 1986, 61-89.
Drake, Richard (1988). Julius Evola, Radical Fascism, and the Lateran Accords.
Washington, DC: The Catholic Historical Review, 74, 1988, 403-19.
Drake, Richard (1989). The Children of the Sun. In The Revolutionary Mystique and
Terrorism in Contemporary Italy, 116-134. Bloomington, IN: Indiana University Press.
Dreyfus, George B. J. (1997), Recognizing Reality: Dharmakirti’s Philosophy and its
Tibetan Interpretations. Albany (NY): SUNY Press.
Dudjom Lingpa (1994). Buddhahood Without Meditation: A Visionary Account Known as
Refining Apparent Phenomena (Nang jang) (trans.: Richard Barron). Junction City,
CA: Padma Publishing.
Dudjom Rinpoche (1978). The Alchemy of Realization (Ri chos bslab bya nyams len dmar
khrid go bder brjod pa grub pa’i bcud len) (English trans. by John Reynolds).
Kathmandu, Nepal: Simhanada Publications.
Dudjom Rinpoche (1979). Extracting the Quintessence of Accomplishment (Ri chos bslab
bya nyams len dmar khrid go bder brjod pa grub pa’i bcud len) (English trans. by
Matthieu Ricard). Darjeeling, WB, India: Ogyan Kunsang Choekhorling.
Dudjom Rinpoche (unpublished ms.). Calling the Lama from Afar. (Poem trans. by
Elisabeth Andersen.)
Dudjom Rinpoche (1991). The Nyingma School of Tibetan Buddhism (2 vol.; trans.: G.
Dorje & M. Kapstein). Boston, MA: Wisdom Publications.
Eichler, Arturo (1987). S.O.S. planeta tierra (SOS Planet Earth). Caracas: National Guard
of Venezuela.
Eichler, Arturo (1987). ¿Agricultura química o biológica? (Chemical or Biological
Agriculture?). In Eichler, Arturo (1987). S.O.S. planeta tierra (SOS Planet Earth).
Caracas: National Guard of Venezuela.
Eisler, Riane (1987). The Chalice and the Blade: Our History, Our Future. San Francisco,
CA: Harper & Row.
Eliade, Mircea (1959). Cosmos and History: the Myth of the Eternal Return. New York,
NY: Harper.
Eliade, Mircea (1964). Shamanism: The Archaic Techniques of Ecstasy. New York, NY:
Pantheon Books.
Eliade, Mircea (1967). From Primitives to Zen. London: Collins.
Eliade, Mircea & Couliano, Ioann P. (1990). Dictionnaire des Religions. Paris: Plon.
964
Elorduy, Carmelo (1983). Introduction. In Lao-tzu, Tao Te Ching, 9-93. Barcelona, Spain:
Orbis. (Original Ed. 1977.)
Engels, Friedrich (1968). The Origins of the Family, Private Property and the State (7th
printing). Moscow: Progress Publishers.
Engels, Friedrich (1998/2001). Dialectics of Nature. Transcribed for MEIA by Sally Ryan
&
[email protected]. Internet: http://www.marxists.org/archive/marx/works/l 883/don/
Erasmus, Desiderius (1984). Elogio de la locura (Morias Enkomion / Moriæ encomium).
Barcelona, Spain: Historia del pensamiento, Editorial Orbis. (Originally published in
1509. English 2004. In Praise of Folly. Mineola, NY: Trade Paperback, Dover
Publications.)
Esterson, Aaron (1972). The Leaves of Spring. Middle Village, NY: Penguin Books Inc.
Estiú, Emilio (1980). El problema metafísico en las obras de Heidegger. In Heidegger,
Martin (1980). Introducción a la metafísica (Einführung in die Metaphysik). Buenos
Aires, Editorial Nova.
Evans-Pritchard, Edward E. (1967). Nuer Religion. London: Oxford University Press.
Evola, Julius (1994). René Guénon: A Teacher for Modern Times (trans. Guido Stucco).
Edmonds, WA: Holmes Publishing Group.
Famose, Jean-Pierre (pseudo Thomas Münzer) (1966). Sexualité et travail. Paris: Maspero:
Partisans 32-33 (Sexualité et répression I), Oct.-Nov. 1966.
Federn, Paul (1952). Ego Psychology and the Psychoses. New York, NY: Basic Books.
(Original Ed. 1926.)
Feifel, Herman (1959). The Meaning of Death (with essays by Carl Jung, Paul Tillich,
Walter Kaufmann, Gardner Murphy, Curt Richter). New York, NY: McGraw-Hill
Book Company.
Ferenczi, Sandor & Rank, Otto (2006). The Development of Psychoanalysis (trans.
Caroline Newton). Kila MT: Kessinger Publishing. (Original German pub. 1924.)
Fetscher, Iring (1971). Carlos Marx y el marxismo. Caracas: Monte Avila Editores.
(Original Ed. 1967.)
Fenichel, Otto (1945). The Psychoanalytic Theory of Neurosis. New York, NY: Norton.
Ferguson, R. B. (2000). The Causes and Origins of Primitive Warfare. Washington, DC:
George Washington University Institute for Ethnographic Research, Anthropological
Quarterly 73(3), 159-164.
Fernández Colón, Gustavo (2005). La corriente nocturna. Caracas: Monte Ávila Editores.
Feyerabend, Paul K. (1982). La ciencia en una sociedad libre (Science in a Free Society).
Mexico, Madrid & Bogotá: Siglo XXI Editores. (Original English Ed. 1980.)
Feyerabend, Paul K. (1984). Contra el método. Esquema de una teoría anarquista del
conocimiento (Against Method. Schema of an Anarchist Theory of Knowledge).
Barcelona, Spain: Historia del pensamiento, Editorial Orbis. (Original English Ed.
1970; 1st Spanish Ed. 1974.)
Feyerabend, Paul K. (1987). Adiós a la razón (Farewell to Reason). Madrid: Editorial
Tecnos. (1st Spanish Ed. 1984.)
Fifth Dalai Lama (1974). The Practice of Emptiness (trans. J. Hopkins). Dharamsala,
Kangra Dist., HP, India: Library of Tibetan Works and Archives.
Fifth Dalai Lama (1974). The Practice of Emptiness (trans. J. Hopkins). Dharamsala,
Kangra Dist., HP, India: Library of Tibetan Works and Archives.
Fine, Reuben (1987). Historia del psicoanálisis. Buenos Aires: Paidós.
965
Fish, Stanley (1992). There’s No Such Thing as Free Speech and It’s a Good Thing Too.
Boston, MA: Boston Review, February 1992, p. 3.
Fischer, C. G. (1923). Estudio Sobre el Principio Activo de Yagé. Bogotá: Universidad
Nacional (Unpublished Thesis).
Foucault, Michel (1967/1986). Historia de la locura en la época clásica (2 vol.) (Madness
and Civilization: A History of Insanity in the Age of Reason). Mexico: Fondo de Cultura
Económica (Breviarios). (Original French Ed. 1964/1972.)
Foucault, Michel (1976). Vigilar y castigar. Nacimiento de la prisión (Discipline and
Punish: The Birth of the Prison). Mexico: Siglo XXI Editores, S.A. (Original French
Ed. 1975.)
Foucault, Michel (1978). Microfisica del poder (Microphysics of Power). Madrid:
Ediciones de La Piqueta.
Foucault, Michel (1985/1984). The Use of Pleasure: The History of Sexuality, Vol 2.
(Trans. Robert Hurley.) New York, NY: Pantheon Books.
Frazer, James G. (1959). The New Golden Bough. New York, NY: Criterion. (Also: Frazer,
James George & Fraser, Robert, Ed. [1998]. The Golden Bough: A Study in Magic and
Religion: A New Abridgement from the Second and Third Editions. Oxford: Oxford
University Press.)
Freud, Sigmund (1946). Totem and Taboo: Resemblances Between the Psychic Lives of
Savages and Neurosis. New York, NY: Vintage Books.
Freud, Sigmund (1953-1974). The Standard Edition of the Complete Psychological Works
of Sigmund Freud (24 vols., James Strachey, trans.). London: The Hogarth Press.
Freud, Sigmund (1962). On the History of the Psychoanalytic Movement. New York, NY:
W. W. Norton & Co Inc., Collier Books.
Freud, Sigmund (1963). General Psychological Theory: Papers on Metapsychology. New
York, NY and London: Macmillan/Collier. (Original German Ed. 1915; this is the 11th
printing of this English Ed.)
Freud, Sigmund (1964). The Future of an Illusion. Garden City, NJ: Doubleday Anchor.
(Original Ed. 1927.)
Freud, Sigmund (1974). Proyecto de una psicología para neurólogos. Madrid: Alianza
Editorial. (Original German Ed. 1895.) (Project for a Scientific Psychology, reprinted in
The Standard Edition of the Complete Psychological Works of Sigmund Freud, Vol. I,
1886-1899, at 295.)
Freud, Sigmund (1983). The Interpretation of Dreams. Dresden, TN: Avon Books.
(Original German Ed. 1899, dated 1900.)
Freud, Sigmund (1989). Civilization and Its Discontents. New York, NY: W. W. Norton &
Co Inc. (Original German Ed. 1930.)
Freud, Sigmund (1990). The Ego and the Id. New York, NY: W. W. Norton & Co Inc.
(Original German Ed. 1923.)
Frick, W. (1973) Psicología humanística. Buenos Aires: Guadalupe.
Fromm, Erich (1955). The Sane Society. New York, NY: Fawcett Publications, Inc.
Fromm, Erich; Suzuki, D. T. & De Martino, Richard (1960). Zen Buddhism and
Psychoanalysis. New York, NY: Harper & Brothers.
Fromm, Erich (1966). Les implications humaines du gauchisme instinctiviste. Une réponse
à Herbert Marcuse. Paris: Maspero: Partisans, N. 32-33 (Sexualité et répression I),
Oct.-Nov. 1966. Original publication 1955.
966
Gadamer, Hans-Georg (1995). El inicio de la filosofia occidental. Lecciones compiladas
por Vittorio De Cesare (The Beginning of Western Philosophy. Lessons Edited by
Vittorio De Cesare). Barcelona, Spain-Buenos Aires-Mexico: Paidós. (Original Italian
Ed. 1993.)
Gampopa (1998). The Jewel Ornament of Liberation: The Wish-Fulfilling Gem of the
Noble Teachings. Ithaca, NY: Snow Lion.
Gao, Wei, Yu Xin Huang, Hong Chen, Da Yong Song & Qin Li Wang (2000). Regulatory
effects of electro-acupuncture at Tsusanli on ir-SP content in rats’ pituitary gland and
peripheral blood and their immunity. Beijing: The WJG Press, World Journal of
Gastroenterology,
2000;
6(4):581-584.
Internet:
http://www.wjgnet.com/downpdf.asp?url=/l007-9327/6/581
Gay, Peter (1989). Freud. Una vida de nuestro tiempo. Buenos Aires: Paidós.
Gebser, Jean (1986). The Ever-Present Origin: The Foundations and Manifestations of the
Aperspectival World (Part One: Foundations of the Aperspectival World; Part Two:
Manifestations the Aperspectival World) (English translations by Noel Barstad & Algis
Mickunas). Athens, OH: Ohio University Press.
Gendün Chöphel (2005). Clarifying the Core of Madhyamaka: Ornament of the Thought of
Nagarjuna (English trans., Pema Wangjié & Mulligan, Jean; Elías Capriles Ed. and
Introduction). Arcidosso, GR, Italy: Shang Shung Edizioni.
Gerez-Ambertin, Marta (1993). Las voces del superyó. En la clínica psicoanalítica y el
malestar de la cultura. Buenos Aires: Ediciones Manantial SRL.
Gibran, Gibran Khalil (2000). Khalil l’heretic. Rennes, France: Part Commune.
Giles, Herbert (trans. 1980). Chuang Tzu: Mystic, Moralist, and Social Reformer. London:
Mandala. (Original Ed. 1899; London: Bernard Quartich. Chinese Ed. 1926; Shanghai,
China: Kelly & Walsh.)
Gilliam, Harold (1986). New Paradigm Trip. San Francisco, CA: San Francisco Chronicle,
January 5, 1986.
Gilligan, Carol (1982). In a Different Voice. Cambridge, MA: Harvard University Press.
Gimbutas, Marija (1989). Il linguaggio della dea. Mito e Culto della dea madre nell’
Europa neolitica. Longanesi, Milan. (English 1989. The Language of the Goddess.
London: Thames & Hudson.)
Gimbutas, Marija (1982). Goddesses and Gods of Old Europe, 7000 to 3500 B. C.: Myths,
Legends, and Cult Images. Berkeley, CA: University of California Press.
Gimbutas, Marija (1991). The Civilization of the Goddess. San Francisco, CA:
HarperSanFrancisco.
Gimbutas, Marija (1997). The Living Goddesses. Berkeley, CA: University of California
Press.
Gladisch, August (1858). Empedokles und die Aegypter : Eine historische Untersuchung.
Leipzig, Germany: Hinrichs
Gladisch, August (1859). Herakleitos und Zoroaster : Eine historische Untersuchung.
Leipzig, Germany: Hinrichs.
Gladisch, August (1864). Anaxagoras und die Israeliten : Eine historische Untersuchung.
Leipzig, Germany: Hinrichs.
Gladisch, August (1866). Die Hyperboreer und die alten Chinesen : Eine historische
Untersuchung. Leipzig, Germany: Hinrichs.
967
Gliedman, John (1984). Turning Einstein upside down: In the quantum universe of John
Archibald Wheeler nothing exists until it is observed. McLean, VA: Science Digest,
Oct. 1984.
Gödel, Kurt (1962). On Formally Undecidable Propositions of Principia Mathematica and
Related Systems. New York, NY: Basic Books.
Gödel, Kurt (2001). Collected Works: vol. l, Publications 1929-1936. Oxford, UK: Oxford
University Press. (For the 1931 work, Ueber die Vollständigkeit des Logikkalküls.)
Goffman, Erving (1963). Stigma: Notes on the Management of Spoiled Identity. Upper
Saddle River, NJ: Prentice-Hall, Inc.
Goldstein, Kurt (1963). The Organism. Boston, MA: Beacon Press. (Original German Ed.
1934.)
Gómez de Liaño, Ignacio (1998). El círculo de la sabiduría (The Circle of Wisdom).
Madrid: Ediciones Siruela.
Goodman, Paul (1977). Anarchism and Revolution. In Stoehr, Taylor (Ed.) Drawing the
Line: The Political Essays of Paul Goodman (pp. 215-232). New York, NY: EP Dutton.
Gramsci, Antonio (1998). El materialismo histórico y la filosofía de Benedetto Croce.
Buenos Aires: Editorial Nueva Visión. (Ed. original 1948. Turín: Einaudi.)
Gregory, Richard (1995). Diccionario Oxford de la Mente. Madrid: Alianza Editorial.
Grof, Stanislav (1975). Realms of the Human Unconscious. New York, NY: Viking.
Grof, Stanislav (1985). Beyond the Brain. Albany, NY: State University of New York
Press.
Grof, Stanislav (1986). Psychology and Consciousness Research. Washington, DC: Re
VISION magazine, 9(1), summer/fall 1986.
Grof, Stanislav (1987). The Adventure of Self-Discovery. Albany, NY: State University of
New York Press.
Grof, Christina & Grof, Stanislav (1992). The Stormy Search for the Self. New York:
Jeremy P. Tarcher, Inc.
Grof, Stanislav (1996). Ken Wilber’s Spectrum Psychology: Observations from Clinical
Consciousness Research. Washington, DC: ReVISION: A Journal of Consciousness and
Transformation, 19(1), 11-24.
Grof, Stanislav (1998a). The Cosmic Game: Explorations of the Frontiers of Human
Consciousness. Albany, NY: State University of New York (SUNY) Press.
Grof, Stanislav (1998b). Human nature and the nature of reality: conceptual challenges
from consciousness research. San Francisco, CA: Haight-Ashbury Publications,
Journal of Psychoactive Drugs. Vol. 30, No. 4.
Grof, Stanislav (1998c). Ken Wilber’s Spectrum Psychology. In Rothberg, Donald &
Kelly, Sean (Eds.), Ken Wilber in Dialogue, pp. 85-116. Wheaton, IL: Quest Books.
Grof, Stanislav (1998d). Spectrum Psychology Revisited. In Rothberg, Donald & Kelly,
Sean (Eds.), Ken Wilber in Dialogue, pp. 377-379. Wheaton, IL: Quest Books.
Grof, Stanislav (2000). Beyond Psychoanalysis. Internet: Home.att.net.
Guénon, René (1945). Le règne de la quantité et les signes des temps. Paris: Gallimard
Idées NRF.
Guénon, René (1947/1991). L’homme et son devenir selon le Vedanta. Paris: Editions
Traditionnelles.
Guénon, René (2001): Check Gustavo Fernández Colon’s book to see whether the
English version of this book is (2003: see immediately following entry) or else add
the relevant source.
968
Guénon, René (2003). Traditional Forms and Cosmic Cycles. La Vergne, TN: Lightning
Source Inc.
Guenther, Herbert V. (1963). The Life and Teaching of Naropa. Oxford, UK: Clarendon
Press.
Guenther, Herbert V. (1964). Philosophy and Psychology in the Abhidharma. New Delhi:
Motilal Banarsidass. (Another edition: Berkeley 1976).
Guenther, Herbert V. (1969). Yuganaddha: The Tantric View of Life (The Sexual Imagery
of the Tantras: The Four Mudras). Varanasi, UP (India): Chowkhamba Sanskrit Series
Office (K. 37/99, Gopal Mandir Lane, P. O. Box 8, Varanasi-l, India), Vol. III. (This is
the 2d Edition, revised.)
Guenther, Herbert V. (1973). The Royal Song of Saraha. Berkeley, CA: Shambhala. (With
commentaries by sKye med bde chen & Karma Phrin las pa.)
Guenther, Herbert V. (1977). Tibetan Buddhism in Western Perspective. Emeryville, CA:
Dharma Press.
Guenther, Herbert V. (1984). Matrix of Mystery. Scientific and Humanistic Aspects of
rDzogs-chen Thought. Boulder, CO: Shambhala.
Guenther, Herbert V. (1993). Ecstatic Spontaneity: Saraha’s Three Cycles of Doha.
Berkeley, CA: Asian Humanities Press.
Guenther, Herbert V. (1999). Mandala and/or dkyil-’khor. Honolulu, HI: The International
Journal of Transpersonal Studies, Vol. 18, No. 2, 149-162.
Guenther, Herbert V. (2000). Is the Mind in Search of Itself? Honolulu, HI: The
International Journal of Transpersonal Studies, Vol. 19, 15-22.
Guenther, Herbert V. & Kawamura, Leslie (1975). Mind in Buddhist Psychology. A
translation of Ye shes rGgyal mtshan’s The Necklace of Clear Understanding.
Emeryville, CA: Dharma Publishing.
Gupta, Bina (1998). The Disinterested Witness. A Fragment of Advaita Vedanta
Phenomenology. 2d Ed. Evanston, IL: Northwestern University Press. (Original Ed.
1947.)
Gurwitsch, Aron (1971). Introduction. In Goldstein, Kurt (1971). Selected Papers /
Ausgewählte Schriften. (Ed. Aron Gurwitsch, Else M. Goldstein Haudek, William E.
Haudek.) Haag, Germany: Nijhoff. Internet: http://www.gurwitsch.net/goldstein.htm
Habermas, Jürgen (1977). Toward a Rational Society. London: Heinemann. (1st English
Ed. 1971.)
Habermas, Jürgen (1979). Communication and the Evolution of Society. London:
Heinemann / Boston, MA: Beacon Press.
Habermas, Jürgen (1982). Conocimiento e interés. Madrid: Taurus. (Original German Ed.
1968.)
Habermas, Jürgen (1984). Ciencia y técnica como “ideología.” Madrid: Editorial Tecnos.
Habermas, Jurgen (1987). The Philosophical Discourse of Modernity: Twelve Lectures. (Tr.
by Frederick Lawrence.) Cambridge, MA: The MIT Press.
Halifax, Joan (1978). Shamanic Voices: A Survey of Visionary Narratives. New York, NY:
E. P. Dutton.
Halifax, Joan (1983). Shaman : The Wounded Healer. Crossroad Publishing Co
Hall, David L. (1978). Process and Anarchy: A Taoist Vision of Creativity. Philosophy
East and West, 28, 3 (July 1978), pp. 271-85.
Hall, David L. (1983). The Metaphysics of Anarchism. Journal of Chinese Philosophy, 10,
pp. 49-63.
969
Hall, David L. & Ames, Roger T. (1995). Anticipating China. Albany, NY: SUNY.
Hamilton, Malcolm B. (1995). The Sociology of Religion. London: Routledge.
Happold, F. C. (1986). Mysticism. London: Penguin.
Hardt, Michael & Negri, Antonio (2001). Empire. Cumberland, RI: Harvard University
Press.
Hardt, Michael & Negri, Antonio (2004). Multitude: War and Democracy in the Age of
Empire. East Rutherford, NJ: Penguin Putnam.
Harner, Michael J. (1973). Hallucinogens and Shamanism. Cary, NC: Oxford University
Press.
Harrison, Paul (1997). North American Indians: The Spirituality of Nature: A History of
Pantheism and Panentheism. At http://members.aol.com/pantheism0/indians.htm
Harvey, David (1990). The Condition of Postmodernity: An Enquire into the Origins of
Cultural Change. Cambridge, MA: Blackwell.
Haule, John Ryan (1990). Divine Madness: Archetypes of Romantic Love. 2. The Naked
Sword:
Opportunity
for
Love's
Transformation.
Internet:
http://www.jrhaule.net/dm02.html
Heartfield, James (2002). The ‘Death of the Subject’ Explained. Leicester, UK: Perpetuity
Press.
Short
abstract
in
Internet:
http://www.marxists.org/reference/subject/philosophy/works/en/heartfield-james.htm
Hegel, Georg Wilhelm Friedrich (1955). The Phenomenology of Mind. London: Allen &
Unwin (2nd Revised English Ed.). (Spanish translation 1966. Fenomenología del
espíritu. Mexico: Fondo de Cultura Económica.)
Hegel, Georg Wilhelm Friedrich (1968). Philosophy of Right. New York: Oxford
University Press Inc.
Hegel, Georg Wilhelm Friedrich (1984-1987). Lectures on the Philosophy of Religion (3
vols.). Berkeley, CA: University of California Press.
Hegel, Georg Wilhelm Friedrich (1988). Introduction to the Philosophy of History.
Indianapolis, IN: Hackett Pub Co Inc. (Original German Ed. 1827.)
Hegel, Georg Wilhelm Friedrich (1976). Ciencia de la lógica (2 vols.). (Spanish translation
by Augusta & Roberto Mondolfo.) Buenos Aires: Ediciones Solar. (Original Ed. of this
translation [1956]. (1990). Hegel’s Science of Logic. Amherst, NY: Humanity Books (a
division of Prometheus Books).
Hegel, Georg Wilhelm Friedrich (1991). Encyclopedia of the Philosophical Sciences in
Outline and Critical Writings. New York, NY: Continuum International Publishing
Group.
Heidegger, Martin (1929). Was ist Metaphysik? In Heidegger, M. (1976). Gesamtausgabe,
IX: Wegmarken, p.103-122. Frankfurt am Main, Germany) Vittorio Klostermann. (In
the original Ed. of Wegmarken, before being included in Gesamtausgabe, 1-19.)
Heidegger, Martin (1938). Die Zeit des Weltbildes (translated as The Age of the World
Picture). In Heidegger, M. (1977). Gesamtausgabe, V, Holzwege (translated as Off the
Beaten Track), 69-104. Frankfurt am Main: Vittorio Klostermann.
Heidegger, Martin (1943). Aletheia. In Heidegger, M. (1975). Early Greek Thinking, 102123. New York, NY: Harper & Row Publishers.
Heidegger, Martin (1947). Letter on Humanism (addressed to Jean Baufret). In Heidegger,
Martin, 1978, Ed. D. F. Krell.
Heidegger, Martin (1951). Logos. In Heidegger, M. (1975), Early Greek Thinking, 59-78.
New York, NY: Harper & Row Publishers.
970
Heidegger, Martin (1953/54). Aus einem Gespräch von der Sprache. Zwischen einem
Japaner und einem Fragenden. In (1985). Unterwegs zur Sprache (1950-1959)
[Gesamtausgabe 12]. Frankfurt am Main, Germany: Vittorio Klostermann. (English
1971; this. Ed. 1982. On the Way to Language. New York: Harper & Row.)
Heidegger, Martin (1954a). Moira (Parmenides VIII, 34-41). In Heidegger, M. (1954),
Vorträge und Aufsätze. Pfullingen, Germany: Neske Verlag. (English in Heidegger, M.
1975. Early Greek Thinking, 79-101. New York: Harper & Row Publishers.)
Heidegger, Martin (1954b). Wissenschaft und Besinnung. In Heidegger, M. (1954),
Vorträge und Aufsätze. Pfullingen, Germany: Neske Verlag.
Heidegger, Martin (1954c). Wer ist Nietzsches Zarathustra? In Heidegger, M. (1954),
Vorträge und Aufsätze. Pfullingen, Germany: Neske Verlag.
Heidegger, Martin (1955). Zur Seinsfrage. In Heidegger, M. (1976) Gesamtausgabe, IX:
Wegmarken, 385-426. Frankfurt am Main, Germany: Vittorio Klostermann.
Heidegger, Martin (1957). Der Satz der Identität. In (1957/1976) Identität und Differenz, p.
25. Now in (1994) Gesamtausgabe, LXXIX: Bremer und Freiburger Vorträge.
Frankfurt am Main, Germany: Vittorio Klostermann.
Heidegger, Martin (1958). Grundsätze des Denkens. In Jahrbuch für Psychologie und
Psychotherapie (6) 1-3, 1958, p. 40. Now in (1994) Gesamtausgabe, LXXIX: Bremer
und Freiburger Vorträge, p. 93. Frankfurt am Main, Germany: Vittorio Klostermann.
Heidegger, Martin (1959). Das Wesen der Sprache. In (1985) Gesamtausgabe, XII:
Unterwegs zur Sprache, p. 187. Frankfurt am Main, Germany: Vittorio Klostermann.
Heidegger, Martin (1971). The Origin of the Work of Art. In Heidegger, M. (1971). Poetry,
Language, Thought (English trans. Albert Hofstadter), 17-79. New York, NY:
HarperCollins. (Original German Ed. 1936.)
Heidegger, Martin (1976) Das Spiegel—Interview. In Neske, G. & Kettering, E. (Eds.)
(1988) Antwort. Martin Heidegger im Gespräch. Pfullingen: Neske Verlag.
Heidegger, Martin (1977). The Question Concerning Technology, and Other Essays. New
York, NY: HarperCollins, Harper Torchbooks.
Heidegger, Martin (1978a). Basic Writings (Ed. D. F. Krell). London: Routledge; San
Francisco, CA: Harper San Francisco.
Heidegger, Martin (1978b). The End of Philosophy and the Task of Thinking (text of the
1968 conference Das Ende des Philosophie und die Aufgabe des Denkens). In
Heidegger, Martin, 1978, Ed. D. F. Krell. Also Internet: http://evansexperientialism.freewebspace.com/heidegger8a.htm (Original German Ed. 1969)
Heidegger, Martin (1980), Introducción a la metafísica (trans. Emilio Estiú). Buenos Aires:
Editorial Nova.
Heidegger, Martin (1987). An Introduction to Metaphysics (Einführung in Die Metaphysik;
English translation by Max Niemeyer). New Haven and London: Yale University Press.
(Original German edition 1953. Tübingen: Max Niemeyer Verlag, 157 pp. 1st English
Ed. of this trans. 1959.)
Heidegger, Martin (1988). The Basic Problems of Phenomenology (Die Grundprobleme
der Phänomenologie; trans. Albert Hofstadter). Bloomington and Indianapolis, IN:
Indiana University Press. (Revised Ed. of English version of 1982.) (Original German
Ed. 1975.)
Heidegger, Martin (1989). Überlieferte Sprache und technische Sprache. St Gallen: Erker.
(Original Ed. 1962.)
971
Heidegger, Martin (1992). Séjours / Aufenthalte (French bilingual Ed. François Vezin,
trans. and notes). Monaco: Éd. du Rocher. (Original German Ed. 1989.)
Heidegger, Martin (1996). Being and Time (trans. Joan Stambaugh). Albany, NY: SUNY
Press. (1927. Original German Ed. 1953.)
Heidegger, Martin (1997). Der Satz vom Grund [Gesamtausgabe 10]. Fkankfurt am Main,
Germany: Vittorio Klostermann.
Heinrich, Clarck (2002). Magic Mushrooms in Religion and Alchemy. Rocheter, VT: Park
Street Press.
Heisig, James W. (2001). Philosophers of Nothingness: An Essay on the Kyoto School.
Honolulu, HI: University of Hawai‘i Press. In this regard cf. also the Internet URL:
www.nanzan-u.ac.jp/SHUBUNKEN.
Hinshelwood, Robert D. (1991). A Dictionary of Kleinian Thought. London: Free
Association Books.
Hobbes, Thomas (1970). Leviathan. New York, NY: Washington Square Press. (Original
Ed. 1651.)
Hoering, W. (1969). Indeterminism in Classical Physics. Oxford, UK: Oxford University
Press, British Journal for the Philosophy of Science, 20, 247-55.
Holland, Cornelius J. & MacDonald, Douglas A. (2006). Gebser’s Integral Consciousness
and Living in the Real World: Facilitating its Emergence Using A Course in Miracles.
San Francisco, CA: The International Journal of Transpersonal Studies, 25, pp. 70-76.
Hume, David (1964). A Treatise of Human Nature. Oxford: Clarendon Press.
Husserl, Edmund (1982). Ideas Pertaining to a Pure Phenomenology and to a
Phenomenological Philosophy (trans. F. Kersten). Dordrecht, Holland: Kluwer.
(Original German Ed. 1913.)
Husserl, Edmund (1970). The Crisis of European Sciences and Transcendental
Phenomenology: An Introduction to Phenomenological Philosophy. Evanston, IL:
Northwestern University Press.
Huxley, Thomas Henry (2004). Evolution and Ethics and Other Essays. Whitefish, MT:
Kessinger Publishing. (Original Ed. 1894. London: Macmillan & Co.)
Huxley, Aldous (1954). The Doors of Perception. London: Chatto & Windus.
Huxley, Aldous (1956). Heaven and Hell. London: Chatto & Windus.
Huxley, Aldous (1961). The Perennial Philosophy. London: Fontana Collins.
Huxley, Aldous (1962). Island. New York, NY: Bantam.
Illich, Ivan (1971). Deschooling Society. New York, NY: Harper & Row. (French 1971.
Une société sans école. Paris: Éditions du Seuil.)
Iqbal, Afzal (1964). Life and Work of Rumi. Lahore, Pakistan: Institute of Islamic Culture.
Isaacs, Susan (1989). The Nature and Function of Phantasy: Developments in
Psychoanalysis. London: Karnac Books. (Original Ed. 1943.)
Jacob, Alexander (1993). Freud and Jung: The Social Implications of Psychological
Theory. Washington, DC: Scott-Townsend Publishers: Mankind Quarterly, Vol. 33, 0601-1993,
pp
379
et
seq.
Internet:
http://www.mugu.com/cgibin/Upstream/lssues/psvchology/Freud.html
Jacobson, Edith (1964). The Self and the Object World. New York, NY: International
Universities Press.
Jameson, Fredric (1991). Postmodernism, or the Cultural Logic of Late Capitalism.
Durham, NC: Duke University Press.
972
Janov, Arthur (1970). The Primal Scream: Primal Therapy—The Cure for Neurosis. New
York, NY: Putnam’s.
Janov, Arthur (1972a). The Primal Revolution: Toward a Real World. New York, NY:
Simon & Schuster.
Janov, Arthur (1972b). The Anatomy of Mental Illness: The Scientific Basis of Primal
Therapy. New York, NY: Putnam’s.
Janov, Arthur (1973a). The Nature of Consciousness. Journal of Primal Therapy,
1(1), 7-63.
Janov, Arthur (1973b). The feeling child. New York: Simon & Schuster.
Janov, Arthur (1974a). Further Implications of “Levels of Consciousness.” Journal of
Primal Therapy, 1(4), 313-352.
Janov, Arthur (1974b) The Nature of Pain and Its Relation to Levels of
Consciousness. Journal of Primal Therapy, 2(1), 5-50.
Janov, Arthur and Holden, E. M. (1975). Primal Man: The New Consciousness. New
York: Crowell.
Janov, Arthur (1983). Imprints: The Lifelong Effects of the Birth Experience. New
York: Coward-McCann.
Johnson, Belden (1991). A Primal Religion. Aesthema: The Journal of the International
Primal Association, No. 10 [February 1991], 51-58.
Jones, Ernest (1979). Vida y obra de Sigmund Freud. Buenos Aires: Ediciones Horme.
Josephy Jr., Alvin M. (1975). The Indian Heritage of America. London: Pelican.
Jung, Carl Gustav (1928). Psychological Commentary. In Padmasambhava according to
Karma Lingpa (1928). Tibetan Book of the Dead. (Kazi-Dawa Samdup, trans.; W. E.
Evans-Wentz, Ed.) London: Oxford University Press.
Jung, Carl Gustav (1954). Psychological Commentary. In Padmasambhava according to
Karma Lingpa (1954). The Tibetan Book of the Great Liberation or the Method of
Realizing Nirvana Through Knowing the Mind. London: Oxford University Press.
Jung, Carl Gustav (1964). Memories, Dreams, Reflections. New York, NY: Vintage.
Jung, Carl Gustav (1967a). The Philosophical Tree. In Collected Works of C. G. Jung, Vol.
13: Alchemical Studies. Princeton, NJ: Princeton University Press. (Original German
Ed. 1945.)
Jung, Carl Gustav (1967b). Symbols of Transformation. In Collected Works of C. G. Jung,
Vol. 5, Symbols of Transformation. Princeton, NJ: Princeton University Press. (Original
German Ed. 1912, Wandlungen und Symbole der Libido; original 2d revised Ed. 1952,
Symbole der Wandlung.)
Jung, Carl Gustav (1968). Man and His Symbols. New York, NY: Dell Pub.
Jung, Carl Gustav (1970a). Wotan. In Collected Works of C. G. Jung, Vol. 10: Civilization
in Transition (Ed. and trans. Gerhard Adler and R. F. C. Hull), p. 179-193. Princeton,
NJ: Princeton University Press. (Originally published in 1936 in the Neue Schweizer
Rundschau.)
Jung, Carl Gustav (1970b). The Undiscovered Self. In Collected Works of C. G. Jung, Vol.
10: Civilization in Transition (Ed. and trans. Gerhard Adler and R. F. C. Hull).
Princeton, NJ: Princeton University Press.
Jung, Carl Gustav (1972a). On the Psychology of the Unconscious. In Collected Works of
C. G. Jung, Vol. 7, Two Essays on Analytical Psychology. Ewing, NJ: Princeton
University Press. (Original German Ed. 1912.)
973
Jung, Carl Gustav (1972b). Mandala Symbolism (3 works) (Ed. Gerhard Adler; trans., R. F.
C. Hull). Princeton, NJ: Princeton University Press.
Jung, Carl Gustav (1975). Instinct and the Unconscious. In Collected Works of C. G. Jung,
Vol. 8 (2 volumes), The Structure and Dynamics of the Psyche. New York, NY:
Princeton University Press. (Original German Ed. 1919. Currently it is deemed more
appropriate to call this volume The Structure and Function of the Psyche.)
Jung, Carl Gustav (1977a). Psychology and Religion. In Collected Works of C. G. Jung,
Vol. 11, Psychology and Religion: West and East. Princeton, NJ: Princeton University
Press. (Original German Ed. 1938.)
Jung, Carl Gustav (1977b). Yoga and the West. In Collected Works of C. G. Jung, Vol. 11,
Psychology and Religion: West and East. Princeton, NJ: Princeton University Press.
(Original German Ed. 1936.)
Jung, Carl Gustav (1981). Psychological Aspects of the Mother Archetype. In Collected
Works of C. G. Jung, Vol. 9, Part 1, The Archetypes and The Collective Unconscious.
Princeton, NJ: Princeton University Press. (Original German Ed. 1939.)
Kalupahana, D. J. (1991). Mūlamadhyamakakārikā of Nāgārjuna: The philosophy of the
Middle Way (Introduction, Sanskrit text, English translation and annotation). Delhi:
Motilal Banarsidass. (Original publication 1986 by SUNY Press.)
Kant, Immanuel (1909). Critique of Practical Reason, and Other Works on the Theory of
Ethics (trans. Thomas Abbott). London / New York / Bombay: Longmans, Green, and
Co.
Kant, Immanuel (1922). Der einzig mögliche Beweisgrund zu einer Demonstration des
Daseins Gottes. Berlin : Ernst Cassirer.
Kant, Immanuel (1957). Perpetual Peace. New York, NY: Liberal Arts Press. (Original
German Ed. 1795. Another translation of Zum ewigen Frieden: Inevitable Peace,
translated by C. J. Friedrich.)
Kant, Immanuel (1966). Critique of Pure Reason. Garden City, NJ: Anchor Books.
(Reprint.) For the German original version of 1st and 2d Eds. (1781 and 1787,
respectively) cf. Kant, Immanuel, Raymund Schmidt Ed. (1956), and Kant, Immanuel,
Ingeborg Heidemann Ed. (1966).
Kant, Immanuel (2001). Critique of the Power of Judgment (trans. Eric Matthews). New
York, NY: Cambridge University Press.
Karma Phuntsho (2005). Mipham’s dialectics and the debates on emptiness: To be, not to
be or neither. New York, NY, & Milton Park, Abingdon, Oxfordshire, UK:
RoutledgeCurzon.
Karmay, Samten Gyeltsen (1988), The great perfection: A philosophical and meditative
teaching of Tibetan Buddhism. Leiden, NL: Brill Academic Publishers, Inc.
Kauffman, Walter A. (1968). Nietzsche: Philosopher, Psychologist, Antichrist. New York,
NY: Vintage. (Original Ed. of this English trans. 1950.)
Kelly, Sean (1998a). Revisioning the Mandala of Consciousness. In Rothberg, Donald &
Kelly, Sean (Eds.), Ken Wilber in Dialogue, pp. 117-130. Wheaton, IL: Quest Books.
Kelly, Sean (1998b). Breaks in the Chain. In Rothberg, Donald & Kelly, Sean (Eds.), Ken
Wilber in Dialogue, pp. 379-381. Wheaton, IL: Quest Books.
Kerényi, Karl (1998). Dionisios: Raíz de la vida indestructible. Barcelona, Spain: Herder.
(Original German Ed. 1994.)
974
Kierkegaard, Søren (1968). Fear and Trembling / The Sickness Unto Death (trans. W.
Lowrie). Princeton, NJ: Princeton University Press. (Original Eds. of this trans. 1944 /
1941.)
Kierkegaard, Søren (1970). The Concept of Dread (trans. W. Lowrie). Princeton, NJ:
Princeton University Press. (Original Ed. of this trans. 1944.)
King, Martin Luther (Clayborne Carson, Ed.) (1998). The Autobiography of Martin Luther
King, Jr. Boston, MA: Little, Brown and Company.
Kirk, Geoffrey Steven; Raven, John Earle & Schofield, M. (1970). Los filósofos
presocráticos. Historia crítica con selección de textos (The Pre-Socratic Philosophers).
Madrid: Editorial Gredos. (Original English Ed. 1966.)
Kirkland, Russell (undated). Person and Culture in the Taoist Tradition. Internet:
http://www.arches.uga.edu/~kirkland/rk/pdf/guides/PERSON.pdf
Kongtrül Lodrö Tayé, Jamgön (1995). Myriad Worlds: Buddhist Cosmology in
Abhidharma, Kalachakra and Dzogchen. Ithaca, NY: Snow Lion.
Koestler, Arthur (1967). The Ghost in the Machine. London: Hutchinson.
Koestler, Arthur and J.R. Smythies (1970). Beyond Reductionism. The Alpback Symposium
1968: New Perspectives in the Life Sciences. New York, MacMillan. Appendix with the
definition of the holon in internet at http://www.panarchy.org/koestler/holon.1969.html
Kolp, E; Young, M. S.; Friedman, H. Krupitsky, E.; Jansen, K. & O’Connor, L.-A. (2007).
Ketamine Enhanced Psychotherapy: Preliminary Clinical Observations on its
Effectiveness in Treating Death Anxiety. Internet: International Journal of
Transpersonal Studies, vol. 26, pp. 1-17.
Kongtrul Lodrö Tayé, Jamgong (1995). Myriad Worlds: Buddhist Cosmology in
Abhidharma, Kalacakra and Dzog-chen. Ithaca, NY: Snow Lion Publications.
Korzybski, Alfred (4th Ed. 5th printing 1973). Science and Sanity: An Introduction to NonAristotelian Systems and General Semantics. Lakeville, CT: International NonAristotelian Library Publishing Company. (Original Ed. 1933.)
Koyré, Alexandre (1973). Études d’histoire de la pensée scientifique. Paris: Gallimard.
Krippner, Stanley (1972). The Plateau Experience: A. H. Maslow and Others. San
Francisco, CA: Journal of Transpersonal Psychology, 1972, 4, 107-120.
Krippner, Stanley (2002). Dancing with the Trickster. Honolulu, HI: The International
Journal of Transpersonal Studies, 21, 2002, 1-18.
Kropotkin, Piotr Alekseyevich (1943). The Wage System. London: Freedom Press, ND.
Internet: http://www.myspot.org/kropotkin/wages.html
Kropotkin, Piotr Alekseyevich (1976). Mutual Aid: A Factor of Evolution. Boston, MA:
Porter Sargent Publications. (Original Russian Ed. 1902.)
Krystal, J., Karper, L., Seibyl, J., Freeman, G., Delaney, R., Bremner, J., Heninger, G.,
Bowers, M., & Charney, D. (1994). Subanesthetic effects of the noncompetitive
NMDA antagonist, ketamine, in humans: Psychotomimetic, perceptual, cognitive, and
neuroendocrine responses. Archives of General Psychiatry, 51, 199–214.
Kuhn, Thomas S. (1970). The Structure of Scientific Revolutions. Chicago, IL: University
of Chicago Press.
Lacan, Jacques (1975). Les Écrits techniques de Freud (1953-1954). Paris: Seuil.
Lacan, Jacques (1960). Remarque sur le rapport de Daniel Lagache: psychanalyse et
structure de la personalité. In Lacan, Jacques (1966). Écrits. Paris: Seuil.
Laclau, Ernesto & Mouffe, Chantal (2001). Hegemony and Socialist Strategy: Towards a
Radical Democratic Politics. London: Verso Books.
975
Laërtius, Diogenes (1959). Lives of Eminent Philosophers. Cambridge, MA: Harvard
University Press.
Laing, Ronald D. (1961). The Self and the Others. London: Tavistock. (Paperback 1969.
Self and Others. Harmondsworth, Middlesex, UK: Pelican.)
Laing, Ronald D. (1967). The Politics of Experience and the Bird of Paradise. London:
Penguin Books.
Laing, Ronald David & Esterson, Aaron (2nd. Ed. 1971). Sanity, Madness and the Family.
New York, N.Y.: Basic Books.
Laing, Ronald D. (1972). La politique de la famille (The Politics of the Family). Paris:
Stock. (Original Ed. 1969/1971.)
Laing, Ronald D. (1970). Knots. London: Tavistock. (Paperback 1971. Harmondsworth,
Middlesex, UK: Penguin.)
Laing, Adrian (1996). R. D. Laing: A Biography. New York, NY: Thunder’s Mouth Press.
Lama Govinda, Anagarika (1973). Foundations of Tibetan Mysticism. New York, NY:
Samuel Weiser Inc.
Lao-tzu (1994). Wen-tzu. Madrid: Edaf, Colección Arca de Sabiduría. (Spanish translation
of Lao-Tzu [1992]. Wen-Tzu: Understanding the Mysteries. Boston, MA: Shambhala.
English translation by Thomas S. Cleary.)
Lao-Tzu (1999). The Classic of the Way and Virtue: A New Translation of the Tao-Te
Ching of Laozi As Interpreted by Wang Bi. New York, NY: Columbia University Press.
Lao-tzu (1989). Te-Tao Ching (translation by Robert G. Henricks). New York, NY:
Ballantine Books.
Lao-zi (1996). El libro del Tao (Te-tao Ching, translation by J. I. Preciado Ydoeta). Buenos
Aires-Mexico: Alfaguara Bolsillo.
Laplanche, Jean & Pontalis, Jean-Bertrand (1967). Vocabulaire de la psychanalyse. Paris:
Presses Universitaires de France (PUF).
Laqueur, Walter (1996). Fascism: Past, Present, Future. New York, NY: Oxford
University Press.
Laszlo, Ervin (1974). A Strategy for the Future: The Systems Approach to World Order.
New York, NY: George Braziller.
Laszlo, Ervin (1987). Evolution: The Great Synthesis. Boston, MA: Shambhala.
Lavelle, Louis (1933). La conscience de soi. Paris: Bernard Grasset.
Lavelle, Louis (1951). The Meaning of Holiness. London: Catholic Book Club.
Lavelle, Louis (1992). La présence totale. Paris: Aubier-Flammarion. (Original French Ed.
1934.)
Lavelle, Louis (1993). The Dilemma of Narcissus. Burdett, NY): Larson Publications /
Biblio distribution.
Lawlor, Robert (1991). Voices of the First Day. Rochester, VT: Inner Traditions.
Leary, Timothy; Metzner, Ralph, & Alpert, Richard (1964). The Psychedelic Experience: A
Manual Based on the Tibetan Book of the Dead. New Hyde Park, NY: University
Books.
Lee, Martin (1997). The Beast Reawakens. Boston, MA: Little, Brown.
Leibniz, Gottfried Wilhelm (1992). Monadology. London: Routledge.
Lemert, Edwin M. (1962). Paranoia and the Dynamics of Exclusion. New York, NY:
Sociometry, Vol. 25, No. 1 (Mar., 1962), pp. 220-231.
976
Lenormant, François (2003). The Beginnings of History. LaVergne, TN / Milton Keynes,
UK: Lightning Source Inc. (1st. English Ed. 1882/1883. New York, NY: Charles
Scribner’s Sons VG.)
Lenin (Ulianov), Vadimir Illich (1972), Materialism and Empirio-Criticism. Peking:
Foreign Language Press.
Lenski, Gerhard; Lenski, Jean, & Nolan, Patrick (1978). Human Societies: An Introduction
to Macrosociology. New York, NY: McGraw-Hill. (1st Ed. 1970.)
LeShan, Lawrence (1982). The Medium, the Mystic, and the Physicist: Toward a
General Theory of the Paranormal. New York, NY: Ballantine Publishing Group.
Levin, David Michael (1985). The Body’s Recollection of Being: Phenomenological
Psychology and the Deconstruction of Nihilism. Boston, MA: Routledge & Kegan Paul.
Levin, David Michael (1993a). Introduction. In Levine, David Michael (1985). Modernity
and the Hegemony of Vision, pp. 1-29. Berkeley, CA: University of California Press.
Levin, David Michael (1993b). Decline and Fall: Ocularcentrism in Heidegger’s Reading
of the History of Metaphysics. In Levine, David Michael (1985). Modernity and the
Hegemony of Vision, pp. 186-217. Berkeley, CA: University of California Press.
Lévy-Bruhl, Lucien (1965). The ‘Soul’ of the Primitive. London: Unwin University Books.
Lichtenberg, Georg Christoph (1995). Aforismos (Aphorismen, nach den Handschriften).
(Aphorisms.) Mexico: Fondo de Cultura Económica. (Original German Ed. 1902/1908;
1st Spanish Ed. 1989.)
Lichtenberg, Joseph D. (1979). Factors in the Developmen of the Sense of the Object.
Journal of the American Psychoanalytic Association 27:375-386. Reference in
Washburn (1995).
Lichtenberg, Joseph D. (1981). Implications for Psychoanalytic Theory of Research on the
Neonate. International Review of Psycho-Analysis 8:35-52. Reference in Washburn
(1995).
Lichtenberg, Joseph D. (1983). Psychoanalysis and Infant Research. Hillsdale, N.J.:
Analytic Press. Reference in Washburn (1995).
Lichtenberg, Joseph D. (1987). Infant Study and Clinical Work with Adults.
Psychoanalytic Inquiry 7:311-330.
Lilly, John C. (1972). The Center of the Cyclone: An Autobiography of Inner Space. New
York, NY: The Julian Press.
Lilly, John C. (1978). The Scientist: A Novel Autobiography. New York, NY:
Bantam Books/J. B. Lippincott. (now: Ronin Publishing)
Lilly, John C. (1987). Programming and Metaprogramming of the Human Biocomputer.
Theory and Experiments. New York, NY: Three Rivers Press.
Lings, Martin (2002). The Eleventh Hour: The Spiritual Crisis of the Modern World in the
Light of Tradition and Prophecy. Kansas City, KA: Midpoint Trade Books.
Lipman, Kennard (1983/1986). Translator’s Introduction. In Mañjushrimitra (Trans.
Kennard Lipman, Namkhai Norbu & Barry Simmons: English 1983/1986). Primordial
Experience: An Introduction to rDzogs-chen Meditation. Boston, MA: Shambhala.
Liscano, Juan (1993). La tentación del caos. Caracas: Alfadil Ediciones.
Lizot, Jacques (1992). El círculo de los fuegos. Caracas: Monte Ávila Editores. (Original
French Ed. [1976]. Le cercle des feux: Faits et dits des indiens yanômami. Paris: Seuil.
English [1985]. Tales of the Yanomami: Daily Life in the Venezuelan Forest.
977
Cambridge / New York / New Rochelle / Melbourne / Sydney: Cambridge University
Press.)
Lizot, Jacques (1985). Les Yanómami centraux. Paris: École des Hautes Études en Sciences
Sociales (EHESS).
Liu I-Ming (1988), Awakening to the Tao (trans. Thomas Cleary). Boston, MA:
Shambhala.
Lochouarn, Martine (1993). De quoi mouraient les hommes primitifs (Causes of Death
among Primitive Men). Paris: Sciences et Avenir, No. 553, March 1993, 44-7.
Lommel, Andreas (undated). El arte prehistórico y primitivo (Prehistoric and Primitive
Art). In El mundo del Arte—Las artes plásticas de sus orígenes a la actualidad (The
World of Art: Plastic Arts from their Origin to the Present Time), Vol. I. Brazil (no
mention of town): Aggs Industrias Gráficas S. A.
Longchenpa (Longchen Rabjam; translated & annotated by Herbert V. Guenther) (1975a).
Kindly Bent to Ease Us: The Trilogy of Finding Comfort and Ease: Part One: Mind
(trans. Herbert V. Guenther). Berkeley, CA: Dharma Publishing.
Longchenpa (1975b). The natural freedom of mind (trans. H. V. Guenther.). Emmeryville,
CA: Crystal Mirror, vol. 4, pp. 113-146. French version (verses and commentary) in
Cornu, Philippe (1994). La liberté naturelle de l’esprit, pp. p. 205-238. Paris: Seuil
(Points/Saggeses).
Longchenpa (Longchen Rabjam; translated & annotated by Herbert V. Guenther) (1976).
Kindly Bent to Ease Us: The Trilogy of Finding Comfort and Ease: Part Three:
Wonderment. Emeryville, CA: Dharma Publishing.
Longchen Rabjam (1998). The Precious Treasury of the Way of Abiding. Junction City,
CA: Padma Publishing.
Longchen Rabjam (2001a). The Precious Treasury of the Basic Space of Phenomena.
Junction City, CA: Padma Publishing.
Longchen Rabjam (2001b). A Treasure Trove of Scriptural Transmission: A Commentary
on The Precious Treasury of the Basic Space of Phenomena. Junction City, CA: Padma
Publishing.
Lothane, Zvi (1992). In Defense of Schreber: Soul Murder and Psychiatry. Hillsdale,
NJ: The Analytic Press.
Löwith, Karl (1988). Ma vie en Allemagne avant et après 1933. Paris: Hachette.
Löwith, Karl; Kenjirõ Yoshioka & Giancarlo Vianello (1995). La scuola di Kyôto (The
Kyoto School). Soveria Mannelli / Messina, Italy: Rubbettino Editore.
Loy, David (1987). The Clôture of Deconstruction: A Mahayana Critique of Derrida.
Indian Philosophical Quarterly # 27, No. 1, March 1987, 59-80. Also Internet:
http://ccbs.ntu.edu.tw/FULLTEXT/JR-AN/33315.htm
Luhmann, Niklas & Habermas, Jürgen (1971). Theorie der Gesellschaft oder
Sozialtechnologie—was leistet die Systemforschung? Frankfurt, Germany: Suhkramp
Verlag.
Luhmann, Niklas (1982). The Differentiation of Society. New York, NY: Columbia
University Press.
Luhmann, Niklas (1990). Sociedad y sistema: La ambición de la teoría. Barcelona, Spain:
Ediciones Paidós/I.C.E. de la Universidad Autónoma de Barcelona. (Original German
Ed. 1984.)
978
Luhmann, Niklas (1990). Operational Closure and Structural Coupling. The Differentiation
of the Legal System. Paper read at the Oñati Institute (Oñati, Euskadi, Spain) in the
summer of 1990, reproduced in photocopy.
Luk, Charles (1966). The Surangama Sutra: Chinese Rendering by Master Paramith of
Central North India At Chih Chih Monastery, Canton, China, A. D. 705. London: Rider
& Company.
Luk, Charles (1972). The Vimalakirti Nirdesa Sutra. Berkeley, CA: Shambhala
Publications.
Lutzenberger, José A. (1978,). Manifiesto ecológico ¿fin del futuro? (trans. Arturo Eichler
& A. J. Uzcátegui-Bruguera). Mérida, Venezuela: Universidad de Los Andes. (Original
Portuguese Ed. 1976.)
Lyotard, Jean-François (1979). La condition postmoderne. Paris: Éditions de Minuit.
(English 1984. The Postmodern Condition: A Report on Knowledge [trans. Geoff
Bennington & Brian Massumi]. Minneapolis, MI: University of Minnesota Press.)
(Spanish 1994. La condición postmoderna. Madrid: Tecnos.)
Magesa, Laurenti (1997). African Religion: The Moral Traditions of Abundant Life.
Maryknoll, NY: Orbis Books.
Magliola, Robert (1984). Derrida on the Mend. West Lafayette, IN: Purdue University
Press.
Mandel, Ernest (1962). Traité d’économie marxiste (2 vol.). Paris: Julliard.
Marcovich, Miroslav (1967). Heraclitus: Greek Text with a Short Commentary. Mérida,
Venezuela: The Los Andes University Press.
Marcuse, Herbert (1964). One Dimensional Man. Boston, MA: Beacon Press.
Marcuse, Herbert (1966). Le vieillissement de la psychanalyse. Trans. Paris: Maspero:
Partisans, N 32-33 (Sexualité et répression I), Oct.-Nov. 1966. Original publication
1963.
Marcuse, Herbert (1972). Counter-Revolution and Revolt. Boston, MA: Beacon Press.
Maruyama, Magoroh (1963). The Second Cybernetics. Durham, NC: American Scientist,
vol. 51, pp. 164-179.
Marx,
Karl
(undated).
Theses
on
Feuerbach.
In
http://www.geocities.com/archasbr/feuerbach.html (Source: MECW Volume 5, p. 3,
and [undated] http://eserver.org/marx/1845-feuerbach.theses.txt.
Marx, Karl & Engels, Friedrich (1970). The Communist Manifesto. New York, NY:
Washington Square Press. (Reprint.)
Maslow, Abraham (1962). Toward a Psychology of Being. Princeton, NJ: D. Van Nostrand
Company.
Maslow, Abraham (1970). Religions, Values and Peak-Experiences. New York, NY:
Viking. (Original Ed. without Preface, 1964.)
Maslow, Abraham (1971). The Farthest Reaches of Human Nature. New York, NY:
Viking.
Maslow, Abraham (1979). The Journals of Abraham Maslow (2 vols., R. J. Lowry, Ed.).
Monterey, CA: Brooks / Cole.
Masquelier, Gonzague (2003). Sartre, une muse pour Perls? Paris: Revue Gestalt, No 24
(2003/1) (Racines, greffes et marcottages), pp. 31-44.
Maturana, Humberto R. & Varela, Francisco (1987). The Tree of Knowledge: The
Biological Roots of Human Understanding. Boulder, CO & London: Shambhala
Publications, New Science Library (Original Spanish Ed. 1984).
979
Maturana, Humberto R. (1985). Biologie der Sozialität. Siegen, Stuttgart, Germany: Delfin,
5,
Sept.
1985.
Internet:
http://www.ecovisiones.cl/metavisiones/Pensadores/MaturanaBiologíasocial.htm
Max-Neef, Manfred A. (1992). From the Outside Looking in: Experiences in Barefoot
Economics. London: Zed Books, Palgrave Macmillan. (Original Ed. 1982.)
May, Reinhard (1996). Heidegger’s Hidden Sources. East Asian Influences on his Work.
London: Routledge. (Original German Ed. 1989.)
May, Rollo (1977). The Meaning of Anxiety. New York, NY: W W Norton & Co Inc.
(Original Ed. 1950)
May, Rollo (1953). Man’s Search for Himself. New York, NY: W W Norton & Co Inc..
May, Rollo (Ed.) (1960). Existential Psychology. New York, NY: Random House.
May, Rollo (1969). Love and Will. New York, NY: W. W. Norton & Company, Inc.
May, Rollo (1975). The Courage to Create. New York, NY: W.W. Norton & Company,
Inc.
May, Rollo (1980). Psychology and the Human Dilemma. New York, NY: W W Norton &
Co Ltd. (Original Ed. 1967.)
May, Rollo (1983). The Discovery of Being: Writings in Existential Psychology. New York,
NY: W W Norton & Co Inc.
May, Rollo (1991). The Cry for Myth. New York, NY: W. W. Norton & Co., Inc.
May, Rollo (1999). Anger, Madness and the Daimonic. Albany, NY: SUNY Press.
Mayr, Ernst (1961). Cause and effect in biology. Washington, DC: Science 134:3489
(Nov.10) 1501-1506.
Mayr, Ernst (1974). Teleological and teleonomic: A new analysis. In Cohen, Robert S. &
Wartofsky, Marx W. (Eds.) (1974). Methodological and historical essays in the natural
and social sciences. Boston Studies in the Philosophy of Science, vol. XIV, 91117, pp.
91-117. Dordrecht, Netherlands / Boston, MA: D. Reidel Publishing Company.
Mayz-Vallenilla, Ernesto (1990). Fundamentos de la meta-técnica. Caracas: Monte Avila
Editores/IDEA.
McEviley, Thomas (1982). Pyhrrhonism and Madhyamika. Honolulu, HI: University of
Hawai‘i Press, Philosophy East and West, Vol. 32, 1982, 3-35.
McKenna, Dennis J. (1998). Ayahuasca: An Ethnopharmacologic History. Internet:
http://leda.lycaeum.org/?ID=16806
McKenna, Terence (1990). Among Ayahuasquera. In Rätsch, Christian (1990). Gateway to
Inner Space: Sacred Plants, Mysticism and Psychotherapy, pp.179-211. Garden City
Park, NY: Unity.
McLeod, Lee (1993), The Self in Gestalt Therapy Theory. Bristol, UK: British Gestalt
Journal, Vol 2, No 1, pp. 25-40.
McTaggart Ellis McTaggart, John (1999-2000). Studies in the Hegelian Dialectic.
Kitchener,
Ontario,
Canada:
Batoche
Books
(Internet:
http://cupid.econ.unimelb.edu.au/het/hegel/l014.pdf). (Original Ed. 1986. Cambridge,
UK: Cambridge University Press. US Ed. 1964, New York, NY: Russell & Russell.)
McTaggart Ellis McTaggart, John (2000). Studies in Hegelian Cosmology. 1918,. 2000,
Kitchener,
Ontario,
Canada:
Batoche
Books
(Internet:
http://cupid.econ.unimelb.edu.au/het/hegel/1013.pdf). (Original Ed. 1918. Cambridge,
UK: Cambridge University Press)
McTaggart Ellis McTaggart, John (1931). A Commentary on Hegel’s Logic. Cambridge,
UK: Cambridge University Press.
980
Merleau-Ponty, Maurice (2002). The Incarnate Subject: Malebranche, Biran, and Bergson
on the Union of Body and Soul. Amherst, NY: Prometheus Books, 2002.
Michael, Don (1986). Discussion. In Anderson, Walter Truett; Ernest Callenbach; Fritjof
Capra, & Charlene Spretnak, Eds., (1986), Critical Questions About New Paradigm
Thinking. Washington, DC: ReVISION Journal, 9(1), summer / fall 1986, section Is this
Notion of a Paradigm and of Paradigm Shifts Appropriate to Describe Social Change?
Dialogue on World Resources and Global Peace.
Michelet, Jules (1987). La bruja. Una biografía de mil años basada en los procesos
judiciales de la Inquisición. (The Witch: A Biography of One Thousand Years Founded
on the Judiciary Proceedings of the Inquisition). Barcelona, Spain: Akal. (Original
French Ed. 1862. Paris: Hetzel.)
Mokshakaragupta (1985). Bauddha Tarkabhasha of Mokshakargupta. Edited and translated
by N. N. Singh. Varanasi, UP, India: Asha Prakashan.
Moore-Lappé, Frances (1971). Diet for a Small Planet. New York, NY: Ballantine and
Friends of the Earth.
Moore-Lappé, Frances & Joseph Collins (1977a). Food First: Beyond the Myth of Scarcity.
New York, NY: Houghton Mifflin.
Moore-Lappé, Frances & Joseph Collins (1977b). Still Hungry after all these Years. San
Francisco, CA: Mother Jones Magazine, August 1977.
Moore Lappé, Frances; Joseph Collins, & Peter Rosset with Luis Esparza (1998). World
Hunger: 12 Myths. London, UK: Earthscan Publications Ltd.
Moore, Marcia & Alltounian, Howard Sunny (1978). Journeys Into the Bright World.
Rockport, MA: Para Research Inc.
Morgan, Lewis Henry (1972). League of the Iroquois. Secaucus, NJ: The Citadel Press.
Morin, Edgar (1981). Pour sortir du vingtième siècle. Paris: Fernand Nathan.
Mounier, Emmanuel (1966). Introduction Aux Existentialismes. Paris: Gallimard - Idées #
14. (Original Ed. 1947.)
Mourgue, Gérard (1993). Sri Aurobindo et Teilhard de Chardin. Paris: Bucher/Chastel.
Moustakas, Clark E. (Ed.) (1956). The Self: Explorations in Personal Growth. (Essays by
Carl Jung, Kurt Goldstein, Erich Fromm, Gordon Allport, Otto Rank, Abraham
Maslow, Carl Rogers, Jean-Paul Sartre and others.) New York, NY: Harper & Row.
Moustakas, Clark E. (1961). Loneliness. New Jersey, NJ: Prentice-Hall.
Mumford, Lewis (1967/1970). Myth of the Machine (two volumes: Pentagon of Power /
Technics and Human Development). New York, NY: Harcourt Brace Jovanovich, Inc.
Münster, Arno (2002). Heidegger, la science allemande et le national-socialisme. Paris:
Kimé.
Mure, Geoffrey Reginald Gilchrist (1965). The Philosophy of Hegel. Oxford, UK: Oxford
University Press, Home University Library series.
Nagarjuna and Seventh Dalai Lama (1977). La guirnalda preciosa y el cántico de las
cuatro reflexiones. Mexico: Diana. (Original English 1975 by George Allen & Unwin.)
Nagarjuna & Seventh Dalai Lama (1975), The Precious Garland of Advise to the King and
The Song of the Four Mindfulnesses. London: George Allen & Unwin.
Namkhai Norbu (1984a). Talks in Conway, USA, July 1982 & January 1983 (The Green
Book) (Ed., Jim Valby; Trans, B. Simmons). Conway, MA: Jim Valby.
Namkhai Norbu (1984b). Dzogchen and Zen. Oakland, Ca.: Zhang Zhung Editions.
Namkhai Norbu (1988). Un’introduzione allo Dzog-chen. Risposte a sedici domande.
Arcidosso, GR, Italy: Shang Shung Edizioni.
981
Namkhai Norbu (1996). Drung, deu e bön. Le narrazioni, i linguaggi simbolici e il Bön
nell’ antico Tibet. Arcidosso, GR, Italy: Shang-Shung Edizioni.
Namkhai Norbu (1997a). La collana di zi. Arcidosso, GR, Italy: Shang Shung Edizioni.
Namkhai Norbu (1997b). Lhundrub Gar 1996 Teachings (uncorrected transcription in
photocopy). Caracas: Venezuelan Dzogchen Community (internal circulation only).
Namkhai Norbu (1999). The Crystal and the Way of Light: Sutra, Tantra and Dzogchen.
Revised Edition: Ithaca, NY: Snow Lion. (Original Ed. 1986.)
Namkhai Norbu & Clemente, Adriano (1999). The Supreme Source: The Fundamental
Tantra of the Dzogchen Semde. Ithaca, NY: Snow Lion. (Original Italian Ed., 1997.)
Namkhai Norbu (1999/2001). The Precious Vase: Instructions on the Base of Santi Maha
Sangha. Arcidosso, GR, Italy: Shang-Shung Edizioni.
Namkhai Norbu (2000). The Crystal and the Way of Light: Sutra, Tantra and Dzogchen.
Ithaca, NY: Snow Lion. (2d revised Ed. of the book of the same name published in
1986 in London by Routledge & Kegan Paul.)
Namkhai Norbu (2004). The Necklace of Zi: On the History and Culture of Tibet.
Arcidosso, GR, Italy: Shang Shung Edizioni. (There is an older English edition
published by the Library of Tibetan Works and Archives in Dharamsala, India. The
present edition is a translation into English of the Italian version of 1997 carried out by
Barrie Simmons with thanks to Nancy Simmons.)
Namkhai Norbu (unpublished ms.). La vía de autoliberación y nuestra total plenitud y
perfección. (E. Capriles, Ed.)
Napper, Elizabeth (2003). Dependent-Arising and Emptiness: A Tibetan Buddhist
Interpretation of Madhyamika Philosophy Emphasizing the Compatibility of Emptiness
and Conventional Phenomena. Boston, MA: Wisdom Publications.
Needleman, Jacob (1963). The Symbol in Psychoanalysis and Daseinsanalyse. In
Binswanger, Ludwig (1963). (Trans. J. Needleman) Being-in-the-World: Selected
papers of Ludwig Binswanger, pp. 59-83. New York, NY: Basic Books.
Neske, G. (Ed.) (1977) Erinnerung an Martin Heidegger. Pfullingen: Neske Verlag.
Nettlau, Max (trans. Johnson, Scott) (1979). Anarchy Through the Times. New York, NY:
Gordon Press.
Newton, Isaac (2005). The Third Book of Opticks. In the worldwide web at the URL
http://www.newtonproject.ic.ac.uk/texts/viewtext.php?id=NATP00039&mode=normali
zed (Original work published in 1704.)
Nietzsche, Friedrich Wilhelm (1920). The Antichrist (Translated from the German with an
Introduction By H. L. Mencken). New York: Knopf. (Original German Ed. 1888.)
Nietzsche, Friedrich Wilhelm (1968). The Will To Power (trans. Walter Kaufman & R. J.
Hollingdale). New York, NY: Vintage.
Nietzsche, Friedrich Wilhelm (1974). The Case of Wagner (trans. Anthony M. Ludovici &
J. M Kennedy,). Croydon, Surrey, UK: Gordon Press. (Original German Ed. 1888.)
Nietzsche, Friedrich Wilhelm (1967). Ecce Homo (How One Becomes What One Is) (trans.
Walter Kaufmann. New York, NY: Vintage. (Original German Ed. 1888.)
Nietzsche, Friedrich Wilhelm (1983). Untimely Meditations (trans. R. J. Hollingdale).
West Nyack, NY: Cambridge University Press. Also (undated 4). Internet:
http://www.geocities.com/thenietzschechannel/um.htm.
Nietzsche, Friedrich Wilhelm (1986). Human, All Too Human. West Nyak, NY:
Cambridge University Press.
982
Nietzsche, Friedrich Wilhelm (1988). The Birth of Tragedy. New York, NY: Doubleday
Anchor. (Original German Ed. 1871.)
Nietzsche, Friedrich Wilhelm (1997a). Twilight of the Idols Or, How to Philosophize With
a Hammer. Oxford, UK: Hackett Publishing Company Inc. (Original German Ed.
1888.)
Nietzsche, Friedrich Wilhelm (1997b). Daybreak: Thoughts on the Prejudices of Morality,
trans. R.J. Hollingdale, ed. M. Clark & B. Leiter. Cambridge: Cambridge University
Press.
Nietzsche, Friedrich Wilhelm (1997c). Beyond Good and Evil: Prelude to a Philosophy of
the Future. Mineola, NY: Dover Publications. (Original German Ed. 1886.)
Nietzsche, Friedrich Wilhelm (1997d). Twilight of the Idols. Indianapolis, IN: Hackett
Publishing. (Original German Ed. 1889.)
Nietzsche, Friedrich Wilhelm (1999). On The Genealogy of Morals: A Polemic By Way of
Clarification and Supplement to My Last Book Beyond Good and Evil. Cary, NC:
Oxford University Press. (Original German Ed. 1887.)
Nietzsche, Friedrich Wilhelm (undated 1). On Truth and Lie in a Nonmoral Sense. Internet:
http://www.publicappeal.org/library/nietzsche/Nietzsche_various/on_truth_and_lies.ht
m (Also in Nietzsche, Friedrich [1979]. Philosophy and Truth: Selections from
Nietzsche’s Notebooks of the Early 1870’s [Nachgelassene Schriften] [Ed. and trans. by
Daniel Breazeale.]. Section: On Truth and Lies in an Extra-Moral Sense. Brighton,
Sussex, UK: Harvester Press.) (Original German Ed. 1873.)
Nietzsche, Friedrich Wilhelm (undated 2). Thus Spoke Zarathustra (Paul Douglas
adaptation
of
the
Thomas
Common
trans.).
Internet:
http://www.luminary.us/nz/zarathustra.html. (Original German Ed. 1891.) (French Ed.
1947/1971. Ainsi parlait Zarathoustra [Maurice Betz, trans. Maurice Betz, trans.].
Paris: Le Livre de Poche NRF., this French Ed.)
Nietzsche, Friedrich Wilhelm (undated 3). On the Uses and Disadvantages of History for
Life (Ian C. Johnston, trans., partly amended by The Nietzsche Channel). Internet:
http://www.geocities.com/thenietzschechannel/history.htm. (Also in [1997]. Untimely
Meditations [Ed. Daniel Breazeale, trans. R. J. Hollingdale)]. West Nyack, NY:
Cambridge University Press.)
Noll, Richard (1997). The Jung Cult. New York, NY: The Free Press Paperbacks.
Oakeshott, Michael (1991). Experience and Its Modes. West Nyack, New York, U.S.A.:
Cambridge University Press.
Obermiller, E. (1999). [Butön’s] History of Buddhism in India and Tibet. New Delhi: Paljor
Publications.
O’Brien, Barbara (1958). Operators and Things: The Inner Life of a Schizophrenic.
Cambridge, MA: Arlington Books.
O’Callaghan, Michael (1993/2001). Interview with John Perry. In the worldwide web at the
URL http://www.global-vision.org/interview/perry.html#self
Offe, Claus (1985). New Social Movements: Challenging the Boundaries of Institutional
Politics. Bielefeld, Germany: University of Bielefeld, Department of Sociology.
Ohashi, R. (1986). Zur Philosophie der Kyoto-Schule. In Zeitschrift für philosophische
Forschung (40), 1986, 121-134.
Ohashi, R. Die Frühe Heidegger-Rezeption in Japan. In Buchner, Hartmut (Ed. 1989).
Japan und Heidegger, pp. 23-37. Sigmaringen (Germany): Thorbecke Verlag.
983
Opalek, Joanne C. (1962). The Experience of Being in the Philosophy of Louis Lavelle.
Shelby, OH: Pontificia Universitas Gregoriana.
Padmasambhava according to Karma Lingpa (1928). Tibetan Book of the Dead. (KaziDawa Sangdup, trans.; W. E. Evans-Wentz, Ed.). London: Oxford University Press.
Padmasambhava according to Karma Lingpa (1938). Das Tibetanische Totenbuch (Aus der
englischen Fassung des Lama Kazi Dawa Samdup Hrsg. von W. Y. Evans-Wentz.
Übers. und eingeleitet von Louise Göpfert-March. Mit einem psychologischen
Kommentar von C. G. Jung). Zürich, Switzerland & Leipzig, Germany: Rascher
Verlag.
Padmasambhava according to Karma Lingpa (1954). The Tibetan Book of the Great
Liberation or the Method of Realizing Nirvana Through Knowing the Mind (Rigpa
ngotö cherthong rangdröl [Rig pa ngo sprod gcer mthong rang grol). Preceded by an
Epitome of Padma-Sambhava’s Biography and Followed by Guru Phadampa Sangye’s
Teachings. (Translation by Sardar Bahadur S.W. Laden, La, C.B.E., F.R.G.S. and by
the Lamas Karma Sumdhon Paul, Lobzang Dorje, and Kazi Dawa-Samdup; edited and
annotated by W. E. Evans-Wentz) London: Oxford University Press.
Padmasambhava (1977). La leggenda del grande stupa e la biografia del guru nato dal loto
(1st text according to Lhanwang Gyaksor Lodrö / Ngakchang Sakya Zangpo; 2d text
according to Örgyen Chogyur Lingpa). Roma: Ubaldini Editore. (Original English Ed.
1973. The Legend of the Great Stupa. Berkeley, CA: Dharma Publishing. New English
Ed. 1997. Legends of the Great Stupa: Two Treasure Texts of the Nyingma Tradition.
Berkeley, CA: Dharma Publishing.)
Padmasambhava according to Karma Lingpa (1989). Self-Liberation Through Seeing With
Naked Awareness (Rigpa ngotö cherthong rangdröl [Rig pa ngo sprod gcer mthong
rang grol]): Being an Introduction to the Nature of One’s Own Mind from The
Profound Teaching of Self-Liberation in the Primordial State of the Peaceful and
Wrathful Deities. A Terma Text of Guru Padmasambhava Expounding the View of
Dzogchen, Rediscovered by Rigdzin Karma Lingpa (translation by John M. Reynolds).
Barrytown, NY: Station Hill Press.
Pandey, Kanti Chandra (1963). Abhinavagupta: An Historical and Philosophical Study.
Varanasi (India): Chowkhamba Sanskrit Series Office.
Pániker, Salvador (1992). Filosofia y mística. Una lectura de los griegos (Philosophy and
Mysticism: A Reading of the Greeks). Barcelona, Spain: Editorial Anagrama.
Parkes, Graham (1997). The putative fascism of the Kyoto School and the political
correctness of the modern academy. Philosophy East & West 47:3 (July 1,1997).
Honolulu: University of Hawaii Press,.
Parsons, William Barclay (1999). The Enigma of the Oceanic Feeling: Revisioning the
Psychoanalytic Theory of Mysticism. New York, NY: Oxford University Press US.
Pascal, Blaise (1962). Pensées. Paris: Le Livre de Poche. (Posthumous edition, 1669.)
Parmenides (1984). Parmenides of Elea: Fragments: A Text and Translation with an
Introduction (Intr. by David Gallop). Toronto, Ontario, Canada: University of Toronto
Press.
Perls, Fritz; Hefferline, Ralph & Goodman, Paul (1951). Gestalt Therapy. New York, NY:
Dell Publishing Co. Inc.
Perls, Fritz S. (1976). The Gestalt Approach & Eye Witness to Therapy. New York, NY:
Bantam Books. (First published 1973.)
Perls, Fritz S. (1969). Gestalt Therapy Verbatim. Moab, UT: Real People Press.
984
Perrot E. and Hamet, R. (1927) Le yagé, plante sensorielle des Colombie. Comptes
Rendues de l’Academie Scientifique 184:1266.
Perry, John Weir (1953). The Self In Psychotic Process: Its Symbolization in Schizophrenia
(with an introduction by C. G. Jung). Los Angeles, CA: University of California Press.
Perry, John Weir (1974). The Far Side of Madness. Englewood Cliffs, NJ: Prentice Hall.
Perry, John Weir (1987). The Heart of History: Individuality in Evolution. Albany, NY:
SUNY (State University of New York) Press.
Perry, John Weir (1999). Trials of the Visionary Mind: Spiritual Emergency and the
Renewal Process. Albany, NY: SUNY (State University of New York) Press.
Perry, Ralph Barton (1948) The Thought and Character of William James, Briefer version.
Cambridge, MA: Harvard University Press. (Abridged version of Perry, Ralph Barton
[1936]. The Thought and Character of William James, 2 vol.)Piaget, Jean & Inhelder,
Bärbel (1956). The Psychology of the Child. London: Routledge & Kegan Paul.
Pettit, J. W. (1999). Mipham’s Beacon of Certainty: Illuminating the View of Dzogchen The
Great Perfection. Boston, MA: Wisdom Books.
Pittendrigh, C. (1958). Adaptation, natural selection and behavior. In Roe, Anne &
Simpson, George Gaylord (1958). Behavior and Evolution. New Haven, CT: Yale
University Press.
Plato (1949). Meno. Indianapolis, IN: The Bobbs-Merril Company, Inc.
Plato (1957). Statesman. New York, NY: Bobbs Merrill.
Plato (1973). Gorgias. Harmondsworth, Middlesex, UK: Penguin.
Plato (1975/1988). Hippias Major. Salem, New Hampshire: Ayer Co.
Plato (1979). The Republic. Harmondsworth, Middlesex, UK: Penguin Books.
Plato (1980). Phaedo. Indianapolis, IN: Hackett Publishing Company, Inc.
Plato (1992). The Republic. (G.M.A. Grube, trans.; revised by C.D.C. Reeve.) Indianapolis:
Hackett.
Plato (1993). Sophist. Indianapolis, IN: Hackett Pub Co Inc.
Plato (1995), Symposium. Rutherford, NJ: Penguin USA.
Plato (1998). Cratylus. Indianapolis, IN: Hackett Pub Co Inc.
Plotinus (1966, trans. Armstrong). Ennead I; Porphyry on Plotinus. Cambridge, MA:
Harvard / Loeb Classical Library.
Plotinus (1983). Plotinus Ennead III. Cambridge, MA: Harvard University Press.
Pois, Robert (Ed. 1970). Race and History and other essays by Alfred Rosenberg edited
and introduced by Robert Pois. New York, NY: Harper & Row.
Popkin, Richard H. (1979). The History of Skepticism from Erasmus to Spinoza. Berkeley,
CA: University of California Press.
Popper, Karl R. (1950-1951). Indeterminism in Quantum Physics and in Classical Physics,
I and II. Oxford, UK: British Journal for the Philosophy of Science, Vol. I, 117-133 and
173-195.
Popper, Karl R. (1961). The Logic of Scientific Discovery. New York, NY: Science
Editions, Inc. (Original Ed. 1959.)
Porterfield, Kay Marie (2002). Ten Lies about Indigenous Science—How to Talk Back. In
http://www.kporterfield.com.aicttw/articles/lies.html. (The facts discussed here are also
in Keoke, Emory Dean & Porterfield, Kay Marie [2003]. Encyclopedia of American
Indian Contributions to the World. 15,000 Years of Inventions and Innovations. New
York, NY: Facts on File.)
985
Pribram, Karl H. & Gill, Merton (1976). Freud’s Project Re-assessed. New York, NY:
Basic Books.
Price, Henry Habberley (2d. Ed. 1969). Thinking and Experience. London: Hutchinson
University Library.
Prigogine, I1ya & Stengers, Isabelle (1984). Order Out of Chaos. Boulder, CO and
London: Shambhala Publications (New Science Library).
Radford-Ruether, Rosemary (1992). Gaia & God: An Ecofeminíst Theology of Earth
Healing. New York, NY: Harper San Francisco.
Rajneesh, Acharya Shree (1971/1974). The Mysteries of Life and Death. Delhi: Motilal
Banarsidass.
Rajneesh, Acharya (2000). My Awakening. Published in the worlwide web at the URL
http://www.realization.org/page/doc0/doc0015.htm
Rank, Otto (1973). The Trauma of Birth. New York, NY and London: Harper and Row
(English and German). (First English Ed. 1929.)
Rank, Otto (1958). Beyond Psychology. New York, NY: Dover Publications. (First
published 1941.)
Rätsch, Christian (1990). Gateway to Inner Space: Sacred Plants, Mysticism and
Psychotherapy. Garden City Park, NY: Unity.
Ravignant, Patrick (1978). Los maestros espirituales contemporáneos (The Spiritual
Masters of our Time). Barcelona, Spain: Plaza y Janés. (Original French Ed. 1972.)
Rees, Philip (1991). Biographical Dictionary of the Extreme Right since 1890. New York,
NY: Simon & Schuster.
Reich, Wilhelm (1968). The Function of the Orgasm. Sex-economic Problems of Biological
Energy (Vol. I of The Discovery of the Orgone). London: Panther.
Reich, Wilhelm (1969). Character Analysis. New York, NY: Farrar, Straus & Giroux. (1st
English Ed. 1945; 3d, enl. ed. [including, beside Charakteranalyse and Psychischer
Kontakt und vegetative Strömung, the articles The expressive language of the living in
orgone therapy, and The schizophrenic split] 1949: New York Orgone Institute Press.)
Reid, Daniel (2002/2003). Practice Makes Perfect: Common Grounds in the Practice Paths
of Chuan Chen Tao and Dzogchen Dharma. Conway, Mass, The Mirror # 63,
December 2002/January 2003, pp. 26-7.
Reynolds, John Myrdhin (1989). The Nagas—Ancient Bönpo Teachings and the Nagas.
Arcidosso, GR, Italy: Rivista Meri Gar / Meri Gar Review.
Reynolds, John Myrdhin (1996). The Golden Letters. Ithaca, NY: Snow Lion Publications.
Ricard, Mathieu & Thuan, Trinh Xuan (2004). The Quantum and the Lotus: A Journey to
the Frontiers where Science and Buddhism Meet. New York, NY: Random House Inc.
Riedlinger, Thomas J. (1986). Washington, DC: ReVISION Journal, 9(1), Summer/Fall
1986.) (Original Ed. 1982. Sartre’s Rite de Passage. San Francisco, CA: The Journal of
Transpersonal Psychology, 14, 105-123.)
Riegel, Klaus (1973). Dialectical Operations: The Final Period of Cognitive Development.
In Human Development, 16:346-370.
Richie, Donald (1982). Zen Inklings: Some Stories, Fables, Parables and Sermons. New
York, NY and Tokyo: Weatherhill.
Rivier, L. & Lindgren, J.-E. (1972) “Ayahuasca,” the South American hallucinogenic
drink: an ethnobotanical and chemical investigation. Economic Botany, 26: 101-129.
Robinson, Joan (1962). Economic Philosophy. Harmondsworth, Middlesex, UK: Pelican
Books.
986
Rodrigué, Emilio (1996). El siglo del psicoanálisis. Buenos Aires: Editorial Sudamericana.
Rodríguez Bornaextea, Fernando (1999). Prólogo a la edición castellana. En Washburn,
Michael (1999). Psicología transpersonal en una perspectiva psicoanalítica, pp. 13-22.
Barcelona, España: Libros de la Liebre de Marzo.
Rodríguez, Darío (1987). Elementos para una comparación de las teorías de Maturana y
Luhmann. Santiago de Chile: Estudios sociales (CPU), N° 54, 4th trimester 1987.
Rockhill, William Woodville (1997). Land of the Lamas. New Delhi: Asian Educational
Services.
Rodrigué, Emilio (1996). El siglo del psicoanálisis. Buenos Aires: Editorial Sudamericana.
Rogers, Carl R. (1942). Counseling and Psychotherapy: Newer Concepts in Practice.
Cambridge, MA: Houghton Mifflin.
Rogers, Carl R. (1965). Client-Centered Therapy. Boston, MA: Houghton Mifflin.
Rogers, Carl R. (1967). Person to Person: The Problem of Being Human. Lafayette, CA:
Real People Press.
Rogers, Carl & Kinget, Mariam (1971). Psicoterapia y relaciones humanas (2 vol.).
Madrid: Alfaguara.
Rogers, Carl & Rosenberg, C. (1981). La persona como centro. Barcelona: Herder.
Rogers, Philip A. M.; White, S. S. & Ottaway, C. W. (1977). Stimulation of Acupuncture
Points re. Analgesia & Therapy of Clinical Disorders in Animals. Vet. Annual, 17, p.
258 et seq.
Rogers, Philip A. M. & Bossy, J. (1981). Activation of the Defense Systems in Animals
and Man by Acupuncture and Moxibustion. Taiwan: Acup. Res. Quarterly, 5, 47 et seq.
Rogers, Philip A. M. (1993). A Brief History of Acupuncture and the Status of Veterinary
Acupuncture
Outside
Mainland
China
(Part
1).
Internet:
http://users.med.auth.gr/~karanik/english/vet/histor1.htm. (Original Ed. 1988.)
Rogers, Philip A. M. (1991). Acupuncture for Immune Mediated Disorders. In: Sidney:
Acupuncture in Animals, Proceedings 167, 124-142. Postgraduate Committee in
Veterinary Science, University of Sydney.
Rogers, Philip A. M. (1996). Acupuncture in Small Animal Practice, Part 3. Internet:
http://users.med.auth.gr/~karanik/english/vet/dogcut3.htm. (Original Ed. undated,
updated 1991, 1993.)
Rohde, Teresa (Ed.) (1999). La India literaria. Mahabarata. Bagavad Gita. Los Vedas.
Leyes de Manú. Poesía. Teatro. Cuentos. Apólogos y leyendas. México: Editorial
Porrúa.
Roszak, Theodore (1992). The Voice of the Earth. New York, NY: Touchstone.
Rothberg, Donald (1998a). Ken Wilber and the Future of Transpersonal Inquiry. In Donald
Rothberg & Sean Kelly (Eds.), Ken Wilber in Dialogue, pp. 1-27. Wheaton, IL: Quest
Books.
Rothberg, Donald (1998b). How Straight Is the Spiritual Path? Conversations with Three
Buddhist Teachers. In Donald Rothberg & Sean Kelly (Eds.), Ken Wilber in Dialogue,
pp. 133-178. Wheaton, IL: Quest Books.
Roudinesco, Élisabeth & Plon, Michel (1997). Dictionnaire de la Psychanalyse. Paris:
Fayard.
Rudgley, Richard (1993). The Alchemy of Culture. London: British Museum Press.
Rudgley, Richard (1998). Lost Civilizations of the Stone Age. London: Century. (US Ed.
1999: New York, NY: Simon & Schuster.)
987
Rudgley, Richard (2000). Secrets of the Stone Age: A Prehistoric Journey. London:
Random House.
Rudhyar, Dane (1983). Rhythm of Wholeness. Wheaton, Ill.: Theosophical Publishing
House.
Ruegg, David Seyfort (1981). The Literature of the Madhyamaka School of Philosophy in
India. Wiesbaden, Germany: Harrassowitz.
Ruitenbeek, Hendrik M. (Ed.) (1972). Going Crazy: The Radical Therapy of R. D. Laing
and Others. New York, NY: Bantam.
Rumi, Jalal-ud-din (1983). Masnavi: versos espirituales (Mathnavi: Spiritual Verses). (2
Vol.) (Translation into Spanish by A. H. D. Halka, from the English translation by
Omar Ali-Shah.) Buenos Aires: Ediciones Dervish International.
Russell, Bertrand & Whitehead, Alfred North (1910-1913) Principia Mathematica (3 vol.).
Cambridge, UK: Cambridge University Press.
Sahlins, Marshall (1961). Evolution and Culture. Ann Arbor, MI: The University of
Michigan.
Sahlins, Marshall (1972). Social Stratification in Polynesia. Seattle, WA: University Of
Washington Press.
Sahlins, Marshall (1974). Stone Age Economics. London: Tavistock Publications.
Sahlins, Marshall (1976). Culture and Practical Reason. Chicago, IL: University of
Chicago Press.
Samuels, Andrew (1989). Foreword to Jung, Carl Gustav [1989]. Essays on Contemporary
Events: The Psychology of Nazism. Princeton, UP: Princeton University Press.
Sanz-Ferramola, Ramón (2001). El imperativo categórico de Kant en Freud (Kant’s
Categorical Imperative in Freud). San Luis, Argentina: Universidad Nacional de San
Luis, Fundamentos en Humanidades, II:1 (2001:3) pp. 167-188. Also in Internet at the
URL: http://dialnet.unirioja.es/servlet/oaiart?codigo=1280138
Sartre, Jean-Paul (1950). L’imagination. Paris: Presses Universitaires de France. (Original
Ed. 1936.)
Sartre, Jean-Paul (1965). La transcendence de l’Égo. Paris: Sylvia Le Bon. (Original Ed.
1936-1937.)
Sartre, Jean-Paul (1939). Esquisse d’une théorie des émotions. Paris: Hermann & Cie.
Sartre, Jean-Paul (1940). L’Imaginaire. Psychologie phénoménologique de l’imagination.
Paris: NRF Librairie Gallimard.
Sartre, Jean-Paul (1980). L’être et le néant. Essai d’ontologie phénoménologique (Being
and Nothingness: An Essay on Phenomenological Ontology). Paris: NRF Librairie
Gallimard. (Original Ed. 1943; the 1980 Ed. is the 31st edition.)
Sartre, Jean-Paul (1982). El existencialismo es un humanismo (Existentialism is a
Humanism). In Sartre, J. P. & Heidegger, M. (1982), El existencialismo es un
humanismo y Carta sobre el humanismo (Existentialism is a Humanism and Letter on
Humanism). Buenos Aires: Ediciones del 80. (Original French Ed. 1946.)
Sartre, Jean-Paul (1947). Huis Clos Suivi De Les Mouches. Paris: Gallimard.
Sartre, Jean-Paul (1964). Saint Genet: Comedien et martyr. Paris: Gallimard. (Original Ed.
1952.)
Sartre, Jean Paul (1973). Preface to Laing, R. D. & Cooper, D. (1973). Razón y violencia:
Una década de pensamiento sartreano (Reason and Violence). Buenos Aires: Paidós
Estudio.
988
Satprem (1973). Shri Aurobindo et l’avenir de la Terre / Shri Aurobindo and the Earth’s
Future. Pondichery, India: Shri Aurobindo Ashram.
Savater, Fernando (1985). Pierre Clastres. In Clastres, Pierre (1985). La economía de la
abundancia en la sociedad indivisa. Supplement to Aletheya magazine, N° 6 (Buenos
Aires: Ediciones Antropos); Mexico: reproduced as a supplement to libertarian
coordination magazine Testimonios, N° 4, October 1987.
Saviani, Carlo (2004). El Oriente de Heidegger (Raquel Bouso García, trans.). Barcelona,
Spain: Herder. (Original Italian Ed. 1998. L’Oriente di Heidegger. Genova, Italy: Il
nuovo melangolo, s.r.l.)
Schatzman, Morton (1973). Soul Murder: Persecution in the Family. New York, NY:
Random House, Inc.
Schiller, Friedrich J. C. (1985). Sobre la gracia y la dignidad (über Anmut und Würde).
Barcelona, España: Icaria. Latest English translation in Curran, Jane V, and Fricker,
Christophe (2005). Schiller's “On Grace and Dignity” in Its Cultural Context: Essays
and a New Translation. Columbia, SC: Camden House.
Schopenhauer, Arthur (1965). On the Basis of Morality. Indianapolis, IN: The BobbsMerrill Co. (Original German Ed. 1841.)
Schopenhauer, Arthur (1969). The World As Will and Representation. Mineola, N.Y. Dover
Publications.
Schumacher, E. Fritz (1973). Small is Beautiful. A Study of Economics as if People
Mattered. London: Blond & Briggs.
Schuon, Frithjof (1984). Light in the Ancient Worlds. Bloomington, IN: Natl Book
Network / World Wisdom Books.
Schweitzer, Albert (1957). Indian Thought and Its Development. Boston, MA and London:
Beacon Press. (Originally published in 1935; English 1936.)
Scotton, Bruce W.; Chinen, Allan B., and Battista, John R. (Eds.) (1996). Textbook of
Transpersonal Psychiatry and Psychology. New York, NY: Basic Books.
Sedgwick, Peter (1982). Psycho Politics. Laing, Foucault, Goffman, Szasz and the Future
of Mass Psychiatry. Nueva York: Harper & Row.
Sellers, Jonathan (1997-2003). The Pure Brethen of Basra: Isma'ili, Yezidi, Sufi. Internet:
http://www.antiqillum.com/texts/bg/Qadosh/qadosh034.htm
Senent, Juan; Saint Marc, Philippe & others (1973). La contaminación. Barcelona, Spain:
Salvat, Biblioteca Salvat de Grandes Temas.
Shah, Idries (1975). Los sufíes (The Sufis) (Pilar Giralt Gorina, trans.). Barcelona, Spain:
Luis de Caralt Editor, S. A. (Original English Ed. 1964.)
Shah, Idries (1970). The Way of the Sufi. New York, NY: Dutton.
Shantideva (1960), Bodhicharyavatara of Shantideva with the commentary Pañjika by
Prajñakaramati. Edited by P. L. Vaidya. Darbhanga, Bihar, India: Mithila Institute.
Tibetan version: Prajñakaramati (undated), Bodhicharyavatarapañjika. In Cone mDo
’grel vol. 26, folio 39a ff. Derge vol. 36, La 82 ff.
Shantideva (1996). The Bodhicharyavatara (Kate Crosby & Andrew Skilton, trans.).
Oxford, UK / New York, NY: Oxford University Press.
Shapiro, Sam 1. (1986). The Neglect of Asian Psychology in the United States. Kyoto,
Japan: Psychologia, 1986, 29, 10-17.
Shapiro, Sam I. & Castillo, Richard J. (1986/1987). Directions in the Development of
Transpersonal Psychology. Wollongong, NSW, Australia: Australian Journal of
Transpersonal Studies, 6(2), 91-99.
989
Sheehan, Thomas (1981). Myth and Violence: The Fascism of Julius Evola and Alain de
Benoist. Social Research, Vol. 48, Spring 1981, 45-73.
Shekdrake, Rupert (1991). The Rebirth of Nature. London: Rider.
Shen, Tsung-lien (1973). Tibet and the Tibetans. New York, NY: Octagon Books. (Original
Ed. 1953.)
Sindima, Harvey J. (1990). Community of Life: Ecological Theology in African
Perspective. In Birch, Eakin & McDaniel (Eds.), Liberating Life: Contemporary
Approaches to Ecological Theology, 137-147. Maryknoll, NY: Orbis Books.
Siraj Ed-din, Abu Bakr [Martin Lings] (1974). The Book of Certainty. New York, NY:
Samuel Weiser. (Original Ed. 1970.)
Smith, Huston (1986/88). Preface to Kapleau Roshi, P. (1986/88). Los tres pilares del zen:
Enseñanza, práctica, iluminación (The Three Pillars of Zen). Mexico City: Árbol
Editorial S.A. de C.V. (Original English Ed. 1985.)
Sokal, Alan & Bricmont, Jean (1999). Imposturas intelectuales (Intellectual Impostures).
Barcelona, Spain: Paidós. (Original Ed. 1988.)
Sorel, Georges (2a ed. 1922). Introduction à l'économie moderne. París: Marcel Rivière. En
http://pages.infinit.net/sociojmt (1a edición: 1903).
Sorel, Georges (1906). Le système historique de Renan. París: G. Jacques.
Sorel, Georges (1908). Les illusions du progrès. París: Marcel Rivière.
Smith, Huston (1976). Forgotten Truth. New York, NY: Harper & Row.
Sprung, Mervin (1979). Lucid Exposition of the Middle Way. London: Routledge & Kegan
Paul.
Stafford, Peter (1978/1983/1992). Psychedelics Encyclopedia: Third Expanded Edition.
Berkeley, CA: Ronin Publishing, Inc.
Stein, Joel (2003). Just Say Om (Scientists study it. Doctors recommend it. Millions of
Americans—many of whom don’t even own crystals—practice it every day. Why?
Because meditation works). Time Magazine, Sunday, July 27, 2003.
Stern, Daniel (1985). The Interpersonal World of the Infant. New York, NY: Basic Books.
Reference in Washburn (1995).
Sullivan, Harry Stack (1953). The Interpersonal Theory of Psychiatry. New York, NY:
W.W. Norton.
Sullivan, Harry Stack (1962). Schizophrenia as a Human Process. New York, NY: W.W.
Norton.
Sullivan, Harry Stack (1968). La fusion de la psiquiatría y las ciencias sociales (The
Fusion of Psychiatry and Social Sciences). Buenos Aires: Editorial Psique. (Original
English Ed. 1964.)
Suzuki, Daisetz Teitaro (1900). Acvaghosha’s Discourse on the Awakening of Faith in the
Mahayana. Chicago, IL: Open Court Publishing Company.
Suzuki, D. T. (1956), The Lankavatara Sutra. London, Routledge & Kegan Paul. (Original
Edition 1932.)
Suzuki, Daisetz Teitaro (1972). Essais sur le Bouddhisme Zen. Première série (Essays on
Zen Buddhism. First Series). Paris: Albin Michel. (1st French Ed. 1940/1943.)
Suzuki, Daisetz Teitaro (1972). Essais sur le Bouddhisme Zen. Deuxième série (Essays on
Zen Buddhism. Second Series). Paris: Albin Michel. (1st French Ed. 1940/1943.)
Suzuki, Daisetz Teitaro (1970.). Le non-mental selon la pensée Zen (The Zen Doctrine of
No-Mind) (Hubert Benoît, trans.). Paris: Le courrier du livre.
990
Suzuki, Shunryu Daiosho (Ed. Trudy Dixon, 1980). Zen Mind, Beginner’s Mind: Informal
Talks on Zen Meditation and Practice. New York, NY, and Tokyo: Weatherhill.
Tannen, Deborah (1990). You Just Don't Understand: Men and Women in Conversation.
New York, NY: Ballantine.
Tarthang Tulku (1977a). Time, Space and Knowledge: A New Vision of Reality.
Emeryville, CA: Dharma Publishing.
Tarthang Tulku (1977b). The Vajrayana Lineages in Tibet. In Crystal Mirror, Vol. 5, 165307. Emeryville, CA, Dharma Press.
Taylor, Steve (2003). Primal Spirituality and the Onto/Philo Fallacy: A Critique of the
Claim that Primal Peoples Were/Are Less Spiritually and Socially Developed than
Modern Humans. San Francisco, CA: Saybrook Graduate School and Research Center,
International Journal of Transpersonal Studies, Vol. 22, 61-76.
Taylor, Steve (2005). The Fall: The Evidence for a Golden Age, 6,000 Years of Insanity,
and the Dawning of a New Era. Winchester, UK / New York, NY: The Bothy, John
Hunt Publishing LTD., O Books.
Teilhard de Chardin, Pierre (1974). El fenómeno humano (trans. Crusafont Pairó). Madrid:
Taurus. (Original French Ed. 1955.)
The Ecologist Editing Team (1971). A Blueprint for Survival. Expanded version in book
form: Harmondsworth, Middlesex, UK: Pelican Books.
Thinley Norbu (1985). The Small Golden Key (to the Treasure of the Various Essential
Necessities of General and Extraordinary Buddhist Dharma) (Trans. L. Anderson).
New York, NY: Jewel Publications. (Original English Ed. 1977.)
Thinle Norbu Rinpoche (1997), Welcoming Flowers from across the Cleansed Threshold of
Hope: An Answer to the Pope’s Criticism of Buddhism. New York, Jewel Publishing
House.
Thogme Zangpo (1975). The Thirty-Seven Practices of all Buddhas’ Sons (rGyal sras log
len so bdun ma). Dharamsala, HP, India: Library of Tibetan Works and Archives.
(Original English Ed. English 1973.)
Thoreau, Henry David (1970). The Annotated Walden (Walden; or, Life in the Woods;
Together with Civil Disobedience...) (Ed. by Philip Van Doren Stern). New York, NY:
Barnes & Noble.
Thurman, Robert A. F. (1987). The Holy Teaching of Vimalakirti: A Mahayana Scripture.
University Park, Pennsylvania, U.S.A.: Pennsylvania State University Press. Internet:
http://www2.fodian.net/old/English/0475.html
Trungpa, Chögyam (1972). Mudra. Berkeley, CA: Shambhala Publications.
Trungpa, Chögyam (1973). Cutting Through Spiritual Materialism. Boulder, CO and
London: Shambhala Publications.
Trungpa, Chögyam (1975). Commentary. In Trungpa, C. & Fremantle, F. (1975). The
Tibetan Book of the Dead. Berkeley, CA and London: Shambhala Publications.
Trungpa, Chogyam (1976). The Myth of Freedom and the Way of Meditation. Berkeley:
Shambhala, 1976
Trungpa, Chögyam (1984). Shambhala: The Sacred Path of the Warrior. Boulder, CO:
Shambhala Publications.
Tsong-kha-pa, Je (1974). Ocean of Reasoning: A Commentary on Nagarjuna’s
Fundamental Treatise on the Middle Way, proving the emptiness of going and coming
(trans. Jeffrey Hopkins). Dharamsala (India): Library of Tibetan Works and Archives.
991
Tucci, Giuseppe (1980). The religions of Tibet. London: Routledge & Kegan Paul.
(Original German Ed. 1970.)
Tulku Thöndup (1984). The Tantric Tradition of the Nyingmapa. Marion, MA:
Buddhayana.
Tulku Thöndup (1996). The Practice of Dzogchen (Harold Talbott, Ed.). Ithaca, NY: Snow
Lion Publications. (First edition 1989, under the title Buddha Mind.)
Turnbull, Colin (1993/1994). The Forest People. London: Pimlico.
Tweedie, Irina (1979). The Chasm of Fire. A Woman’s Experience of Liberation through
the Teachings of a Sufi Master. The Old Brewery, Tisbury, Wiltshire, UK: Element
Books.
Under the Direction of Brice Parain (1972). Historia de la Filosofía Siglo XXI Editores:
Del mundo romano al islam medieval. Mexico City: Siglo XXI Editores. (Original
French Ed. 1969.)
Under the Direction of Yvon Belaval (1981). Historia de la Filosofía Siglo XXI Editores:
La filosofía en Oriente. Mexico City: Siglo XXI Editores. (Original French Ed. 1974.)
Urgyen Tulku (2005). Blazing Splendor: The Memoirs of Tulku Urgyen Rinpoche.
Boudhanath (Kathmandu Valley, Nepal), Hong Kong (China) and Esby (Østjylland,
Danmark): Rangjung Yeshe.
Vals, José Luis (1995). Diccionario freudiano. Buenos Aires: Julián Yebenes S.A.
van der Dennen, Johan M. G. (1995). The Origin of War: The Evolution of a MaleCoalitional Reproductive Strategy. Groningen, NL: Origin Press.
van der Post, Laurens (1976). Jung and the Story of Our Time. Westminster, MR: Random
House Inc.
Vásquez, Eduardo (2005). Excerpt from Karl Löwith’s Ma vie en Allemagne avant et après
1933. Mérida, Venezuela: Dikaiosyne (Journal of Grupo Logos—Filosofía, Derecho y
Sociedad, Faculty of Legal and Political Sciences, University of The Andes), 14, 2005.
Vattimo, Gianni (1995). Más allá de la interpretación. Barcelona, Spain / Buenos Aires /
Mexico City: Ediciones Paidós and I.C.E. of the Barcelona Autonomous University.
(Original Italian Ed. 1994.)
Vattimo, Gianni (1986). The End of (Hi)story. Chicago Review 30(4): 20-30.
Vattimo, Gianni (1988). The End of Modernity: Nihilism and Hermeneutics in Post-modern
Culture (trans. John R. Snyder). Cambridge: Polity Press.
Veith, Gene Edward (1993). Modern Fascism. St. Louis, MI: Concordia Publishing House.
Velasco G., Fabiola C. (2003). Algunos aspectos del pensamiento de Elías Capriles (Some
Aspects of Elías Capriles’ Thought). Mérida, Venezuela: Dikaiosyne (Journal of Grupo
Logos—Filosofía, Derecho y Sociedad, Faculty of Legal and Political Sciences,
University of The Andes), No. 11, December 2003.
Ventaka Ramanan, K. (1966). Nagarjuna’s Philosophy. Rutland, VT: Charles E. Tuttle, for
the Harvard-Yenching Institute.
Vich, Miles A. (1990). The Origins and Growth of Transpersonal Psychology. Thousand
Oaks, CA: Journal of Humanistic Psychology, vol. 30, Nº 2, pp. 47-50.
Vlastos, Gregory (1968). Zeno. In Kauffinan, Walter (Ed.), Philosophic Classics, 27 et seq.
New York, Prentice Hall. (Original Ed. 1961.)
von Foerster, Heinz (1985). Interview published in Généalogies de l’auto-organisation.
Paris: Cahiers du C.R.E.A., N° 8.
Waddington, Conrad Hal (1957). The Strategy of the Genes. A Discussion of Some Aspects
of Theoretical Biology. London: George Allen and Unwin.
992
Wallia, C. J. S (undated). Postmodernism and Deconstruction: Is Everything Maya? Book
review of Mohanty, Satya P. (1997). Literary Theory and the Claims of History:
Postmodernism, Objectivity, Multicultural Politics. Ithaca, NY: Cornell University
Press.
Published
in
IndiaStar
Review
of
Books;
Internet:
http://www.indiastar.com/wallia14.htm.
Walsh, Catherine (2004). Geopolíticas del conocimiento, interculturalidad y
descolonización. Quito: Boletín ICCI-ARY Rimay, 60(6), March 2004 (Published by
Instituto Científico de Culturas Indígenas). Paper presented at the inauguration of the
house of the Instituto Científico de Culturas Indígenas, in the event titled Geopolíticas
del Conocimiento y la Descolonización de las Ciencias (February 18, 2004).
Walsh, Roger (2003). Entheogens: True or False? San Francisco, The International Journal
of Transpersonal Studies, vol. 22, 1-6.
Ware, James R. (1981), Alchemy, Medicine and Religion in the China of A.D. 320: The Nei
P'ien of Ko Hung (Pao-p'u tzu). New York, Dover Publications.
Washburn, Michael (1990). Two Patterns of Transcendence. Journal of Humanistic
Psychology, 30(3), 84-112.
Washburn, Michael (1994). Transpersonal Psychology in Psychoanalytic Perspective.
Albany, NY: State University of New York (SUNY) Press.
Washburn, Michael (1995). The Ego and the Dynamic Ground (2d Ed.). Albany, NY: State
University of New York Press. Spanish Ed. (1966). El ego y el fundamento dinámico.
Barcelona, Spain: Kairós.
Washburn, Michael (1998). The Pre/Trans Fallacy Reconsidered. In Rothberg, Donald &
Kelly, Sean (Eds.), Ken Wilber in Dialogue, pp. 64-83. Wheaton, IL: Quest Books.
Wasserman, James (2001). The Templars and the Assassins: The Militia of Heaven.
Rochester, VT: Inner Traditions International.
Wasson, R. Gordon; Sabina, Maria; Cowan, George And Florence; Rhodes, Willard
(1974). María Sabina and Her Mazatec Mushroom Velada (Ethno-Mycological Studies
No. 3). New York, N.Y.: Harcourt Brace Jovanovich.
Watson, Burton (Trans.) (1968). Complete Works of Chuang Tzu. New York, NY:
Columbia University Press.
Watts, Alan W. (1956). The way of Zen. New York, NY: Pantheon Books.
Watts, Alan W. (1959). The Wisdom of Insecurity. New York, NY: Pantheon Books.
Watts, Alan W. (1969). The Book: On the Taboo Against Knowing Who or What You Are.
New York, NY: Collier Books.
Watts, Alan W. (1962). The Joyous Cosmology. New York, NY: Pantheon Books.
Watts, Alan W. (1973). Cloud-Hidden, Whereabouts Unknown: A Mountain Journal. New
York, NY: Pantheon Books. (Spanish 1980), Memorias: Autobiografia 1915-1965.
Barcelona, Spain: Kairós.
Watts, Alan W. (1975a). Psychotherapy East and West. New York, NY: Vintage Books.
Watts, Alan (1975b), Tao—The Watercourse Way (written in 1973, with the collaboration
of Al Chung-Liang Huang). New York, Pantheon Books.
Wayman, Alex (1973), The Buddhist Tantras: New Light on Indo-Tibetan Esotericism.
London: Routledge & Kegan Paul.
Wayman, Alex (1979). Calming the Mind and Discerning the Real: Buddhist Meditation
and the Middle View (From the Lam rim chen mo of Tsong-kha pa). Delhi: Motilal
Banarsidass Pub. Pvt. Ltd. (Original Ed. 1978.)
Wayman, Alex (1980), Yoga of the Guhyasamajatantra. Delhi: Motilal Banarsidass.
993
Weber, Renée (1982a). The enfolding-unfolding universe: A conversation with David
Bohm. In Wilber, Ken (Ed.) (1982). The Holographic Paradigm and Other Paradoxes:
Exploring the Leading Edge of Science. Boulder: Shambhala.
Weber, Renée (1982b). The Physicist and the Mystic: Is a Dialogue between them
Possible? A conversation with David Bohm. In Wilber, Ken, (Ed.) (1982). The
Holographic Paradigm and Other Paradoxes: Exploring the Leading Edge of Science.
Boulder: Shambhala.
Weisskopf, Walter (1971). Alienation and Economics. New York, NY: Dutton.
Whyte, Lancelot Law (1962). The Unconscious Before Freud. Garden City, NY:
Doubleday Anchor.
Wikipedia (Cleanup from January 2006). Rajneesh. In the worldwide web at the URL
http://en.wikipedia.org/wiki/Rajneesh (consulted on Sept. 20, 2006).
Wilber, Ken (1980). The Atman Project: A Transpersonal View of Human Development.
Wheatom, Ill.: Quest Books.
Wilber, Ken (1981). Up from Eden. Wheaton, IL: Quest Books. (Spanish 1995),
Después del Edén. Barcelona, Spain: Kairós.
Wilber, Ken (1982). Physics, Mysticism and the New Holographic Paradigm: A
critical appraisal. In Wilber, Ken (Ed.) (1982). The Holographic Paradigm and
Other Paradoxes: Exploring the leading edge of science. Boulder, CO and London:
Shambhala.
Wilber, Ken (Ed.) (1982). The Holographic Paradigm and Other Paradoxes. Boulder,
CO and London: Shambhala Publications.
Wilber, Ken (Ed.) (1984). Quantum Questions: Mystical Writings of the World’s Great
Physicists. Boulder, CO and London: Shambhala Publications.
Wilber, Ken (1990). Structure, Stage and Self. In Wilber, Ken (1990). Eye to Eye: The
Quest for the New Paradigm. Boston, MA: Shambhala. (Revised Ed.; original Ed.
pub. 1983.)
Wilber, Ken (1993a). The Spectrum of Consciousness. Wheaton, IL / Madras, India /
London: Quest Books: The Theosophical Publishing House. (Original Ed. 1977.)
Wilber, Ken (1993b). The Pre/Trans Fallacy. In Walsh, Roger & Vaughan, Frances
(Eds.), Paths Beyond Ego. Los Angeles, CA: Tarcher.
Wilber, Ken (1993c). Psicología integral (Integral Psychology). Barcelona, Spain:
Kairós. (Original English Ed. 1986.)
Wilber, Ken; Engler, Jack & Brown, Daniel P. (1986). Transformations in
Consciousness. Boston, MA & London: Shambhala.
Wilber, Ken (1990). Two Patterns of Transcendence: A Reply to Washburn. Journal
of Humanistic Psychology, 30(3), 113-136.
Wilber, Ken (1995). Sex, Ecology, Spirituality. Boston, MA & London: Shambhala.
Wilber, Ken (1996a). Brief History of Everything. Boston, MA & London: Shambhala.
Wilber, Ken (1996b). A More Integral Approach: A Response to the ReVISION
Authors. Re VISION: A Journal of Consciousness and Transformation, 19(2), 1034).
Wilber, Ken (1997). The Eye of Spirit. Boston & London: Shambhala.
Wilber, Ken (1998). A More Integral Approach. In Donald Rothberg & Sean Kelly (Eds.),
Ken Wilber in Dialogue, pp. 306-367. Wheaton, IL: Quest Books.
Wilber, Ken (1999a). Introduction. In The Collected Works, Vol. 2. Boston, MA &
London: Shambhala.
994
Wilber, Ken (1999b). The Marriage of Sense and Soul. New York, NY: Broadway
Books.
Wilber, Ken (1996c). Eye to Eye. 3d. Ed. Boston: Shambhala.
Wilber, Ken (1996d). Up from Eden (revised Ed.). Boston: Shambhala.
Wilber, Ken (2000a). Integral Psychology. Boston, MA & London: Shambhala.
Wilber, Ken (2000b). One Taste. Boston & London: Shambhala.
Wilber, Ken (2000c). Introduction. In Wilber, Ken (2000). The Collected Works of Ken
Wilber, Volume 8 (The Marriage of Sense and Soul, Same Taste). Boston, MA &
London: Shambhala.
Wilber, Ken (2000). Introduction. In Wilber, Ken (2000). The Collected Works of Ken
Wilber, Volume 8 (The Marriage of Sense and Soul, Same Taste). Boston, MA &
London: Shambhala.Wilden, Anthony (1980). System and Structure. London:
Tavistock. (1st Ed. 1972.)
Wilhelm, Richard (1962). The Secret of the Golden Flower: A Chinese Book of Life. New
York, N.Y.: Harvest/HBJ Books.
Williams, Paul (1998). The Reflexive Nature of Awareness: A Tibetan Madhyamaka
Defense. Richmond, Surrey, UK: Curzon Press.
Winnincott, Donald Woods (1974). Play and Reality. Harmondsworth, Middlesex, UK:
Pelican Books (a division of Penguin Books).
Wisser, Richard (Ed.) (1970). Martin Heidegger im Gespräch. Freiburg: Karl Aler (also in
Gesamtausgabe 16).
Witteveen, H. Johannes (1997). Universal Sufism. Shaftesbury, Dorset (England, UK) /
Rockport, Mass.: Element Books Ltd.
Wittgenstein, Ludwig (1968). Philosophical Investigations (3d ed.). New York, NY:
Macmillan.
Wong-Mou-Lam (trans. 1969). The Sutra of Hui Neng. In Price, A. F. & Wong Mou-Lam,
The Diamond Sutra and The Sutra of Hui Neng. Boston, MA: Shambhala Publications.
Wright, Ronald (1992). Stolen Continents. Boston, MA: Houghton Mifflin.
Wulf, Rosemarie (1996). The Historical Roots of Gestalt Therapy Theory. Christchurch,
Aotearoa, New Zealand: Gestalt Dialogue: Newsletter of the Integrative Gestalt Centre,
November, 1996. In Internet at the URL http://www.gestalt.org/wulf.htm
Yoka Daishi /Taisen Deshimaru (1981). Canto del inmediato satori (Song of Immediate
Satori). Barcelona, Spain: Visión Libros. (Yoka Daishi is Yung-chia Hsüan-chüeh.)
Zimmerman, Michael E. (1998). A Transpersonal Diagnosis of the Ecological Crisis. In
Rothberg, Donald & Kelly, Sean (Eds.), Ken Wilber in Dialogue, pp. 180-206.
Wheaton, IL: Quest Books.
Žižek, Slavoj (Ed.) (1994). Mapping Ideology. London: Verso.
Žižek, Slavoj (1999). The Ticklish Subject: The Absent Centre of Political Ontology.
London / New York: Verso.
Zolla, Elémire (1994). Lo stupore infantile. Milan, Italy: Adelphi Edizioni S.P.A.
Zolla, Elémire (1998). Che cos’è la tradizione. Milan, Italy: Adelphi Edizioni S.P.A.
Zukav, Gary (1979), The Dancing Wu Li Masters. An Overview of the New Physics. New
York, NY: William Morrow and Company, Inc.
FOR THE BIBLIOGRAPHY ON
995
HEIDEGGER AND EASTERN THOUGHT
(FROM SAVIANI, CARLO, 1998, SPANISH 2004)
SEE VOLUME I OF THIS BOOK
996
1
As will the shown below in the regular text, Antonio Gramsci wrote: “In reality science is also a
superstructure, an ideology.” (Cited in an e-article by Gustavo Fernandez Colon that circulated through
email in the context of the dialogue between Alex Fergusson and Rigoberto Lanz concerning the “Misión
Ciencia” created by the Government of the Bolivarian Republic of Venezuela.)
2
A perfect adæquatio or matching is impossible insofar as, as shown in vol. I of this book, conceptual maps
are digital, whereas the territory they interpret is analog (the discrepancy between these two being aptly
illustrated by the relationships between a digital photograph, which is discontinuous, and what it
represents, which is continuous and to which therefore it cannot correspond: if the number of dpis is
extremely high, one may get the illusion that is looks roughly alike, but as soon as one zooms in into the
picture all one sees is a combination of squares of different colors having no resemblance whatsoever
with reality), and insofar as from different viewpoints different maps are equally valid—and for the same
reason equally incapable of perfect correspondence with what they represent. However, the problem
arises when the fragmentary outlooks the Buddha represented with the fable of the men with the elephant
and the image of the frog in the well takes its perceptions to fit the undivided, holistic territory they
interpret—and in general when we confuse the map with the territory of take it to perfectly correspond to
it, as happens when the basic human delusion that the Buddha called avidya and that Heraclitus called
lethe is active. Cf. also Capriles (2004) and other works. (As we all know, Foucault [1976, 1978] and
Deleuze [1980] assert the sciences to be more than ideologies: to be the very matrix that makes possible
and justifies the existence of power.)
3
As stated in a note to the Introduction in vol. I of this book, since the initial use of the term in Sorel (2a Ed.
1922), myth was for our author a network of meanings and a tool of elucidation helping us to perceive
our own history. In particular, Sorel’s “theory of social myths” establishes that myth is a humanoriginated belief born out of a psychological shock and—insofar as it must move human beings to action
on the basis of an exemplary genealogy—often related to the question of origins. Rather than remitting to
the past as the primitivists believed, it points to the eternal. It consists in a set, not of concepts or ideas,
but of motive images, and hence the point is nor whether or not it does respond to whatever happened,
but that it must give rise, intuitively and prereflexively, to the whole of the feelings susceptible of giving
rise to an envisaged action: it has to do with what will be produced and what one intends to produce, even
though it is not a precise prediction. If it is fruitful, if it responds to the collective aspirations, if it is
accepted by the whole of society or at least by a sizeable part of it, the myth renews itself on the basis of
itself: its socialization corresponds to its consecration. Hence myth is beyond such disjunctives as truefalse, good-evil, just-unjust: either it is fruitful, generating a socio-psychological activity, or it is not
fruitful and does not generate such activity. This, among other things, is why Sorel denounces the implicit
reductionism of Marxism and its pretension of scientifically predicting the future, yet rather than refuting
the system in question, limits himself to asserting that it pretends itself scientific insofar as science is the
pivotal myth of its time: Marxism is mythic precisely to the extent to which it pretends itself scientific.
This is why Sorel (1906) asserts that the true problem does not lie in conceiving precepts or even
examples, but in setting into action the forces susceptible of causing action to adjust itself to the precepts
and examples. Unlike Pareto, Sorel does not view myth as an irrational belief we must rid ourselves of,
but as a motor or instigator to be implemented—so long as the myth be “authentic” in the sense of
leading to a desirable state of affairs. This is why Sorel (1908), just as this book, insists that “progress” is
nothing but a myth of the bourgeoisie—which, it is now clear, has led us the brink of self-destruction.
The myth I present in the three volumes of this book, and particularly in vol. III, Beyond History, is intended
as a means, not only toward the transformation of society, but also toward going beyond “adhering” (to
myths and all sorts of constructions of thought) in the sense of “being conditioned by”—and thus toward
achieving freedom with regard to that which causes myths to have a motive power. In other words, just
like Ashvagosha advocated the use of language as a means toward going beyond language, in this book I
am laying out a myth that I intend to ultimately cause myths to lose their motive power. In fact, according
to the view of human evolution and history presented in vol. III, our species went from a condition in
which human beings were not conditioned by myths and thought constructions in general, to one in which
they were so conditioned and hence wholesome myths were employed. Finally, from the latter it moved
to a condition in which harmful myths were adopted that pretended to be objective, “scientific”
descriptions of reality rather than myths.
997
(It must be noted that my coincidence with Sorel in the above regards should not be taken to imply I accept
his extreme apology of violence.)
4
My use of this term does not imply the thesis according to which self-deceit is the function of a topos alien
to consciousness (as in the first Freudian topic) o to the ego (as in the second Freudian topic). Cf. vol. II
of this book.
5
In general, those traditions that, like the Dionysian, have been connected to Mount Kailash: Indian Shaivism,
Persian Zurvanism (and later on Ismailism), Chinese Taoism, Himalayan Bön and, later on, Tantric
Buddhism and Buddhist Dzogchen, etc. A more in-depth discussion was undertaken in a note to vol. II of
this book, and will be undertaken far more thoroughly in Capriles (work in progress 3). Alain Daniélou
(1987), for his part, has shown the identity between the Dionysian tradition, Shaivism, and the Egyptian
cult of Osiris.
6
Hesiod reformed ancient tradition by introducing, between the Bronze and Iron Ages, an “Age of Heroes,”
which according to Wilamowitz and Reintzenenstein (Fernández Colón [2005]) was added by the Greek
poet in order to insert in this tradition “the prestigious works of Homeric heroes.” Heraclitus repeatedly
referred to the aion, but extant fragments do not refer to eras. Plato (Politician 268d-273c) reinvented the
tradition even more radically, though Châtelet (1965, pp. 225-239) inferred a degenerative philosophy by
combining these fragments with Republic, Book VIII. The Stoics, who acknowledge that they took their
view from Heraclitus, seem to express the latter’s conception in full, for their description of the
successive eras is in perfect agreement with the most archaic versions of the degenerative view of human
spiritual, social and cultural evolution and history—such as that of the Bönpos (Reynolds, John, 1989)
and that of the Taoists (which, however, does not divide the time cycle in four or three eras in the manner
of the various extant Indian and Greek traditions. In fact, as will be shown below in the regular text
(check whether or not I cited ISE or reworded the same ideas), they described the primordial era as being
free from all social divisions, property, individual family, and so on (check in ISE what else must be
said).
7
The fourfold division of the cycle was originally carried out on the basis of the four-sided dice used in
ancient India, in which a perfect (kritya) game was four (hence the name krityayuga), the second best
game was three (hence the name tretayuga), the next was two (hence the name dwaparayuga) and the
lowest possible was one, which represented a “black” or “dark” game (hence the name “black / dark age”
or kaliyuga). In their turn, those traditions that referred to the primordial age as satyayuga, rather than
taking the term satya or truth in the sense of adæquatio rei et intellectus, or in that of perceptio clara et
distincta, etc., used it in the sense of “absence of the delusion (i.e., of what the Buddha Shakyamuni
called avidya and which Heraclitus called lethe) that causes us to experience the put as given, the relative
as absolute, the dependent as independent, the apparent as inherent, the conditioned as unconditioned,
etc.” In other words, the term refers to the Heraclitian aletheia (but not as Heidegger misunderstood
Heraclitus’ usage of the term).
Finally, the tradition that posits three eras refers to the second as dharmayuga because in this era, despite the
fact that the true condition of reality has been covered up by delusion, the spontaneous perfection of the
natural order has not been forgotten (so to day) to such a degree as to cause human beings to rebel
against their circumstances. Though this makes them experience less conflict than they would experience
were they to rebel, it also makes possible the development of inequalities and injustices. Finally, in the
kaliyuga rebellion proliferates, causing conflict and suffering, but also opening the way for the
subversion of the established social, economic, political, cultural and spiritual order.
According to one Hindu interpretation (Rohde [Ed., 1999]; Liscano [1993]; Fernández Colón [2005]), the
krityayuga lasts 1,728,000 years, the tretayuga lasts 1,296,000 years, the dwaparayuga lasts 864,000
years and the kaliyuga lasts 432,000 years. According to another (or the same?) view, a kalpa lasts 4,320
millions years. However, these numbers are quite irrelevant. CHECK INTERNET FOR THE
KALACHAKRA CHRONOLOGY.
8
According to the pre-Buddhist Himalayan spiritual system known as Bön (and to some extent in agreement
with Marxism), it was the introduction of private property that gave rise to political power, for property
gave raise to chaotic struggles that could only be suppressed when all recognized a sovereign. The first
sovereign being of divine origin, at some point he nonetheless abused power, and so a privileged ruling
cast or social class arose, giving rise to social stratification; then, the need to protect both private property
and the class system gave rise a further development of political power, wielded by the privileged sectors
998
of society. This dynamics gave rise to the oppression and exploitation of groups of human beings by
other groups of human beings. Cf. Reynolds (1989).
9
According to Diogenes Laërtius (1972-1979, L, IV, 9), also Heraclitus would have sustained the circular
vision we are concerned with, asserting that the world arises from fire and returns to fire according to
fixed cycles and for the whole of eternity.
10
Some interpret the Book of Daniel as reflecting traditions assimilated during the captivity in Babylon, but
most secular interpreters believe that references in the Book of Daniel reflect the persecutions of Israel by
the Seleucid king Antiochus IV Epiphanes (175–164 BC), and dating its composition to that period,
deem that Eastern influences were received through the Persians.
11
From the sixties onwards, books on the subject—using abundant data from the UNESCO yearbooks and the
results of research by the most serious institutions, and, in some cases, endorsed by some of the most
renowned scientists—proliferated, allowing growing numbers of people to become aware of the
extremely dangerous situation we face, and to search for an alternative to the project at its root. The work
that rang the alarm bell may have been Rachel Carson’s Silent Spring (1962), which was followed by F.
Osborn’s The Looted Planet, W. Vogt’s Path of Survival, Barry Weissberg’s The Politics of Ecology, the
MIT’s The Limits to Growth (which in the long run may have undermined the ecological movement
because its predictions failed to materialize), The Ecologist’s A Blueprint for Survival, MesarovicPestel’s Mankind at the Crossroads, D. Meadows’ The Global Equilibrium, Segeberg’s The Ecological
Warning, Philippe Saint-Marc’s Socialization of Nature, and many other classics.
The emergent awareness of the limits and the dynamics of ecosystem Earth caused some of the clearest
thinkers in the West to outline projects for restructuring technology and the sciences. In 1962, Murray
Bookchin began publishing the manifold books in which he developed the concept and the ideology of
anarcho-ecologism. In the 1970s, the Norwegian thinker Arne Naess produced the concept of deep
ecology, which called for a radical restructuring of the whole of human society in order to put an end to
all types of exploitation (and which he related to Buddhist thought); Ivan D. Illich advanced most
important, similar proposals, which covered manifold disciplines (and which went so far as to put
forward a maximum speed of transportation of 10 miles/hour); and E. Fritz Schumacher propounded
other most important concepts, such as those of intermediate technology, Buddhist economics and
technology with a human face. These trends of thought kept proliferating, giving rise to the manifold
works by Hazel Henderson, Walter Weisskopf, Manfred Max-Neef, Fritjof Capra, Brian Tokar and
Andrew Dobson, Herman Daly, Nicholas Georgescu-Roegen, Richard England, Frances Moore-Lappé &
Joseph Collins, Armory & Hunter Lovings—and, to some extent, also those by Kenneth Boulding and
John Galbraith. Lately, the proliferation of works on this line of thought has been so important, that it
would be very difficult to elaborate an exhaustive list of them.
In this note I listed some books by their names because, except for those that are quoted in this book, none of
them are not included in the Bibliography.
12
The Millennialist tradition involves an analogy between phylogenesis and ontogenesis in that the condition
of plenitude and perfection that manifests at the end of the process is not followed by a new process of
degeneration.
13
This symbolism is evidently far more sexist than Eastern ones.
14
In the works of Taoism of Unorigination or contemplative Taoism in general, and in those by Lao-tzu, in
particular, the terms “nothingness” and “nonbeing” (which in this case are the Chinese wu and the
Japanese mu, as different from the Chinese k’ung and the Japanese ku) refer to the condition that is free
from the delusory valuation of the concept of being—or of the concept of nonbeing, for that matter. I find
this terminology—which as we have seen exerted an important influence on Martin Heidegger—far less
precise than that of the Madhyamaka school of Buddhist philosophy, and view this lack of precision—
together with Heidegger’s lack of a practice of Awakening—as of the main likely causes of the lack of
precision in Heidegger’s philosophy.
15
The quotation, from Capriles (2003), is the following:
A delusion is a distorted perception of reality. Someone who, being deluded with regard to the direction of
cardinal points, tries to go south, at a given moment could as well discover she or he is going north. As
we have seen, this happens all the time in our daily lives, as so often our attempts to get pleasure result in
pain, the actions whereby we intend to get happiness give rise to unhappiness, what we do achieve
security produces insecurity, and so on and on. In fact, the essential human delusion (avidya or marigpa)
gives rise to an inverted dynamics that often causes us to achieve with our actions the very opposite of
999
what we set out to accomplish—which is what a popular twentieth century British-born author called
“law of inverted effect” or “reverse law” (Watts, 1959). The great Dzogchen Master Vimalamitra
provided us with an excellent example of this law in the There Sections of the Letters of the Five Spaces,
where he noted that all the happiness of samsara, even if it momentarily appears as such, is in reality
only suffering, maturing in the same way as the effects of eating an appetizing yet poisonous fruit
(Namkhai Norbu, 1999/2001, p. 41): again and again the appetizing aspect of the fruits of samsara
beguile us into gobbling them, and yet we fail to learn from the ensuing stomachaches. In The Precious
Vase: Instructions on the Base of Santi Maha Samgha, Chögyäl Namkhai Norbu (1999/2001, p. 44)
explains the examples with which the mahasiddha Sarahapada illustrated this law:
“Not knowing what to accept and what to reject, even though we crave happiness we obtain only sorrow, like
a moth that, attracted by a flame dives into it and is burnt alive; or like a bee that, due to its attachment to
nectar, sucks a flower and cannot disengage from it, dying trapped inside; or like a deer killed by hunters
while it listens to the sound of the flute; like fish that, attached to the taste of the food on the fisherman’s
hook, die on the hot sand; like an elephant that, craving contact with something cool, goes into a muddy
pool and dies because it cannot get out. In fact the Treasury of the Dohas (Do ha mdzod) says:
“Observe the deeds of the fish, the moth, the elephant, the bee and the deer, [each of which brings about its
own suffering through attachment to objects of one of the five senses]! [...]”
From the Three Sections of the Letters of the Five Spaces (op. 3: p. 7, 1):
“There is no end to all the various secondary causes, just like following the mirage of a spring of water.”
“In fact all the beings that transmigrate through the power of karma, whether they are born in the higher or
lower states, are in fact beguiled and dominated by the diverse secondary causes so whichever actions
they perform become a cause of suffering. They are never content with what they do and there is nothing
on which they can really rely...”
16
I think it is advisable not to try to predict exactly when would the disintegration of human society or the
end of human life on our planet take place if current trends were sustained, for so far most such
predictions have proved wrong. According to what seem to be the soundest interpretations of the
prophesies in the Kalachakra Tantra and related traditions, which foretell the advent of a millennium of
Awakening, harmony and peace beginning after the Kalachakra wars, we are still many decades away
from the wars in question, and so these prophesies seem to foresee that human society will not
disintegrate, and that human life will not come to an end, during the 2lst century.
The fact that scientific predictions have rarely been fulfilled with precision, is show by the ones made in The
Ecologist Editing Team, 1971, which was supported in a document by many of the most notable
scientists of the United Kingdom and by organizations such as The Conservation Society, the Henry
Doubleday Research Association, The Soil Association, Survival International, and Friends of the Earth.
The authors (which included Edward Goldsmith) asserted that:
“After examination of the relevant available information has made us conscious of the extreme gravity of the
global situation in our days. However, if we allow prevailing tendencies to persist, the rupture of society
and the irreversible destruction of the systems that sustain life on this planet, possibly towards the end of
the [twentieth] century, doubtlessly within the lifetimes of our children, will be inevitable.”
The same applies to the predictions by Michel Bosquet, who warned over three decades ago that (in Senent,
Juan; Saint Marc, Philippe & others [1973]):
“Humankind needed thirty centuries to gather momentum; there are thirty years left to brake before the abyss.
“
More pondered, but perhaps still too tight in his dating, German-Ecuadorian deep ecologist Arturo Eichler
pointed out in the late 1980s that it would have been an exaggeration to predict the total destruction of
the systems that sustain life in the twentieth century, but also asserted that only a total immediate
transformation might perhaps make our survival possible beyond the first half of the present century
(personal communication).
For his part, Lester Brown, from the Worldwatch Institute in Washington, D.C. (Brown, Lester, 1990), may
have also proposed too fixed a threshold when he asserted at the Global Forum on the Environment and
Development for Survival that took place in Moscow from January 15-19, 1990 that:
“If we cannot turn around some of the prevailing tendencies in the future, we run the very real risk that
environmental degradation may produce economic ruin, as it has already done in parts of Africa, and that
the two may begin to feed upon each other, making any future progress extremely difficult... ...by the
year 2030, we will either have produced an environmentally sustainable world economic system or we
1000
will have clearly failed and, much before that, environmental degradation and economic ruin, feeding
upon each other, will have led to social disintegration. We will do it by 2030 or we will have clearly
failed.”
Without announcing a “date of doom,” in 1998, a group of scientists comprising many of the Nobel prize
winners of the planet warned against the irreversible destabilization and destruction of the ecosystem
through the greenhouse effect—which, given the ever-increasing heat absorbed by the Pacific Ocean,
which then is distributed, has been giving rise to ever more extreme “El Niño” phenomena, which have
wreaked havoc around the world. Even James Lovelock, who previously had made fun of ecologists,
pointed out that Gaia (the planet considered as a living organism) would be incapable of maintaining its
homeostasis (health) and life with an index of human incidence upon its systems such as the one that has
characterized recent years and decades. More recently, another conference of climatic experts made even
direr warnings.
Though I refuse to make predictions concerning the time at which, if no radical change is achieved, society
may be disrupted or humankind destroyed, there is no doubt that the results of our scientifictechnological project threaten the continuity of human society and life, and that little time is left for us to
make the necessary changes. Therefore it is imperative that we begin working right now toward the
spiritual, psychological, epistemological, technological, social, economic and cultural changes that are
the condition of possibility of long term survival: only thus will possibly come true the predictions in the
Kalachakra Tantra, according to which after the final wars of Kalachakra humankind will enjoy a
millennium of peace and spiritual fulfillment.
17
Buddhism does not claim that a god created the world in order to fulfill a preconceived purpose. Since the
question as to how the world originated and how life manifested is irrelevant for Liberation or
Awakening, Shakyamuni remained silent when asked about it (just as he did when asked about other
thirteen topics). Furthermore, the question concerning the meaning of life only arises from the standpoint
of dualistic delusion, as the latter causes us to feel that we are thrown into a world against our will and
forced to have experiences in it, and then makes us ask what is the meaning of being so thrown and so
forced. However, upon Awakening we realize a Meaning that is inexpressible and unthinkable: we (are)
what is happening, and as we are no longer caught within the boundaries of the dualism of self and other,
person and world, experience and recipient of experience, etc., so that we cannot feel different from what
is happening, the flow of Time (which I capitalize insofar as here I am referring to it in the context of
Total Time-Space-Gnosis-Awareness) is itself absolute, nondual, nonconceptual Meaning—making it
impossible for the Awake individual to ask himself questions concerning the purpose or meaning of life.
In this context, it is important to emphasize once more that samsara and nirvana are two dynamics (in an
individual) of the single Base or zhi (gzhi) referred to in the Dzogchen teachings, and that both manifest
from the same source. In a note to Chapter II we saw that according to the Kunje Gyälpo there is no one
apart from Samantabhadra, the state of dharmakaya, who has created dualism. However, in truth
samsara arises again and again in our experience (in a way that was described both in Part Two of this
book and in Capriles [2004]), and thus the question regarding the origin of samsara does not refer to
something that happened long ago, but to something that constantly happens again and again as time goes
on. At any rate, there being no duality the moment just before the occultation of the true condition of
reality and the subsequent arising of samsara, it is impossible that at that moment there be an intention,
and hence that there be a “reason” for this occultation to occur; therefore, we cannot say that the
occultation took place for this or that reason. In fact, the illusion of duality that is the core of samsara
arises nondually. If, after being possessed by the illusion of duality, we are fortunate enough as to
reGnize rigpa and thereby apprehend nondually what at some point had seemed to be a duality, we come
to realize the “meaning beyond words” referred to above.
Though we cannot say why samsara arises, we can say how it arises: this is what the Dzogchen teachings do
when they explain the successive arising of kunzhi (kun gzhi) as basic ignorance concerning the true
condition of the Base or zhi (gzhi), of kunzhi namshe (kun gzhi rnam shes) as a readiness to single out
forms out of the continuum of sensation that manifests in the state of kunzhi and know them, of
nyongmongpachen yikyi namshe (nyong mongs pa can yid kyi rnam shes; this is what is called in
Sanskrit as klishtamanovijñana) as the active core of the passions that are the essence of the realm of
sensuality, and of the six sensory consciousnesses as the actual functioning of this realm of samsara. For
a more detailed explanation of this, see Capriles (2004) (the definitive, corrected version of which will
soon be available in print), as well as Capriles (work in progress 4).
1001
18
A person enjoying high status is not “better off’ than another suffering a low status; if a poverty-stricken
person has a greater quantity of so-called “physical” sufferings, a wealthier person certainly has a great
deal of so-called “mental” ones—and, moreover, at any moment he or she can have an accident or illness
and thus be forced to experience so-called “physical” pain. Furthermore, if we ascend to a higher place
because of apparently desirable turns of fortune, when the time comes for the wheel of samsara to turn
we will experience a far more vertiginous and pronounced fall, since we will plunge from a higher point
in the wheel, possibly to the lowest point. And when we face the status represented by the lower part of
the wheel, being unaccustomed to them, we will reject them with greater impetus, which will make them
ever more unpleasant. This is the reason why Blaise Pascal insisted that the existence of the peasant, for
example, is less prone to conflict than that of the sovereign (Pascal [1962]; thought 223):
“The great and the small have the same accidents, the same sorrows and the same passions; however, the
former is on the periphery of the wheel, whereas the latter is more near the center and thus is less agitated
by the same movements.”
19
Below I reproduce the whole section from which the quotations in the regular text were taken, so that the
reader who has not studied vol. II of this book may place the cited excerpts in context:
In the preceding chapter I referred to Awakening as absolute sanity and as absolute mental health, and
referred to deluded normality—in which the greatest part of the time we are successful at eluding the
Hell that, as we have seen repeatedly, is the bare experience of being-for-Self and of being-for-others—
as masked insanity. The point is that normality is characterized by the basic human delusion called
avidya or marigpa, and delusion is the very opposite of the mental soundness that should be the defining
characteristic of sanity and mental health. According to Alfred Korzybski (4th Ed. 5th printing, 1973),
sanity lies in the structural fit between our reactions to the world and what is actually going on in the
world, whereas insanity would consist in the lack of such fit—which the author in question explained in
terms of his renowned map-territory analogy: the map is not the territory but, when correct, it has a
structure similar to that of the territory that allows it to be useful in dealing with the latter, and that is at
the root of the structural fit that in his view is the index of sanity. However, conceptual maps are digital,
whereas the sensory territory is analog, and the digital, being discontinuous, cannot correspond to the
analog, which is continuous. In other works19 I have illustrated this lack of match with a series of
examples; here, I believe it may suffice to use that of the mismatch between a digital photograph and the
analog reality it is supposed to replicate: though the lack of fit is minimized if the number of dpis is
extremely high, even in this case it would suffice to zoom in to see a combination of colored squares
bearing no resemblance to the continuous reality photographed. No doubt, in spite of this, digital maps
are instrumental to our aims a great deal of the time—yet very often their use causes effects that
diametrically contradict those that we intend to produce, being the source of the most extreme lack of fit
imaginable between the ones and the others. In fact, as shown in the following chapter of this volume,
because of the radical difference between the digital code of the process that in the 1895 Project for a
Scientific Psychology Freud called secondary (based on the computations of the left cerebral hemisphere)
and the analog code of the process he called primary (based on the computations of the right
hemisphere), the action of consciousness in terms of the former is very often read invertedly in the
latter—which causes it to yield effects diametrically opposed to the ones intended, as is proper to the
samsaric “reverse law” or “law of inverted effect” that was briefly reviewed toward the end of the first
chapter of this volume.
Furthermore, the exacerbation of the delusion called avidya or marigpa, and hence of What Gestalt theory
calls figure-ground mind and of understanding exclusively in terms of digital secondary process, has
caused the figures we single out in the sensory continuum to appear to us as in themselves isolated from
the ground, making consciousness unaware of the indivisibility of the analog continuum of the territory
and of the interdependence, not only of the singled out figure and the rest of the continuum, but of all
potential figures among themselves. The result is a lack of overall understanding of the indivisible,
analog continuum and network of interdependences that is the universe—which, according to the Udana
(third book of the Khuddaka Nikaya in the Pali Canon, which contains the teachings of the First
Promulgation that form the basis of the Hinayana), the Prajñaparamitasutras (Second Promulgation), the
philosophy of Nagarjuna (based on the latter sources) and other Buddhist sources and systems, is a
central aspect of the basic human delusion called avidya or marigpa. K. Venkata Ramanan paraphrases
the explanation the Prajñaparamitashastra, which the Chinese attribute to Nagarjuna,19 gives about this
essential aspect of delusion:19
1002
“We select from out of the presented only the aspects of our interest and neglect the rest; to the rest that is
neglected we become first indifferent and then blind; in our blindness, we claim completeness for the
aspects we have selected. We seize them as absolute, we cling to them as complete truth... While the
intellectual analysis of the presented content into its different aspects is conducive to and necessary for a
comprehensive understanding, analysis is miscarried if the fragmentary is mistaken for the complete, the
relative is mistaken for the absolute.”
In the Udana of the First Promulgation, Shakyamuni Buddha illustrated this aspect of the basic human
delusion by the story of the six blind men and the elephant, according to which the one who held the
elephant’s head asserted the object to be like a pot, the one who held the ear said it was like a winnowing
fan, and so on:19 each of them held so firmly to his partial view, taking it to be the exact, absolute view of
totality, that they quarreled bitterly, unable to come to an agreement as to the nature of the object before
them. The same story is told in the Tathagatagarbhasutra of the Third Promulgation, as follows:19
“The king assembled many blind men and, [placing them before] an elephant, commanded, “Describe [this
object’s] particular characteristics.” Those among them who felt the elephant’s nose said that [the object]
resembled an iron hook. Those who felt the eyes said that [it] resembled bowls. Those who felt the ears
said [it] resembled winnowing baskets. Those who felt the back said it resembled a sedan chair, and those
who felt the tail said it resembled a string. Indeed, though [their respective descriptions responded to the
parts of the] elephant [they touched], they were lacking in overall understanding...”
The result of the inverted meaning the contents of digital secondary process have in the analog code of
primary process, of the perception of parts of the whole as intrinsically isolated essents and the incapacity
of consciousness to apprehend interconnections, and in general of the basic human delusion called avidya
or marigpa, is the above-mentioned lack of fit between the aims behind our actions and the results these
produce. In this regard I wrote elsewhere: THIS QUOTATION IS REPEATED FROM ABOVE;
REFER TO IT RATHER THAN CITE AGAIN.
A delusion is a distorted perception of reality. Someone who, being deluded with regard to the direction of
cardinal points, tries to go south, at a given moment could as well discover she or he is going north. As
we have seen, this happens all the time in our daily lives, as so often our attempts to get pleasure result
in pain, the actions whereby we intend to get happiness give rise to unhappiness, what we do achieve
security produces insecurity, and so on and on. In fact, the essential human delusion (avidya or marigpa)
gives rise to an inverted dynamics that often causes us to achieve with our actions the very opposite of
what we set out to accomplish—which is what a popular twentieth century British-born author called
“law of inverted effect” or “reverse law.”1919 The great Dzogchen Master Vimalamitra provided us with
an excellent example of this law in the There Sections of the Letters of the Five Spaces, where he noted
that all the happiness of samsara, even if it momentarily appears as such, is in reality only suffering,
maturing in the same way as the effects of eating an appetizing yet poisonous fruit:19 again and again the
appetizing aspect of the fruits of samsara beguile us into gobbling them, yet we fail to learn from the
ensuing stomachaches. In The Precious Vase: Instructions on the Base of Santi Maha Samgha, Chögyäl
Namkhai Norbu explains the examples [in terms of the five senses] with which the mahasiddha
Sarahapada illustrated this law:19
“Not knowing what to accept and what to reject, even though we crave happiness we obtain only sorrow, like
a moth that, attracted by a flame dives into it and is burnt alive; or like a bee that, due to its attachment
to nectar, sucks a flower and cannot disengage from it, dying trapped inside; or like a deer killed by
hunters while it listens to the sound of the flute; like fish that, attached to the taste of the food on the
fisherman’s hook, die on the hot sand; like an elephant that, craving contact with something cool, goes
into a muddy pool and dies because it cannot get out. In fact the Treasury of the Dohas (Do ha mdzod)
says:
“‘Observe the deeds of the fish, the moth, the elephant, the bee and the deer, [each of which brings about its
own suffering through attachment to objects of one of the five senses]! [...]
“From the Three Sections of the Letters of the Five Spaces (op. 3: p. 7, 1):
“‘There is no end to all the various secondary causes, just like following the mirage of a spring of water.
“‘In fact all the beings that transmigrate through the power of karma, whether they are born in the higher or
lower states, are in fact beguiled and dominated by the diverse secondary causes so whichever actions
they perform become a cause of suffering. They are never content with what they do and there is nothing
on which they can really rely...’”
1003
Each society has its conventions, which contradict those of many other societies and which are as arbitrary as
the latter: while the Arabs see burping after partaking of a meal at someone else’s home as a sign of
politeness showing one is satisfied, European convention would see the same behavior as a scandalous
breach of etiquette. However, the problem does not lie in the difference of conventions, but in the fact
that both the Arab and the European, just as all other peoples, mistaking convention (Greek nomos) for
nature (Greek physis) see their own social rules as absolute, universal standards. Far worse, insofar as the
followers of each theistic religion take their own faith to be divinely sanctioned, and insofar as the
followers of each ideology take their own doctrine to be the only true and/or just one, religious and
ideological divergences have for millennia given rise to sheer insane behavior like wars, massacres,
crucifixions, lynching and so on. However, in the last centuries things have turned for the worst, for as
shown in the vol. III of this book, the currently prevailing ideology, which is that of progress and of
science as the bearer of truth, has given rise to courses of behavior that are likely to destroy human
society and even put an end to human life on this planet in the course of the present century and which as
such are the most insane ever taken by our species.
Thus we can but agree with seventeenth century French thinker Blaise Pascal, who compared the state of
mind of normal individuals to a psychological disorder,19 and with ex-Frankfurt philosopher, social
psychologist and New Age forerunner Erich Fromm, who gave to understand that our society as a whole
is way far from sanity:19
“Just as there is a folie à deux there is a folie à millions. The fact that millions of people share the same vices
does not make these vices virtues, the fact that they share so many errors does not make the errors to be
truths, and the fact that millions of people share the same form of mental pathology does not make these
people sane.”
In fact, deluded normality consists in being well adapted to an extremely deranged society, and as such
implies becoming extremely deranged. In its turn, society is deranged because its members are affected
by an extreme instance of the basic human delusion called avidya or marigpa, which has led them to
develop common, clearly insane cultural views and conventions. Roughly twelve centuries before Erich
Fromm, Buddhist Madhyamika-Prasangika Master and philosopher Chandrakirti related the fable of a
king that consulted a famous astrologer, who predicted that a rainfall of “maddening water” would
pollute the reservoirs in his kingdom, as a consequence of which all who drank from them would be
driven insane. Hence the king warned his ministers and subjects to prepare a protected supply of water
and avoid drinking the deranging water. However, the subjects, being less wealthy, exhausted their
reserves more rapidly, and soon had to drink contaminated water. Since the king and the ministers
behaved quite differently from the subjects who had drunk the maddening water, the latter concluded that
the former had become insane. When the ministers used up their reserves, they also had to drink the
deranging water—upon which the rest of the subjects thought the ministers had become normal, and all
agreed the only one still insane was the king. Thus in order to keep his kingdom and avoid being
impeached and put into an asylum, the king had no option but to drink the polluted water.19
As implied above, the current mortal ecological crisis we have produced is ample proof that there is a
structural lack of fit between our reactions to the world and what is actually going on in the world, for as
stated in the excerpt of a book of mine cited above, the realization that we are heading South while
intending to go North proves that we are basing ourselves on a delusive perception and therefore that, in
terms of criteria such as Korzybski’s, we are at the extreme opposite to sanity—which is just what
Chandrakirti suggested, what Pascal and Fromm asserted, and what Antipsychiatry turned commonplace.
20
The following is the reproduction of a note to vol. I of this book:
It is not easy to assess the authenticity or unauthenticity of the Prajñaparamitashastra. Unlike the texts
conforming the Collection of Madhyamika Reasonings (Skt. Yuktikaya; Tib. Rigtsog [rigs tshogs] or
Uma rigtsog [dbu ma rigs tshogs]) universally attributed to Nagarjuna, this text posits some autonomous
theses and syllogisms, and some of its views seem to some extent similar to those of the Madhyamika
Swatantrikas. However, the text in question makes it very clear that whatever an Awake individual posits
is posited without what Chandrakirti called “own-mind:” the Awake individual does not believe what He
or She says, but says it as an expedient means for leading sentient beings of specific capacities to
Awakening. This is a view rejected by the Swatantrikas and accepted both by the Prasangikas and the
adherents of the Inner, Subtle Madhyamaka (Tib. Nang trawai uma [nang phra ba’i dbu ma]), and in
particular by the Mahamadhyamikas. Therefore, we may not conclude the shastra was concocted by late
followers of the Madhyamika Swatantrika subschool.
1004
Nevertheless, just as Nagarjuna’s Collection of Madhyamika Reasonings (Skt. Yuktikaya; Tib. Rigtsog [rigstshogs] or Uma rigtsog [dbu ma rigs tshogs]) is seen as the source of Swabhava Shunyata Madhyamaka
or Uma Rangtongpa, and as Nagarjuna’s Collection of Eulogies (Skt., Stavakaya; Tib., Tötsog [bstod
tshogs]) and in particular the Eulogy to the Expanse of the True Condition (Skt., Dharmadhatustava;
Tib., Chöjing Töpa [chos dbyings bstod pa]) is seen as the source of the Parashunya Madhyamaka or
Uma Zhentongpa, if the Prajñaparamitashastra were actually a work by Nagarjuna, it could perhaps be
seen as one of the main sources of Madhyamaka Swatantrika—and insofar as it combines autonomous
theses and syllogisms with the insistence that no thesis should be clung to, and that Awake Ones posit
theses without own-mind, merely as other-directed assertions that may be useful to treaders of the Path, it
could be seen also as one of the sources of Mahamadhyamaka. In fact, in this case the Collection of
Madhyamika Reasonings as it is known and conserved in Tibet would be the source of Prasangika, rather
than the source of the whole of Swabhava Shunyata Madhyamaka or Uma Rangtongpa.
Hui-neng’s method of interrelated opposites (described in Capriles, 2004 and others of my works), which is at
the root of many intellectual skillful means of Ch’an and Zen Buddhism, insofar as it is based on the
understanding that Buddhas have no own-mind and all they say are other-directed assertions having the
function of leading being to Awakening, would be based, among other sources, both in the Collection of
Madhyamika Reasonings and in the Prajñaparamitashastra.
21
In Guenther (1984), we are told the tale of the men and the elephant is an ancient Indian story. As remarked
in the regular text, to my knowledge it first appeared in written form in the Tathagatagarbhasutra. Later,
it reappeared in Islamic countries, in texts by the Sufi poets; for example, according to the Hadiqah by
Sana’i, just like in the original sutra, the men were blind, while in Rumi’s Mathnavi (written centuries
after the Hadiqah) they had no vision problems, but were in the dark (Iqbal [1964]). It must be noted,
however, that the fifth man, who mistook the tail for a snake, is not featured in the Sufi version of the
story; in fact, I incorporated him into the tale. Recently, the story has been told in Dudjom Rinpoche
(1991, vol. I, p. 295), in Namkhai Norbu Rinpoche’s oral teachings, in texts dealing with systems theory
and also in previous works by the author of this book (cf. Capriles [1986, 1988, 1994], etc.).
22
This example was used by Alan Watts, from whom I have often borrowed it. Unfortunately I do not
remember in which of Watts’ books it was used.
23
There is a direct relation between the ampleness or narrowness of an individual’s space-time-knowledge
and what Tantrism designates as “energetic-volume-determining-the-scope-of-awareness” (kundalini or
thig le: a concept that was explained in a note the first time the term was used in the regular text, and that
was considered in greater detail in the context of the discussion of the mandala). In fact, Total SpaceTime-Awareness corresponds to what the Dzogchen teachings call “thigle chenpo” or Total Thigle;
since, as I have noted elsewhere, the Tibetan term thigle translates both the Sanskrit word bindu, meaning
“seed” and implying the form of the sphere, and the Sanskrit noun kundalini, which I translate as
“energetic-volume-determining-the-scope-of-awareness,” “total thigle” means both “total sphere” (i.e.,
total bindu) and “total energetic-volume-determining-the-scope-of-awareness” (i.e., total kundalini)—
which in this case must be understood qua Fruit and qua Path (which is exactly the same as Dzogchen
qua Fruit and qua Path). (Furthermore, when the energetic-volume-determining-the-scope-of-awareness
is very high, bindus or spheres may manifest in the vision of human beings. And, since the term bindu
also refers to the seed-essence that is the white principle in the male and the red principle in the female,
the fact that the same word is used in Tibetan for bindu and for kundalini is due to the relation between
the conservation of the seed-essence and the height of the energetic-volume-determining-the-scope-ofawareness in an individual.)
It may also be useful to relate the Dzogchen term “total sphere” to the statement by the Seraphic Doctor, Saint
Bonaventura, that was later reproduced by Blaise Pascal, and which physicist Alain Aspect repeated after
his experiments of 1982 at the University of Paris-Sud:
“The universe is an infinite sphere the center of which is everywhere and the periphery of which is nowhere.”
24
In Pascal (1962), the second Noble Truth is correctly described, and just as in the story of the maddening
water, is compared to a psychological disorder (the French philosopher-mathematician-optician did not
use the name “Noble Truth,” nor did he refer to Buddhism, which in his time was reputedly unknown in
France.)
25
So long as Total Space-Time-Awareness is veiled by space-time-knowledge (no matter whether the latter
be narrower or wider), a directional consciousness observes, judges and controls behavior. And so long
1005
as a directional consciousness observes, judges and controls behavior, to some degree one is subject to
the impeded-centipede effect.
26
We are told that Prometheus, the mythological character, was imported into Greece from India, where he
was called Matariswan (a combination of matari, from matri, the Sanskrit term for mother, and the
Sanskrit verbal root swas, meaning to breathe)—sometimes identified with Vayu (personification of
wind), sometimes with Agni (personification of fire), sometimes associated with the messenger of
Vivaswat, who brings down the hidden fire to the Bhrigus. However, if the Greek myth were truly of
Indian origin, it would be pre-Indo-European and would have been lost or banished after the Aryan
invasions, for neither in the classical religious texts of the Brahmans nor in the Puranas is there any
reference to Matariswan stealing the fire and being punished—whereas, as shown in the following note,
in the Yanomami myth of the origin of fire the latter is stolen (references to Matariswan are found in a
few hymns of the Third Book of the Rig Veda, as well as in the Atharva Veda; later on they are found in
the Kena [Talavakara] and Isa Upanishads; then in the Shatapatha Brahmana, in the Mahabharata, and
then in the Puranas).
The account of a universal deluge, which in Greece was directly related to the myth of Prometheus, is
common to many civilizations and spiritual traditions. There are two Indian versions of the account: in
the Brahmanic version the equivalent of the Hebrew Noah, the Greek Deucalion, the Chaldean
Khasisatra, etc., is the great rishi Manu (the Sanskrit root man- refers to the thinking faculty proper to
humankind, and Manu’s descendents were the manavas, which is the Sanskrit for “humankind”—the
adjective “human” being manushya); in the version of the Puranas the Indian equivalent of these is the
King of the Dastas (i.e., the Fisher King). In the Brahmanic version, Manu found, in the water that was
brought to him for his ablutions, a small fish who was an avatara and who spoke to him, saying, “I will
save thee from a flood which shall sweep away all creatures.” This fish grew to such a large size that it
had to be consigned to the ocean; then he directed Manu to construct a ship and resort to him when the
flood should rise. The deluge came, and Manu embarked in the ship; the fish then swam to Manu, who
fastened the vessel to the fish’s horn, and was conducted to safety. This version of the story first appears
in the Shatapatha Brahmana (1, 8, 1-6); then it is repeated in the Mahabharata (Book XIII, 185, with
further mentions in various parts of the epic).
However, the origin of the Indian version of the story is thought to be Dravidian (or possibly even preDravidian). It is a fact that the Dravidians were in close contact with the Elamites and the Sumerians, and
in fact the version of the Puranas, which is less Aryanized, shows coincidences with both the Babylonian
and Biblical versions of the legend that are missing in the version featuring Manu. In Lenormant (2003),
we read:
“We must also remark that in the Puranas it is no longer Manu Vaivasata that the divine fish saves from the
Deluge, but a different personage, the King of the Dastas—i.e., fishers—Satyravata, ‘the man who loves
justice and truth,’ strikingly corresponding to the Chaldean Khasisatra. Nor is the Puranic version of the
legend of the Deluge to be despised, though [its written form] be of recent date, and full of fantastic and
often puerile details. In certain aspects it is less Aryanized than that of the Brahmanas or than that of the
Mahabharata; and, above all, it gives some circumstances omitted in these earlier versions, which must
yet have belonged to the original foundation, since they appear in the Babylonian legend; a circumstance
preserved, no doubt, by the oral tradition—popular, and not Brahmanic—with which the Puranas are so
deeply imbued. This has already been observed by Pictet, who lays due stress on the following passage of
the Bhagavata-Purana: ‘In seven days,’ said Vishnu to Satyravata, ‘the these worlds shall be
submerged.’ There is nothing like this either in the Brahmanas or in the Mahabharata, but in Genesis the
Lord says to Noah, ‘Yet several days and I will cause it to rain upon the earth;’ and a little farther we
read, ‘After seven days the waters of the flood were upon the earth’... Nor must we pay less attention to
the directions given by the fish-god to Satyravata for the placing of the sacred Scriptures in a safe place,
in order to preserve them from Hayagriva, a marine horse dwelling in the abyss... We recognize in it,
under an Indian garb, the very tradition of the interment of the sacred writings at Sippara by Khasisatra,
such as we have seen it in the fragment of Berosus.”
27
A Yanomami myth also tells us that their tribe (i.e., humankind, for Yanomami means “human”) came into
possession of fire by stealing it, and that their people experienced dire consequences from their crime. In
Lizot (1985) (I am translating into English from p. 49 of the Spanish Ed.) we read:
“Our ancestors were immortal; they ceased being so when they came into the possession of fire.”
1006
As we have seen, references to a time when the human lifespan was limitless are proper to the degenerative
view of human evolution and history—to which we find many allusions in Yanomami mythology.
According to the Yanomami myth, the immortal being who originally possessed the fire was called Baba;
his wife was called Prueheyoma, and they lived in the a country inhabited by the “Waika.” The
Yanomami, in the guise of birds, went to see Baba and made him laugh, as a result of which the fire he
kept hidden in his mouth fell, and so the birds brought it to the top of a tree. Baba was extremely angry
and told the Yanomami (ibidem):
“—This fire that you just stole from me, this eternal fire, will bring you torments: its smoke will cause you
illnesses and will make you die; it will consume your bodies. Your bones will be pulverized (note by the
author of this book: the Yanomami cremate their corpses and pulverize the burnt bones, which they then
eat). Only I will remain immortal, in the freshness of the water where I am going to live.”
Actually, all that threatens the survival of our species has to do with fire: it is the direct cause of the
greenhouse effect, of acid rain, of lung cancer in smokers and city dwellers, etc.; nuclear energy is a
substitute of fire—and, at any rate, without the use of fire none of the technology that has brought us to
the verge of extinction would not have been produced.
28
Schumacher also wrote (Schumacher, E. Fritz, 1973):
“I think we can already see the conflict of attitudes which will decide our future. On the one side, I see the
people who think they can cope with our threefold crisis by the methods current, only more so; I call
them the people of the forward stampede. On the other side, there are people in search of a new life-style,
who seek to return to certain basic truths about man and his world; I call them home-comers. Let us
admit that the people of the forward stampede, like the devil, have all the best tunes or at least the most
popular and familiar tunes. You cannot stand still, they say; standing still means going down; you must
go forward; there is nothing wrong with modern technology except that it is as yet incomplete; let us
complete it.”
29
It is interesting that according to the legend the creator of the Golem was the Maharal of Prague, the
famous “supreme rabbi Loeb” (or Leow), who was a close friend of Johannes Kepler—the author of the
Astronomia Nova who, together with Galileo, was a leading figure in the scientific revolution of the end
of the sixteenth and beginning of the seventeenth century CE—as well as of the “dreamer” Frederick of
Habsburg. It is also interesting that Descartes—promoter of the technological project of subjugation of
Nature—was accused of producing Golems. It has been noted that the Golem constitutes the
materialization of the “dream harbored by the Middle Ages”.
The myth warns us that if we are to survive we must erase the aleph from our technological Golem before it
is too late—not in order to do away with technology, but to change its nature, preventing it from
becoming a Golem that finally destroys its masters. We have not yet erased the aleph because we have
fallen asleep: the means of social hypnosis keep us in a trance, helping us avoid the dreadful choice
between radical change and extinction. However, in our case there is an element that was not
contemplated in the Hebrew tale: the pride we take on having built such a colossal Golem does not allow
us to acknowledge that it is about to destroy us, but causes us to keep building it up, telling ourselves that
the problems that the Golem has created are due to the fact that it has not been developed sufficiently.
30
It is an interesting coincidence that, a few decades ago, a so-called “Frankenstein Law” was approved in the
U.S., allowing genetic engineers to patent their creations. However, the Golem threatening us with
destruction was created long before the appearance of genetic engineering, being developed by
philosophers-scientists and then perfected by engineers and other scientists-technicians.
31
With the help of those who have rid themselves of delusion and achieved Awakening, or who are quite
advanced in the process of ridding themselves of delusion and establishing themselves in the Awake
condition, we must engage in this process, simultaneously implementing the social, political, economic,
scientific, technological, cultural and other transformations necessary for survival and for the transition to
a New Age of Communion, plenitude, equity and harmony. If we conceive plans and strategies for
survival on the basis of delusion, our attempts to put an end to the crisis will further it, for they will
constitute an activity of the same kind, and will be performed with the same mentality as the one that
gave rise to our predicament. Only with the help of those who have overcome the delusion at the root of
the crisis, and of those who are well advanced in the process of overcoming it, could we manage to put
an end to it.
32
If the implementation of a thesis-project gives rise to practical consequences that radically contradict the
aims inherent in the thesis-project, the latter has achieved its empirical reductio ad absurdum. However,
1007
in the case of the technological project of domination of all that we see as other with regard to ourselves,
it is not only the thesis-project at its root that completes its reductio ad absurdum when the
implementation of the project gives rise to the ecological crisis that seems to be about to disrupt human
society and eventually wipe out human life from the face of the earth: what completes its reductio ad
absurdum is mainly the basic delusion that, upon developing to a certain degree, gave rise to the
technological thesis-project of domination. In fact, this project is a late product of the development of
delusion throughout the cosmic cycle (aeon or kalpa), which by reducing delusion to absurdity toward
the end of the cycle, allows for its eradication at the level of the species (or at least at the level of those
members of the species who survive), and thereby makes possible the beginning of a new one (the first
stage of which would be a new Golden Age, satyayuga or krityayuga), or the start of the Millennium
predicted in the Kalachakra Tantra, the Book of Ismailians, the Apocalypse, etc. In this regard, see
Capriles (1994a).
33
I have been warned that in English the “cat” sentence is used in the context of erotic relations in a “sexist,
women-denigrating sense;” however, this is no reason for sacrificing the allusion to Hegel’s schwartzen
Kühen statement, which to my knowledge has nothing to do with that context or attitude.
34
Nicholas of Cusa or Nicolaus Cusanus, thus called after the city of Cues (Cusa) where he was born
(Nicolaus Chrypffs or Krebs after his family), distinguished among four degrees of knowledge. The
highest was the knowledge of God, which can only be attained when a human being goes beyond all
other, lower types of knowledge, setting aside the knowledge of the opposites and submerging him or
herself in a state of absence of positive determinations in which all assertions are renounced: only this
docta ignorantia, which was wisdom rather than science, and which implied awareness of the impotence
of all rational knowledge, could give access to what the Cusan called speculative reason or intellectual
intuition, which was the only faculty that could have knowledge of the coincidentia oppositorum inherent
in God.
35
I am referring to processes that may be deemed to be phenomenological in terms of Lambert’s concept of
phenomenology, and specially in terms of Hamilton’s concept of phenomenology, which applies to the
realm of psychology as different from that of logic, and in particular to the processes that are the object
of phenomenology in terms of Hegel’s conception, according to which phenomenology is the science
showing the succession of the different forms or phenomena of consciousness (however, as I show in this
chapter, Hegel’s view of this succession is inverted). I am also referring to processes that may be deemed
phenomenological in terms of Stumpf’s concept of phenomenology. However, the post-Husserlian senses
of the term are in a way included, insofar as in this book I maintain the phenomenological epoche with
regard to the existence or nonexistence of a reality external to our perception (which was adopted by the
Madhyamaka school of philosophy around two millennia ago).
36
This irreversibility does not mean that whatever is built up by means of phenomenological negation cannot
be undone; what it means is that it cannot be undone by means of further phenomenological negations: in
order to undo it, negations have to be undone—which can only be achieved by Seeing through them into
the Self-qua-Base.
37
I am understanding the term “phenomenological” in a wide sense in which it refers to the designates the
logic characteristic of the occurrences that take place in human experience, rather than in the different
senses thinkers such as Husserl, Heidegger or Sartre gave the word. This is further discussed in Vol. III of
this book.
38
Even though Marxism in general rejected Hegel’s concept of nature and in general of the physical universe
as a projection of Mind that was not different from Mind, which as such obliterated the map-territory
distinction and implied that the dynamic of nature and in general of the physical universe was ruled by the
laws of thought, by speaking of a dialectic of nature in spite of the fact that dialectic is supposed to be the
movement of Mind and hence of thought, Engels (1998/2001) unwittingly reproduced the Hegelian
outlook. With regard to the Aufhebung or sublation, whereas in Hegel this negation is what allows the
movement of Geist (spirit, usually rendered as Mind) to give rise to evolution in the sense of gradual
perfecting, Marx views it as the manner of development of material conditions—and although he shares
Hegel’s inverted view of the development of society as a process of gradual perfecting (which, however,
involves repeated “qualitative leaps”), he does not fall into exactly the same error as Engels insofar as
these material conditions are those produced by human beings who in his view function in terms of the
laws of dialectic.
1008
39
A signal is analog when a magnitude or quantity is used to represent a quantity that changes in a continuous
manner in the referent, without leaps or intervals. Contrariwise, a signal is digital if there is a
discontinuity between itself and other signals from which it must be distinguished. “Yes” and “no” are
examples of digital signals, and the same applies to numbers; however, quantities—even though they are
always expressed in numbers—are in themselves analog signals.
The quantifying endeavor that has characterized the sciences since Galileo requires exact measurements, but
there are impossible to achieve insofar as discontinuous signals cannot correspond exactly to continuous
changes. In fact, analog systems increase in a continuous manner, like the slope of a hill, whereas digital
systems increase in terms of discontinuities, like a stairway. When we interpret the slope in stairway
terms (as in the example of digital pictures given in the regular text), a perfect correspondence between
the one and the other is impossible (however, the smaller the stairs, the less apparent this lack of
correspondence will be). Thus the definition of truth as adæquatio intellectus et rei (correspondence of
the intellect to the things it interprets) is actually the definition of something that is by its own nature
impossible. The digital may include increasingly smaller fractions (decimal, centesimal and so on) in
order to approach the analog, but this approach will be asymptotic, as it can never reach an exact
correspondence with it. (This also refutes the Pythagorean belief that the arche is the number and that
everything in the universe is no more than numbers—which was reborn in Kepler and his
contemporaries, who replaced Aristotelianism with Platonism [Koyré 1973].)
In Capriles (1994a), the first chapter (“Qué es filosofía y cuáles son las causas profundas de la crisis
ecológica”) explains in greater detail why the perfect adæquatio intellectus et rei is impossible, and how
all-explanatory systems must necessarily end up contradicting themselves when they try to reach absolute
precision.
40
Numbers are by their very nature digital: fingers are used for counting, and the term “digital” derives from
the Latin digitus-digiti, which means, “finger.” As we have seen, the main trait of the digital is its
discontinuity, which is paradigmatically exemplified by the one occurring between one number and the
next: one, two, three; one dot one, one dot two, one dot three; one dot eleven, one dot twelve, one dot
thirteen; and so on and on ad infinitum. This is why the French for “digital” is “numérique.”
41
In Capriles (2004) (the definitive, corrected version of which will soon be available in print) I deal with this
problem at greater length. Let us briefly review it here with regard to Nagarjuna’s and Chandrakirti’s
refutation of the alleged self-existence of a cart: if the cart is the sum of the wheels, the axles, the main
platform, the seats, the reins and so on, then the cart is not a unity, but an aggregate of unities. If in turn
we consider any of these unities, we will realize that it is not a unity but an aggregate... and the same will
apply to the unities making up the latter aggregate... so that ultimately entities can neither be seen either
as unities (insofar as they are aggregates), or as aggregates of unities (insofar as there are no ultimate
unities that may aggregate in order to form them). In the case of the cart, it cannot be said to be a selfexisting entity, nor can it be said to be an aggregate of self-existing entities.
Upon reviewing the views of Zeno of Elea (and in particular his proof of Q in the first argument against
plurality, based on the argument according to which all that is extended and thus has a size is divisible
into parts, and what is divisible into parts is not in itself a unity), Gregory Vlastos has rejected arguments
of this kind with the millennia-old line of reasoning that the oneness and the multiplicity of an entity are
not mutually exclusive features, and therefore that the multiplicity of what we consider as being “one”
and hence as constituting a unity, does not contradict its oneness and therefore does not imply it is not a
unity (Vlastos [1968]). However, when a deluded being recognizes and apprehends an entity, he or she
perceives that entity as being exclusively and absolutely one (i.e., as being a unity), and there is no
comprehension whatsoever in the deluded mind of the fact that the entity also is a multiplicity. If then the
same individual mentally disassembles the entity, he or she will perceive it as a multiplicity, and there
will be no understanding whatsoever in the deluded mind of the fact that this multiplicity also is a unity.
This does not mean that the right thing to do is to say that the entity is both one and multiple, which if
left unexplained would violate the law of the excluded middle (or law of the excluded third, or principle
of non-contradiction), would not clarify anything, and would be but another conceptual position, contrary
to saying that the entity is neither one nor multiple, and equally true and equally false as the latter (it
would clarify things if we said that relatively the entity is one when viewed from one standpoint and
multiple when seen from another, but that it cannot be said to be either absolutely one or absolutely
multiple; however, this would be but another conceptual position which, if grasped at, would give rise to
just another instance of delusion).
1009
The delusion consisting in perceiving entities as being inherently and absolutely one and thus as being unities,
which implies the negation of the fact that they also are multiplicities (or, upon analysis, the delusion that
consists in seeing them as being, inherently and absolutely, multiplicities—which implies the negation of
the fact that it is equally valid to see them as unities) is precisely what Madhyamika philosophers
intended to destroy with their arguments, and it is what is destroyed by Zeno of Elea’s “proof of Q” of
the first argument against plurality (whatever the real intent of this philosopher may have been). In fact,
even though the “proofs” conceived by Zeno of Elea are universally held to have been intended to
substantiate a worldview contrary to that of the Madhyamikas (i.e., to show that only thought was real,
and that physical reality did not at all exist), they may be used to substantiate the view of the
Madhyamikas. The point is that the proof of Q in the first argument against plurality (of entities-unities)
and some of the other “proofs” produced by Zeno of Elea to show the supposed inexistence of the
physical world, of plurality, and so on (which is supposed to be what Zeno was trying to demonstrate),
may as well be used to show that our understanding is one-sided and yet is taken to be the single, total
and absolute truth regarding that which it understands—and therefore to show that that understanding is
deluded.
Both Zeno and the Madhyamikas also produced refutations of movement (we have knowledge of four
arguments against motion developed by Zeno of Elea, which are called: the racecourse, the Achilles, the
arrow and the moving blocks; in their turn, the Madhyamikas developed a series of refutations of “going
and coming:” the first ones were those that Nagarjuna carried out in the second chapter of his
Mulamadhyamakakarikah; then Chandrakirti [1974] commented them in the second chapter of the
Mulamadhyamakavrittiprasannapada; then both the refutations by Nagarjuna and the commentaries by
Chandrakirti were commented on by a series of scholars and Masters, including Je Tsongkhapa [1974],
who did so in the second chapter of the reputed dbu ma rtsa ba’i tshig le’ur byas pa shes rab ces bya ba’i
rnam bshad rigs pa’i rgya mtsho.) The latter showed that ultimately we cannot say a moving cart goes
over a certain place, for when the front of the cart reaches that place, the back of the cart has not reached
it yet, and when the front of the cart just passes that place, the back of the cart has not arrived at it yet.
The problem cannot be solved by referring to parts of the cart: when the front of any molecule of the cart
arrives at some imaginary mathematical line, the back of that molecule will not have arrived at it yet, and
when the back of the molecule arrives at it, the front part will be past it already. Furthermore, if by
“moment” we refer to a unit of time having duration, then a moving object could not be said to be in
some precise place at some precise moment (for it would not be in the same place throughout the
moment), nor could it be said not to be in that place at that moment (for at some point of the moment it
may be in that place); if by “moment” we refer to a mathematical point or line along the time line—i.e.,
to an abstract instant having no duration—then we are not referring to a real time unit but to an
intellectual abstraction that can neither be perceived or measured, and it would be a violation of logic to
relate it with real, physical objects moving in real, physical time, for it is not legitimate to relate the
phenomenal (i.e., the physical) with the non-phenomenal (in this case, the mathematical)...
In fact, as shown below in the regular text of this chapter, Leibniz claimed that space is no more than relations
between monads, and made it clear that the latter were nonphenomenal. Kant objected that if there were
nonphenomenal monads, positing phenomenal space as the result of the relations between monads would
amount to mixing up two unmixable levels of reality: the phenomenal and one that would be absolutely
other with regard to it. According to Russell and Whitehead’s theory of logical types (1910-1913),
contradictions between terms are “real” only when both terms belong to the same logical type; in terms
of this theory, Leibniz incurred in a breach of logic, for he infringed the rule according to which what
belongs to a logical type different from that of the class being considered may neither be included in the
class nor be excluded from it—a breach that was neither nullified nor mitigated by Gregory Bateson’s
posterior observation that, for the theory of logical types to be applied, its rules have to be violated
(which in its turn implies that anyone who may have thought this theory did away with the contradictions
that have been perceived in Aristotelian logic, would have been utterly wrong). The error Kant perceived
in Leibniz is exactly the same type of error we would incur in if we related the movement of
phenomenal, physical entities in phenomenal, physical space and time, to nonphenomenal, mathematical
instants.
42
As we have seen, the view expressed in this book is based on awareness of the impossibility of thought to
correspond exactly to what it interprets, and in this sense it is contrary to Hegel’s, which as we have also
1010
seen, not only posits an exact correspondence of the map of thought to the territory of the given, but
asserts the territory to be a projection of the map, not truly different from it.
We have also seen that from one standpoint a table is a table, whereas from other standpoints it is not a table
(but pieces of wood joined, molecules, atoms or many other things according to the standpoint we take),
and that both views are valid yet none of them gives us the truth concerning the table (nor can we have
the truth concerning the table by saying it is both a table and not-a-table, or by saying it is neither a table
not not-a-table, for both alternatives would violate the principle of noncontradiction [or of the excluded
middle, or of the excluded third] which is indispensable for establishing truth and untruth—and, should
we wish to obtain the false impression that we are not violating it, we would have to illegitimately mix
up different categories or logical types. The same applies to the problem of whether moving objects are
or are not in the same place at any given moment: as seen in note before last, if by “moment” we refer to
a unit of time having duration, then a moving object could not be said to be in some precise place at some
precise moment (for it would not be in the same place throughout the moment), nor could it be said not to
be in that place at that moment (for at some point of the moment it may be in that place)—and thus both
views would be equally valid and equally incapable to give us the truth of the matter (in the sense of
corresponding exactly to what they interpret). On the other hand, if by “moment” we understood a
mathematical moment having no duration, a moving object would occupy the same place in the same
moment—but, as shown in note before last, this would involve incurring in the illegitimate operation of
mixing up different logical types (in this case, the phenomenal and the nonphenomenal).
From the standpoint of this book, contradictory views are not mutually exclusive insofar as each is valid from
a different standpoint; however, when we perceive the table as a table the delusory valuation of thought
causes us to we take this as the absolute truth concerning the object and feel it is not not-a-table, and
when we perceive it as being something else than a table the delusory valuation of thought causes us to
we take this as the absolute truth about the object and feel it is not a table: it is here that basic human
delusion lies in this respect. The perfectly correct truth would be that of a Buddha who is utterly beyond
the delusory valuation of either view, and the relatively correct view would be that of the so-called
“correct relative truth” of the post-Contemplation state of superior bodhisattvas, which involves the
delusory valuation of thought but also awareness that whatever we posit is just as true and as false as its
opposite.
43
This thesis by Marcuse (which he set forth in ch. 6 of Marcuse [1964], “From Negative to Positive
Thinking: Technological Rationality and the Logic of Domination,”), is discussed below in the
penultimate section of this chapter, “The Ideological Character of the Sciences, The ‘New Paradigm’
Championed in the 1980s and 1990s, and the Role of Science and Technology in the New Age.”
44
This objection by McTaggart is nonetheless doubtful, for he understood “contradiction” in the
general sense of the term, failing to mention the difference between the two Hegelian senses of the
term. To begin with, it must be clear that Hegel understood error in the sense of partial truth,
which consisted in taking the part for the whole, thus ignoring the absolute whole. In Hegel’s view,
contradiction between partial truths reveals their partiality and becomes an impulse leading
toward their surpassing in a more complete vision, which is contradictory in another sense: in that
of being the synthesis of contradictory opposites, which is truer than these insofar as it
encompasses them and suspends them in the Whole—which, upon entering in contradiction with
other truths, in the dialectical process reveals itself as partial truth. In the particular case of the
final, true Whole consisting in the Idea, which is no longer a partial truth that must or can be
surpassed. This is why Oakeshott (1991) asserted contradictions lay in inferior categories, but not
so in the Absolute Concept. This seems to actually express Hegel’s belief, for each and every
position or thesis would be surpassed through the development of the contradictions it contains,
but the absolute concept would no longer involve contradictions—which would be the reason why
it would be the final arrival point of human evolution and history, at which perfection and
completion would be achieved. However, this does not solve the problem McTaggart denounced,
which lies in the seeming impossibility to distinguish the two kinds of contradictions envisaged by
Hegel: if reality is itself contradictory (in the general sense of the term, which corresponds to the
second sense in Hegel) and in order to describe reality correctly it will have to be described in
contradictory terms, then how can we determine that it is contradictions that reveal error to be
error (which is what, according to Hegel, impulses the dialectical process toward the final
achievement of the absolute concept that according to Oakeshott represented the final and
1011
definitive surpassing of contradiction)? Mure’s (1965) attempt to justify Hegel before McTaggart’s
criticism seems to have been fruitless. However, some think that in the Encyclopædia Hegel
surpassed the error being discussed.
At any rate, we have seen that Hegel’s dialectic was inverted, as rather than generating ever increasing
truth and completion human evolution generates ever increasing abstraction and fragmentation,
and that the absolute concept, if attained, would constitute a spurious condition (for spuriousness
can only be surpassed by our species if at the end of the time cycle self-consciousness liberates itself
spontaneously).
45
This is why in a previous note it was state that to say the table exists is as valid as to claim the table does
not exist, and to say the structure we call “the table” is a table is as valid as to claim it is not a table—for
contradictory views may be validly asserted from different perspectives—and yet none of these
statements will be correct unless, rather than adhering to one of them as true and taking the opposite as
untrue, we are perfectly aware that each is valid as the other. Cf. Capriles (2004, 2005). (The subject is
also discussed, though with lesser precision and exhaustiveness, in other older, minor works of mine, and
is tangentially touched upon in some older large works of mine.)
46
The ideas expressed in the following passage are implicit in the discussion of the phenomenon of being in
the first chapters of this book; however, at this point is seemed convenient to make them explicit.
47
The term rang rgyud in rang rgyud du khes len pa (“self-directed” or “interior-directed assertions”) is the
one used to refer to the Autonomists or Swatantrikas, because Consequentialists (Prasangikas) considered
that only Consequentialists were utterly free from own-mind and therefore from making assertions from
the heart (i.e., from making self-directed or interior-directed assertions), and hence they discarded the
possibility that Autonomists or Swatantrikas could have posited their autonomous theses and syllogisms
without having own-mind, as other-directed assertions. Gendün Chöphel does not appear to have agreed
with these early Consequentialists, for in the dbu ma’i zab gnad snying por dril ba’i legs bshad klu sgrub
dgongs rgyan (Chöphel [2005]) he says that the way of other-directed assertions “is not just a
Consequentialist way of understanding; all schools upholding the principles of two truths and provisional
and definitive meanings have just the same understanding. Dharmakirti asserted in the
Pramanavarttikakarika, ‘The truth of thatness has no prejudice; with a confident detached stance, one
accepts the material world’.” There is no doubt that other-directed assertions are not an exclusive feature
of Consequentialists, for (as will be asserted below) all Awake individuals (including Consequentialists)
posit autonomous syllogisms without having own-mind and therefore as merely other-directed assertions.
As shown in my Introduction to Chöphel’s book (Capriles [2005]), Tsongkhapa rejected the concept of not
having own-mind and hence not making assertions from the heart (i.e., not making self-directed or
interior-directed assertions); therefore, Gendün Chöphel tells us that, since the terms other-directed /
exterior-directed assertions and self-directed / interior-directed assertions were in the teachings,
Tsongkhapa had to give them a new sense, which is discussed in my Introduction.
48
This may help one to set the Tantric precept obliging one to “lie” in the perspective of one’s degree of
advancement on the Path (i.e., whether one is in the first or second paths, in the third or fourth paths, or
in the fifth path and thus has gone beyond practice). In fact, in the case of beginner bodhisattvas who, in
order to advance on the Path, have to convince themselves and others of what they take as being the
truths of the dharma, what they tell cannot be said to be “lies,” for they really take them to be true. In
their turn, higher bodhisattvas in the state of post-Contemplation have to “lie” to both themselves and
others insofar as they are aware that the teachings of the dharma they have to posit are not really true,
and that there is no self to be liberated in either themselves or others—and since they delusorily value
their perceptions, in this case they experience what they say as being lies... Finally, Buddhas, insofar as
they do not delusorily value whatever they say, are beyond both lying and saying the truth.
49
According to the studies by Frances Moore-Lappé and Joseph Collins, from the Institute for Food and
Development Policy in San Francisco (Moore-Lappé & Collins [1977a, 1977b]; Moore Lappé, Collins &
Rosset [with Esparza] [1998]; in Capra [1982], pp. 258-259), the world production of grain in 1977
would have been enough to feed properly twice the world population of the same year. However, they
made it clear that for this to be so it would have been necessary to radically transform current modes of
production and distribution of food, for these modes of production are designed in such a way as to
provide the rich with extravagant amounts of animal proteins produced from vegetable proteins, by
methods which turn many units of vegetable proteins into a single unit of animal protein and thus reduce
to a fraction the amount of protein available for human consumption—whereas the prevailing
1012
socioeconomic system makes the great bulk of the world population incapable to pay for the nutrients
they need in order to be properly nourished. Moore-Lappé and Collins list as the reasons of this
scandalous injustice: socioeconomic inequality; the unequal distribution of the means of food production;
agroindustrial production and what the great corporations in the food business perceive as being their
own interests; the model of nutrition imposed by transnational corporations and First World governments
(which as we have seen is based on the conversion of great amounts of vegetable protein into small
amounts of animal protein); and the Gargantuan appetites of the “privileged”—including most citizens of
First World States and the “rich” of other regions—who consume most of the products and the energy
produced worldwide. Moore-Lappé (Moore-Lappé [1971]) previously showed how the combination of
different types of vegetable proteins could result in a vegetarian diet supplying sufficient protein to
human beings. Since the higher Buddhist Paths require the consumption of meat, this product should be
produced by the traditional preindustrial means that were not based on the transformation of rich sources
of vegetable protein into relatively poor sources of animal protein (furthermore, in places such as Yörmo
in Nepal, the Buddhist prohibition of killing animals for their meat is honored, and only the meat of
animals dying of natural death is consumed—of course, after processing it in such a way as to prevent the
transmission of potential infectious illnesses).
50
In Habermas (1982), taking interest as a criterion, human action was classified into three main classes:
instrumental, communicative and emancipatory. To Habermas, instrumental action must characterize the
relationships between human beings and the natural environment, whereas communicative action (and,
whenever necessary, emancipatory action) must characterize the relationships between human beings. (In
this regard, Habermas seems to be following a thesis of Engels’. In Fetscher [1971], we read: “In
classless society, which Marx regard as the final stage of social evolution, the problem of the State and
the problem of bureaucracy [will] disappear together. Then there will be no longer domination of man by
man—and instead of dominating persons things will be dominated. In Das Kapital, Marx admits
repeatedly that also in this classless society there will continue to be a certain dosage of subordination
and authority, but it will be objectively conditioned and rationally founded relationships—which Marx,
evidently, regards as compatible with a complete freedom.”)
In proposing the above, Habermas overlooks two important realities:
(1) First of all, he overlooks the fact that, since secondary process works on the basis of primary process, in
trying to determine the experience and behavior of human beings secondary process must face the
limitations imposed by the code of primary process, which makes the attempts by secondary process to
control experience and behavior often give rise to unwanted and unsuspected effects. Once given types of
primary process relations develop—as happens with instrumental relations in the kaliyuga or age of
darkness—and these begin to gain ground in all fields, it is not possible to put a lid to their development
in some fields, confining it to others. This is due to the fact that primary process: (a) lack negatives, and
(b) places the emphasis on relationships, rather than on who is who in them or in the direction of the
relation. Because of the former, the “no” that secondary process may give the development of a primary
process relation in a certain ambit does not function as a negation in the latter code, and on the contrary,
by placing the emphasis on what is being denied, it may foster its development. Because of the latter,
primary process cannot establish hermetic limits between the relations that occur between human beings,
and the ones that take place between human beings and phenomena that are not human beings—and
hence the attempts by secondary process to impose different patterns of relation to the two spheres of
relations cannot be fully effective at the deepest level of our experience.
(2) Besides, it overlooks the fact that instrumental relations with the “natural environment” are at the root of
the ecological crisis that threatens to put an end to all life on our planet. According to the interpretation
of the degenerative view of human evolution and history developed in Capriles (1994a), in the earliest
stage of humankind the non-relational condition that I have referred to by the Christian term
“Communion,” in which the single, divine essence of all essents was directly realized, alternated with the
relational state of post-Communion, in which all relations were communicative insofar as there was still
a residual awareness that all essents were ultimately divine (as we have seen, the reference to an initial
stage when the human lifespan was infinite suggests that in that stage there was no post-Communion, but
I have decided to skip consideration of this). Later on, when Communion became rarer and the relational
state became the only one most human beings could experience, the loss of the capacity of Communion
resulted in the inability to recognize the divine in other human beings and in the rest of nature, and in the
origination and development of the vertical relationship that, as will be shown below in the regular text
1013
of this chapter, manifested in art as the “birth of the gods”—and so after a relatively short time political
power and social and economic differences arose. Parallel to this, the ego delusion continued to develop,
causing us to believe ourselves ever more firmly to be inherently a separate, limited self (or ego), and
therefore giving rise to ever-increasing selfishness (or egotism)—and so with the passing of time the
combination of selfishness, verticality and the incapacity to perceive the divine in nature and other
human beings and to place ourselves in their place caused vertical relations to acquire an instrumental
character. Then came the division into two kinds of human groups represented by the myth of Cain and
Abel, resulting in the exertion of violence against other sentient beings at the root of the Jungian shadow
that, as shown in a previous chapter, catalyzed the development of evil—which then developed into the
exploitation and oppression of other human beings and of the whole of the natural environment, and
finally into what Bateson called conscious purpose against nature.
51
This critique is based on the fact that Husserl’s critique of the “technicalization” of science (Husserl,
Edmund, English 1970) was directed against the formalization of science, rather than implying that a
commitment to technical control was inherent in the essence of science: what Husserl refers to as
technique is mathematics (and in particular geometry), which Galileo and other Plato-influenced
founding fathers of modern science took to constitute the “real world” that is uncovered by science—the
shifting world of appearances being for them somehow and somewhat unreal (whereas according to
Husserl with regard to both worlds it was imperative to maintain the phenomenological epoche—and
thus taking one to be true and the other unreal would be unwarranted). Furthermore, Husserl did not
regard the hard sciences as being ideological, but as being rigorous, and viewed its results as being
unquestionable (though according to him the same was not the case with psychology). At any rate, even
if we accepted that Marcuse arrived at some of his views concerning science and technology on the basis
of a misinterpretation of Husserl’s views, this would not at all mean that his own views in this regard are
wrong. And even if we accepted that “Husserl’s arguments against Galilean realism present problems,”
this would have very little to do with the validity or not of Marcuse’s views on science and technology.
At any rate, no one would claim that Marcuse misinterpreted Heidegger’s radical critique of technology
(Heidegger [1977]), which seems to have been a weightier influence on him, as well as on the rest of the
Frankfurt School (which synthesized Marxian philosophy with elements from Heidegger’s philosophy,
psychoanalysis and other sources).
52
The experienced speed of passing time is directly proportional to the rate of the vibratory activity at the root
of delusory valuation, and therefore when this activity becomes too fast, it becomes untenable and
collapses (which I have compared to a dog running after its own tail whose legs at some point cannot
keep up with the speed, as a result of which the dog falls on it face): at this point, the units of “lived
time” become so small that “subjective” time disintegrates, deactivating delusion.
The acceleration of time and the increase of contradiction as the aeon unfolds are exponential; however, the
first duplication takes many thousands of years... Duplications continue to take place until they occur in
years... And then finally result in the disconnection of the delusory valuation of thought and concomitant
temporality.
53
Toward the beginning of the cycle, negative feedback is determinant and positive feedback has very little
power to influence the human dynamics. As the cycle advances, positive feedback increases its power
and importance, until, toward the end of the cycle, it clearly predominates over negative feedback. This is
why the duplication of the human wayward dynamics and of the acceleration of time happens ever more
often as the cycle unfolds.
54
Having been influenced by left-wing anarchism during his stay in France, Shri Aurobindo became a leftwing activist for Indian independence until he realized he would be killed if he continued along the path
he was following, and hence gave up political activism and went into seclusion, devoting himself to the
practice of Hindu Tantra. He believed that oppression in Marxist states would be the source of the desire
for total freedom that would lead to the extinction of the State. Paradoxically, despite espousing
Tantrism, he believed the Rigveda (the first of the Vedas in the Samhita collection, which is almost
exclusively Indo-European in content) to be the highest of the Vedas, and the Atharvaveda, in which the
nondual doctrines at the root of Communion which had prevailed among the Dravidians surfaced
(together with the magical elements of Dravidian and pre-Dravidian religion and even with elements of
sorcery), to be the lowest of Vedas.
55
This subject is not part of the theme of this book; I dealt with it in length in Capriles (1994a), and thus refer
the reader to the work in question. Here, suffice to say that, among the reasons why the extinction of the
1014
State cannot be achieved by implementing a dictatorship of the proletariat, and why Marxist revolutions
have failed and capitalism has been restored or is on the way of being restored in most ex-Marxist and
supposedly Marxist states, in the above-mentioned work I listed the following:
1) That the reductio ad absurdum of the basic human delusion and all that developed during the present time
cycle had not been completed. As we have seen, since the “no” that secondary process gives to a primary
process structure and function cannot cause the eradication of the structure and function in question, but,
contrariwise, places an emphasis on that which is negated, furthering it and fueling it, there is no way that
an intentional, conscious attempt to interrupt a primary process structure and function may achieve its
goal—and, on the contrary, it is likely to achieve the very opposite of what it intends. As we have seen,
only when the reductio ad absurdum of basic human delusion and of all that developed with it
throughout the cycle has been completed, can this delusion and all that grew with it be surpassed.
2) If people whose psyche reproduces the vertical, instrumental, utilitarian, selfish structure and function
internalized in current vertical, instrumental, utilitarian, selfish societies, manage to obtain political
power and then attempt to transform society, in this attempt they will necessarily reproduce the vertical,
instrumental, utilitarian, selfish structure and function in question. Furthermore, as shown in the regular
text of this chapter, wayward characteristics grow from their own feedback while, in the process of
degenerative evolution, people switch the secondary-process-position they occupy in primary-processrelations of oppression; therefore, so long as the psyche is not transformed in a radical way, there is no
way we can change society in an equally radical way. The conditions for this transformation to be
possible are, among others: that the reductio ad absurdum of delusion be completed, so that radical
change at all levels may become possible; that the practice of the traditions of Awakening may restore
free access to the state of Communion; and that, at the same time as we set out to transform the psyche,
we set out to transform society. This is so because while the internalization of social relations structures
the psyche, the psyche’s actions reproduce the psyche’s structure and so this structure equally structures
society.
3) The third of these reasons is that a dictatorship cannot carry out the dissolution of the State, not only
because it will give rise to an elite that then would cling to power and will struggle to maintain class and
power distinctions, but, more generally, for the same reasons why in 1941 (in the Conference on Science,
Religion and Philosophy that took place in New York) Margaret Mead and Gregory Bateson warned that
democracy could not be implemented by means of social engineering. Bateson (1972) praised and
summarized the paper by his ex-wife, Margaret Mead, in the following words:
“Dr. Mead’s contribution consists in this—that she, fortified by comparative study of other cultures, has been
able to transcend the habits of thought current in her own culture and has been able to say virtually this:
“Before we apply social science to our own national affairs, we must re-examine and change our habits
of thought on the subject of means and ends. We have learned, in our cultural setting, to classify behavior
into ‘means’ and ‘ends’ and if we go on defining ends as separate from means and apply the social
sciences as crudely instrumental means, using the recipes of science to manipulate people, we shall arrive
at a totalitarian rather than a democratic system of life.” The solution that she offers is that we look for
the ‘direction’ and ‘values’ implicit in the means, rather than looking ahead to a blueprinted goal and
thinking of this goal as justifying or not justifying manipulative means. We have to find the value of a
planned act implicit in and simultaneous with the act itself, not separate from it in the sense that the act
would derive its value from reference to a future end or goal...
“...a discrepancy—a basic and fundamental discrepancy—exists between ‘social engineering’, manipulating
people in order to achieve a planned blueprint society, and the ideal of democracy, the ‘supreme worth
and moral responsibility of the individual human person’. The two conflicting motifs have long been
implicit in our culture, science has had instrumental leanings since before the Industrial Revolution, and
emphasis upon individual worth and responsibility is even older. The threat of conflict between the two
motifs has only come recently, with increasing consciousness of, and emphasis upon, the democratic
motif and simultaneous spread of the instrumental motif. Finally, the conflict is now a life-or-death
struggle over the role which the social sciences should play in the ordering of human relationships. It is
hardly an exaggeration to say that this war (i.e., the Second World War) is ideologically about just this—
the role of social science. Are we to reserve the techniques and the right to manipulate people as the
privilege of a few planning, goal-oriented, power-hungry individuals, to whom the instrumentality of
science makes a natural appeal? Now that we have the techniques, are we, in cold blood, going to treat
people as things? Or what are we doing with those techniques?
1015
“(The planners) ignore the fact that in social manipulation, the tools are not hammers and screwdrivers. A
screwdriver is not seriously affected when, in an emergency, we use it as wedge; and a hammer’s outlook
on life is not affected because we some times use its handle as a simple lever. But in social manipulation
our tools are people, and people learn, and they acquire habits which are more subtle and pervasive than
the trick which the blueprinter teaches them... Whenever they meet certain sorts of context, they will tend
to see these contexts as structured on an earlier familiar pattern. The blueprinter may derive an initial
advantage from the children’s tricks; but the ultimate success of his blueprint may be destroyed by the
habits of mind which were learned with the trick.”
4) The fourth of these reasons is that, as Trotsky was right in noting, it was impossible to totally do away with
capitalism (and, even more so, with power and class divisions) in a world in which Capitalism prevails in
most nations. In fact, this results in the nation trying to implement a revolution having to compete against
capitalism in terms of the values, standards and ways of measuring wealth characteristic of capitalism—
when capitalism is most effective in accomplishing capitalistic aims. Furthermore, it exposes the nation
involved in the revolution to meddling in its internal affairs, plots, subversion and so on.
These are only four of the most obvious reasons why Marxist revolutions are most unlikely to succeed in
achieving the transformations they intend to carry out, among those I considered in Capriles (1994a).
56
In the penultimate section of this chapter Ken Wilber’s objections to the use of modern physics to “prove”
mysticism, as laid down in his Preface to the Reader Quantum Questions (1984, Boulder & London,
Shambhala), are considered.
57
The Traditionalist movement arose to defend elitist and anti-egalitarian views, together with a pessimistic
view of ordinary life and of history, and a radical rejection of the modern world; it is thus easy to
understand why it opposed so fiercely the democratic, scientist, evolutionist views of the Theosophical
Society (which validate the Modern project that resulted in the current ecological crisis and that threatens
to put an end to our species, and which hence I reject as radically as those held by the Traditionalist
movement).
The Traditionalist movement began with René Guénon (1886-1951), who after converting to Islam and
moving to Cairo revived interest in the concept of Tradition, which he understood in the sense of
continuity of the teachings and doctrines of spiritual elites in ancient civilizations and religions, and
which he asserted had a perennial value over and against the modern world and its offshoots—which
included humanistic individualism, relativism, materialism, and scientism. Though Guénon asserted that
in the primordial age of perfection there was a single caste, which was called hamsa and which possessed
a very high spirituality, he follows Brahmanic casteism in claiming that, once the division into various
castes took place, the Brahmin caste was the spiritually superior one (Guénon [2001]; Fernández Colón
[2005])—outright contradicting the view of Buddhist Tantrism expounded below in this note. (Check
whether this is the best place to introduce this, or whether it is better to introduce where the
Tantric view is expounded below in this note.)
Other important Traditionalists of the past century included Ananda Coomaraswamy, Frithjof Schuon, Martin
Lings (“Abu-Bakr Siraj-ud-din”) and Julius Evola, who wrote a book on Guénon that referred to him as
“A Teacher for Modern Times” (Evola [1994]). Minor traditionalists among many others are the
French poet and writer Jean Biès, as well as the Italian author Ellemire Zola, who in Zola (1998)
honors Guénon and elucidates the latter’s concept of “tradition,” and Zola’s wife Grazia
Marchianò, a leading follower of Coomaraswamy in the field of comparative aesthetics.
Evola: In Lee (1997), Evola is called a “Nazi philosopher” and it is said he “helped compose Italy’s belated
racialist laws toward the end of the Fascist rule.” In Laqueur (1996, pp. 97-98), he is called a “learned
charlatan, an eclecticist, not an innovator.” Sheehan (1981) and Drake (1986, 1988, 1989) asserted that
Evola supplied ideological justification for the famous bloody campaign by right wing terrorists in Italy
during the 1980, whereas Philippe Rees (1991) affirms that “Evolian-inspired violence result[ed] in the
Bologna station bombing of 2 August 1980.” Evola has been called racist, rabid anti-Semite, mastermind
of right-wing terrorism, fascist guru. During the Fascist era he was somewhat sympathetic to Mussolini
and fascist ideology, but his aristocratic and anti-populist views prevented him from becoming a cardcarrying member of the Fascist party; however, Evola’s anti-materialistic and non-biological racial views
won Mussolini’s enthusiastic endorsement. According to Evola, the cultivation of the “spiritual race”
should take precedence over the selection of the somatic race, which is determined by the laws of
genetics and with which the Nazis were obsessed. After Mussolini was freed from his Italian captors in a
daring German raid led by SS-Hauptsturmführer Otto Skorzeny, Evola was among a handful of faithful
1016
followers who met him at Hitler’s headquarters in Rastenburg, East Prussia, on September 14, 1943.
While sympathetic to the newly formed Fascist government in the north of Italy, which continued to fight
on the Germans’ side against the Allies, Evola rejected its republican and socialist agenda, its populist
style, and its antimonarchical sentiments. When Evola was hit by a bomb in an air raid, René Guénon
wrote to him suggesting that his misfortune may have been induced by a curse or magical spell cast by
some powerful enemy (Evola [1994]); however, despite their close association, and the fact that they
belonged to the same movement, Guénon did not quote Evola in his works—about which the latter
complained. Evola’s main work was Revolt against the Modern World.
Schuon: In Schuon (1986), the author made an extensive and intensive apology of imperialism, propounded a
impossible regress to political forms to a great extent Medieval, expounded extreme elitist views, and
charged against non-creationistic, non-theistic explanations of the origin of the world and of the human
phenomenon—thus indirectly repudiating Buddhism, Taoism and other non-theistic religions and
denying their validity, and thereby contradicting the ecumenicist stand he proclaimed in his books (which
paradoxically include works on Buddhism, just as those by Guénon include studies on Taoism!).
Biès: In Biès (1985) we find a right-wing usage of the degenerative vision of evolution and history, for the
author follows Brahmanic orthodoxy and asserts that in the satyayuga or era of truth, rather than there
being no social, economic or political divisions (as asserted by the original version of the view of
degenerative evolution, as manifest in the Bönpo tradition of the Himalayas, in Dravidian Shaivas and
later Tantrics of India, in Taoists of China, in the Stoics of Greece, etc.), the Brahmin caste prevailed;
that in the tretayuga or era of there the Kshatriya caste prevailed; that in the dwaparayuga or era of two
the Vaishya caste had the upper hand; that in the kaliyuga the Shudra caste comes to prevail; that at the
end of the kaliyuga it is the dalits or untouchables that prevail (which he justified on the grounds that
Marxist revolutions placed political power in the hands of the proletariat—which, by the way, is a
baseless assumption, for though in theory all Marxist states should have been “dictatorships of the
proletariat,” in practice very few Marxist leaders were of proletarian extraction); and that our hopes lie in
the restoration of Brahmin power in the satyayuga of the next cosmic cycle. Biès asserts that the spiritual
systems most appropriate for the kaliyuga are the various types of Tantrism, but, as we have seen, he
contradicts the Tantric view of the satyayuga or krityayuga as the era in which there are no social,
economic or political differences, as well as the Tantric view of the Brahmin caste as the one with the
lowest spiritual potential (see below). Furthermore, he declares the socialist interpretation of the Gospel
and the literal admission of the egalitarian and communitarian statements that abound in it to be a gross
error.
(Above it was noted that according to Tantrism the Brahmin caste is the one with the lowest spiritual
potential. This is due to the fact that Tantrism represented a revival of pre-Indo-European traditions that
viewed the body and its impulses as sacred means for attaining the unconcealment of the divine, and
included among its skillful means the use of alcohol and the Tantric Bacchanals; therefore, the prejudices
and the antisomatism of the Brahmins made them least apt to practice Paths such as those of
transformation and of spontaneous liberation. The Kshatriyas were slightly less unsuitable to practice
these Paths, the Vaishyas even less so, and the Shudras were most apt among caste Indians. Though some
mahasiddhas, such as the great Sarahapada and others, came from Brahmin families, often the greatest
mahasiddhas and realized beings came from the lowest type of untouchables (the Chandalas and
Chandalis, in charge of the disposal of corpses). This inversion of the traditional caste-structure was
reflected in the Tantric appraisal of the spiritual capacity of the members of the different castes. With
regard to the classification of the Tantras into four vehicles, as taught by the Sarmapa Schools in Tibet,
an unpublished manuscript by Chögyäl Namkhai Norbu translated by Adriano Clemente gives us a
summary by Jamgön Kongtrul the Great of the views of Nagarjuna, Rab ’byor bskyans and others:
(“In the Shes bya Kun khyab we read:
(“‘These are four types of disciples of the Buddha: (1) those who appreciate to a greater extent external
practices such as purification and ablutions, who desire to practice the Teaching in this way; (2) those
who are more interested in the real meaning and less in external actions; (3) those who understand that
external actions can be a source of distraction, and therefore dedicate themselves principally to
meditation on the real inner meaning; and (4), those who rejoice in the enjoyments through the nondual
wisdom of method and prajña.
(“‘When these four types of disciple receive a Teaching, they become respectively followers of (1)
Kriya[tantra], (2) Ubhaya[tantra] [or Charyatantra], (3) Yoga[tantra], and (4) Anuttarayogatantra.
1017
(“‘To transmit the Teaching to the four types of disciples in accordance with their inclinations there have
therefore been imparted teachings related to the four types of Tantra: to those who feel greater
attachment and lust, and who in the Hindu tradition are followers of the god Shiva, the method of the
Anuttaratantra was transmitted; to those who are conditioned by anger, who in the Hindu tradition are
followers of the methods linked to Vishnu, the method of the Ubhayatantra was taught; to those who are
more obscured by ignorance, who traditionally follow the methods linked to Brahma, the Kriyatantra has
been taught; to the individuals with undefined characteristics the Yogatantra was taught. These
considerations are explained in the De nyid ’Dus pa, which contains the way of seeing of Masters such as
Nagarjuna, Rab ’byor bskyans and others.”
(“And furthermore:
(“‘The (Anuttarayogatantra titled) Dur khrod smad du byung ba rgyud maintains that in order to discipline
Brahmins, Kshatriyas, Vaishyas and Shudras with the Teaching, and to carry them onto the Path, the four
series of Tantras were transmitted, namely the Kriya[tantra], Ubhaya[tantra or Charyatantra],
Yoga[tantra] and Anuttara[yoga]tantra.
The (Tantra titled) rDo rje gur (mkha’ ’gro ma dra ba rdo rje gur zhes bya ba’i rgyud kyi rgyal po) states:
(“‘To those with an inferior capacity the Kriyatantra was taught.
(“‘To those with a medium capacity the Ubhayatantra was taught.
(“‘To those with a superior capacity the Yogatantra was taught.
(“‘To those with a supreme capacity the Anuttara[yoga]tantra was taught’.”)
58
Though Wilber’s system of fulcra as a whole, which purportedly applies to all spiritual Paths, does not
correspond to spiritual development on any Buddhist Path, I have found no self-evident blunders in his
explanation of the succession of lower fulcra in ontogenesis.
59
His entourage featured one thousand and two Buddhas who shone with the brightest of lights—which
meant that in this propitious aeon one thousand Buddhas and two supreme bodhisattvas would manifest.
60
Namkhai Norbu and A. Clemente (1999, p. 265) name a full series of texts later than the Rig pa rang shar,
which list the names of the Masters in question. Here I will mention only the Treasure of the Supreme
Vehicle or Tegchog dzö (theg mchog mdzod) by Longchen Rabjampa (klong chen rab ’byams pa); for the
complete list, cf. the above-referred book by Norbu and Clemente.
61
So far as my studies go, the teachings do not seem so clear in this regard. The claim that in the first period
of all time cycles the duration of human life is limitless seems to imply that there is no post-Communion
state, for it is in the Communion state that the timeless condition of Total Space-Time-Awareness
manifests, whereas in the post-Communion state there is the experience of the passing of time (which
may be slower of faster according to how far the time cycle has developed).
However, since the idea that the whole of humankind (or the part of humankind that survives the massive
upheavals and destruction at the end of the time cycle) may attain full, irreversible Awakening
simultaneously as the cycle ends does not seem so plausible to our mentality in the beginnings of the
twenty-first century CE, I will assume throughout this chapter that in the initial period of a cycle and in
the millennium announced by the Kalachakra Tantra a Communion and a post-Communion state
alternate.
62
Cf. the preceding note.
63
The concept of neue Mitte was issued by Gerhard Schroeder, but Angela Merkel in her coalition
government set to follow the same model (which had already been deemed unavoidable by Kohl).
64
In Wikipedia we read (at the URL http://en.wikipedia.org/wiki/Iraq_War):
Total deaths (all excess deaths) Johns Hopkins - As of June 2006: 654,965 (range of 392,979–942,636).
601,027 were violent deaths (31% attributed to Coalition, 24% to others, 46% unknown)[1][2]
War-related & criminal violence deaths (all Iraqis) Iraq Health Minister. Through early November 2006:
100,000-150,000[3][4]
War-related & criminal violence deaths (civilians) Iraq Body Count - English language media only: 69,04575,495[5]
[1] "Mortality after the 2003 invasion of Iraq: a cross-sectional cluster sample survey"PDF (242 KiB). By
Gilbert Burnham, Riyadh Lafta, Shannon Doocy, and Les Roberts. The Lancet, October 11, 2006
[2] The Human Cost of the War in Iraq: A Mortality Study, 2002-2006PDF (603 KiB). By Gilbert Burnham,
Shannon Doocy, Elizabeth Dzeng, Riyadh Lafta, and Les Roberts. A supplement to the second Lancet
study.
[3] "Iraqi death toll estimates go as high as 150,000". Taipei Times, November 11, 2006.
1018
[4] "Iraqi health minister estimates as many as 150,000 Iraqis killed by insurgents". International Herald
Tribune. Nov. 9, 2006.
[5] Iraq Body Count project.
65
The quote from Roszak in Taylor (2005, p. 240) is:
“Tribal societies have abused and even ruined their habitat. In prehistoric times, the tribal and nomadic people
of the Mediterranean basin over cut and overgrazed the land so severely that the scars of the resulting
erosion can still be seen. Their sacramental sense of nature did not offset their ignorance of the low range
damage they were doing to their habitat.” (Roszak, 1992, p. 226)
66
For example,
cite the salmon in p. 241 and then other Amerindians in pp. 242-243...
67
American Indians, just like the most ancient pre-Buddhist Tibeto-Burmans from Zhang Zhung and the
aborigines from different regions, seem to have found themselves in a pancommunicative condition and
therefore related with natural phenomena as though they were persons rather than mere lifeless things.
The best-known example of this attitude among North American Aborigines is the words Chief Seattle,
the patriarch of the Duwamish and Suquamish Indians of Puget Sound, was supposed to have
pronounced in 1854—which, however, are now the subject of polemic, as shown in the following excerpt
from Bracho (2005):
“A certain historical controversy has arisen concerning what Chief Seattle exactly said or did not say. This
controversy has been fed both by legitimate reasons and by factions interested in undermining the
indigenous-ecological movement. Concerning the former (the only ones that will be dealt with in this
work), they were perhaps to be expected, since Seattle did not read or left any written record of his own,
but spoke in an inspired way, as was the custom in his culture and as was proper of a powerful natural
speaker like him.
“Furthermore, he did so in his own language, the Lushootseed, from which it was necessary to translate to the
Chinook, a dialect arisen from the mixture of indigenous languages, French and English, which was the
commercial lingua franca in the area—from which it was necessary to translate into English for the ears
of Commissioner Stevens. In such a chain of translation... surely much of the original could be lost. Then
the passing of time and the “transcribing liberties” of those who carried down the original, added more
[potential sources of distortion]...
“However, in spite of all the above, the available historical evidence, including checking against the oral
testimonies of the descendants of Seattle’s own tribe, as well as comparison with other indigenous
traditions, have corroborated the basic authenticity and coherence of what has arrived of Seattle’s
discourse to our time.
“The latter includes the there main versions of it that are known today: the one by Henry Smith, Seattle’s
contemporary and eyewitness of the discourse who published his transcription of it thirty years later; the
version of the end of the 1960s produced by Texas University researcher William Arrowsmith... who
rendered the more ornate Victorian English in the transcription of his predecessor into a plainer English
more in agreement with the Indian style, making his text public during the celebration of the first “Day of
the Earth” in 1970; and [the one by] professional script writer Ted Perry, a teacher at the same
University, who adapted and modified Arrowsmith’s text for an ecological-educational video
commissioned by the Christian church of the Southern Baptists through its producer John Stevens...—a
version that catapulted Seattle to the national and international celebrity he now enjoys, mainly after its
publication in Passages, the magazine of Northwestern Airlines...
“From all three versions, beyond their greater or lesser fidelity to what Seattle really said, a common message
follows that is responsible for the universal impact the discourse has had. A message that could be
expressed in the following terms: ‘If every corner of our land is sacred to us and our venerated
forefathers, if we do not consider ourselves to be owners of the sky, the water and the earth, how could
we pretend to sell them to you and how could you pretend to become their owners’. A message that
makes it clear that the human being is a custodian rather than the owner of the Universe, and who
therefore has the duty of responsibly caring for it, rather than of selfishly owning it.”
The letter Chief Seattle supposedly wrote to US President Franklin Pierce in 1855, is now universally known
to be a hoax, and the purported discourse chief Seattle gave in 1854 (or 1855), as reported by Henry
Smith in 1887, has not been proven beyond the slightest shadow of doubt to be genuine either (cf., for
example, the evaluation of the various documents discussed above at the URL
http://members.aol.com/pantheism0/indians.htm). However, Henry Smith’s version was published during
1019
his lifetime (in 1887), and so there are no doubts as to its authorship; since it seems hardly possible that a
man of European descent would put in the mouth of an Indian sage like Seattle, utterly non-European
ideas which express so masterfully the North American aboriginal worldview, we are bound to conclude
that they reflect to a greater or lesser degree what Seattle said in his discourse—and therefore that Bracho
is not likely to be hallucinating when, in the above-quoted excerpt, he notes that the attempts to dismiss
Smith’s transcription of Seattle’s discourse may be due to an interest factions share in undermining the
indigenous-ecological movement. At any rate, here I am not concerned with the historical reality of
falsehood of Seattle’s words, for this book, rather than having scientific pretensions, is intended to
express a narrative that I believe may help our species take the road to a bright future rather than that to
self-destruction.
Furthermore, manifold documents attest to the pancommunicative attitude of American aboriginal sages and
their astonishment before the attitude of the European invaders toward the so-called natural
“environment.” Many statements by American aboriginal sages, including the remarkable statements by
Sitting Bull, were reproduced in Harrison, Paul, 1997. As a token of the texts offered, consider the
following, extremely brief statement by Sitting Bull:
“Every seed is awakened and so is animal life. It is through this mysterious power that we too have our being
and we therefore yield to our animal neighbors the same right as ourselves, to inhabit this land.”
68
Neo-liberal thinking in the sense I am giving the term (i.e., in that of the economic ideology of Hayek and
the Chicago Boys) insists on the need to allow the economy to regulate itself through “the invisible hand
of the market “ However, as shown in Bairoch (1995), the most extraordinary myth of economic theory is
that free markets provide the path to development, for the industrial crown jewels of the world’s most
dynamic and powerful economies became what they are today due to State subventions and other forms
of interventionism. He writes:
“It is difficult to find another case where the facts contradict so directly a dominant theory.”
For his part, Noam Chomsky (Chomsky & Dieterich [1997], p. 27) notes that Bairoch undervalues the
importance for the rich of interventions by the State, because he limits himself in a conventional manner
to a restricted category of market interferences.
69
With regard to the fact that laws give rise to the evils they are supposed to contain, besides fact that a ”law
of inverted effect” is inherent in the relations between primary and secondary processes (associated with
the two cerebral hemispheres), or to the associated relations between conscious identity and the
unconscious phantasy which is the Jungian shadow, there is the fact that laws require enforcement, and
those who enforce them are corruptible humans; therefore, law begets corruption.
70
The loss of the tao is illusory, for in truth the “Fall” corresponding to the loss in question is part of the tao’s
flow, and the same applies to all thoughts and acts of human beings after this “Fall.” In other words, what
is lost is not the tao qua Base, but the unveiling of the tao qua Base that here I have been referring to as
the tao qua Path and the tao qua Fruit. The term here translated as “virtue” is te, which refers to the tao’s
virtue in the sense in which one speaks of the “healing virtue” of a plant: it is not “virtue” in the Kantian
sense in which a person is said to be virtuous when she or he resists the impulses issuing from
selfishness, and artificially sets to help others. The way the tao’s te or virtue remains after the tao is
veiled has been compared with a mothball that has been removed from a drawer, without its smell
disappearing from the drawer.
71
As we all know, St. John Evangelist lived in Ephesus—Heraclitus’ place of birth—and his usage of the
word can but remind us the Ancient Greek philosopher’s use of the term. It is significant that the
translators of St. John’s Gospel into Chinese rendered “Logos” as “tao,” so that the Gospel begins “In the
beginning there was the tao.”
72
The state of Communion (being) beyond conceptualization, it does not involve interpretation of the nature
of the whole as either “divine” or “profane.” However, in the post-Communion state, in which there is
conceptualization, one may conclude that the true nature of all reality that became patent in the state of
Communion is “divine” or “sacred” with regard to the fragmentary perceptions involving the delusion of
self-being that manifest in post-Communion (or with regard to those that manifested before Communion
occurred for the first time). Furthermore, as one becomes increasingly familiar with the state of
Communion, in post-Communion one ever more easily recognizes the divine in the profane, so to speak.
As it becomes increasingly difficult to access the state of Communion, at some point it becomes utterly
impossible to recognize the divine in the profane, and as a result all and everything is perceived
profanely: this is what Max Weber called “die Entzauberung der Welt” or “the disenchantment of the
1020
world,” and that Schiller called “die Entgöterung der Natur” or “disdeification of nature”—which,
however, as understood here is something that took place long before the “moments” (so to speak) at
which these authors placed this occurrence.
73
This will be touched upon once more below with regard to Roszak (1992). At this point, suffice to say that
degeneration in those peoples that in our time still have a tribal structure and function occurs
independently of whether or not they interact with “civilized” peoples, and that in the former it proceeds
differently than it does in the latter. For example, unlike the peoples of the Paleolithic as envisaged in
this “metanarrative,” most tribal peoples of our time have a predominantly shamanic spirituality that not
always conserved metashamanic elements. Likewise, though peoples such as the Yanomamis are, from
the technical standpoint, in the Paleolithic, unlike the European and North-African humans of the
Paleolithic studied by paleopathologists, Yanomami groups recurrently wage war against other
Yanomami groups—and, moreover, all such groups have ritual ways for their members to engage in
fights with members of their own group. Furthermore, anthropologists have commented on the supposed
cruelty of Yanomamis toward their domestic animals. Of course, we cannot be sure that all this is not a
result of their encroachment by “civilized” peoples, but at any rate the American aborigines—including
those that did not know metallurgy—waged war long before the arrival of the European invaders.
(The above does not mean that no American aborigines had entered the Age of Metals before the arrival of
Europeans. In Porterfield, Kay Marie, 2002, we read: “Although the polar Inuit near Baffin Bay did use
meteorites to make iron blades, for the most part, other American Indians did not work with iron (a
prerequisite for entering the Iron Age). American Indians did begin making metal tools before Europeans
did. The people of the Old Copper Culture in the Great Lakes region of North America 7,000 years ago
are considered by many scientists to have been the oldest metal workers in the world. They developed
annealing to strengthen the tools they made. Pre-Columbian metal workers invented sophisticated
techniques for working with other metals. Pre-contact metallurgists living in what are now Ecuador and
Guatemala learned how to work with platinum, a metal that has the extremely high melting point of 3218
degrees by developing a technique called sintering. Europeans were unable to work platinum until the
19th century. Metal workers in other parts of the Americas knew how to solder, could make foil and used
rivets to fasten pieces of metal together. In areas where no metal deposits lay close to the surface,
American Indians made tools of bone, wood and stone. The blades of their flint surgical instruments were
so thin that the incisions they made could not be duplicated until the advent of laser surgery.”)
74
Moreover, beside being aware of the divine in nature and as nature, many aboriginal tribes seem to have
been aware that a superficial, essentially mistaken sense of self-identity may conceal our true condition,
and, as Taylor reminds us, asserted human beings have two souls: one that is fundamental and real, and
another one that is the “trickster,” which in his paper he shows to correspond in most respects to
identification with the ego (Taylor [2003], p. 66). This may be a distortion, arisen when access to the
state of Communion became more difficult and less ubiquitous, of the contrast between realization, in the
state of Communion, that there is no individual soul, but only a universal principle (which here is turned
into the “real soul”), and that the belief in individuality is no more than a fiction (corresponding to the
trickster). There is abundant literature regarding the trickster in transpersonal disciplines; for a short
discussion, cf. Krippner (2002).
75
Cf. note 50 to this chapter.
76
Indo-Europeans supposedly introduced an extreme androcentrism in Eurasia, and the Semitic peoples
supposedly introduced patriarchate as such. At some point both peoples are thought to have found
themselves established in arid regions that were not apt for the extensive practice of agriculture, and so
they concentrated on cattle breeding and especially on shepherding. It was probably later on that they
established themselves in places of difficult access, from which they began raiding their neighbors in
order to appropriate their agricultural products, women and riches in general. Thus the gods that arose
with the theogenesis seem to have developed into two kinds of gods: one kind represented the state of
Communion and became symbols used for gaining access to this state (as was the case with the gods that
according to Daniélou (1992), shared the same origins and identity, such as Shiva in India, Dionysus in
Greece and Osiris in Egypt; and, as I myself have shown [1997c, 1998a, 1998b, 1999c, 2000b, 2003],
also Zurvan in Persia and the Yandag Gyälpo in the Himalayas) and one kind that was invoked in order
to obtain supernatural help in the war against enemies (such as the Yaveh of the Semitic peoples—which
as Marija Gimbutas [1989] has shown by quoting the oldest invocations and prayers to this deity,
originally was a blood-thirsty divinity invoked before combat—and the gods of the Indo-Europeans).
1021
In Capriles (2000b) I suggested that the myth of Cain and Abel may have referred to the relation between the
Semitic shepherds, on the one hand, and the agricultural peoples of high antiquity in most of Eurasia, on
the other—and that it also applies to the relation between the Indo-European equivalents, or the Semites,
and neighboring agricultural peoples. As is proper of the dynamics of the Jungian shadow, which at the
time was developing at an extremely rapid pace, the shepherding Semites attributed aggression—which
in truth was exerted by the shepherding peoples, which attacked their agricultural counterparts—to Cain
as the symbol of the agricultural peoples. Furthermore, the myth itself insists that only blood may wash
away a sin, and the blame attributed to Abel was precisely that he was not offering blood to God: on the
one hand it presents God as blood-thirsty, as proper of a demonic deity of war and aggression, and on the
other it demands for actions that necessarily result in the development of the shadow and therefore of evil
(it has been claimed that also the peoples of ancient Eurasia that later on were conquered by IndoEuropeans and Semites carried out animal sacrifices, but the myth of Cain and Abel suggests the
opposite—and, at any rate, had agricultural peoples actually carried out animal sacrifices, it is clear that
shepherding peoples placed a greater emphasis on the need for these sacrifices, for their diet required a
far greater amount of animal slaughtering than did that of agricultural peoples).
For an account of the bellicose character of Indo-Europeans and their religion, cf. Eisler (1987); Bocchi &
Ceruti (1993); Gimbutas (1989, 1982). However, the fact I refer to the works by Eisler and Gimbutas
does not mean I endorse ecofeminists who posit and eulogize a stage of goddess-worship previously to
the worship of male gods, nor does it mean I view goddess worship is the ideal of ecological integration,
for I agree with Cauvin (1987, 1998/2000) that the introduction of both male gods and female goddesses
are the main signs of the “Fall” that resulted in the loss of the sense of divinity of this world and in
general of primordial plenitude, equality, harmony and so on, and I also agree with Rosemary RadfordRuether (1992), that we should not assume that the agricultural peoples of Eurasia that later on were
conquered and dominated by the Semitic and Indo-European peoples (such as for example the
Sumerians, the Elamite and the Dravidians) were totally non-violent and absolutely egalitarian (socially,
economically, politically or sexually), as were human beings in the Golden Age: although violence and
verticality were less developed among the agricultural peoples in question, among them these vices and
defects had already developed to a considerable extent.
As to the reasons why both Semitics and Indo-Europeans turned into conquerors and dominators, DeMeo
(1998) may be right that there was a massive process of desiccation of previously fertile lands, but it
seems to me quite likely that this process was produced by the interactions of the inhabitants of those
lands with their natural environment (in which a key element may have been the massive breeding of
goats and sheep)—and, at any rate, the process of Fall is inherent in the psychophysical constitution of
human beings rather than being a product of fortuitous environmental occurrences. Furthermore, at first
sight DeMeo does not seem to be a serious researcher—even though some of his critics (for example,
Correa & Correa [2002]) do not seem to be any more serious than DeMeo himself.
77
In Eliade & Couliano (1990), an attempt is made to show that Manicheans would not have been so
decidedly antisomatic; however, I believe their religion must be decidedly classed among antisomatic
systems.
78
Though Buddhist systems based on renunciation never posited two substances, one material and the other
spiritual, they often represented the body as impure (for an example cf. Shantideva [1996], p. 115). In
their turn, though the Jainas did not explicitly assert the physical world to be impure or a source of evil,
they posited an ultimate distinction between “living substance” or “soul” (Skt, jiva) and “nonliving
substance” (Skt., ajiva), demanding that whatever had soul be absolutely respected; though this may
seem to imply all that had no soul needed not be respected, all that had no soul was full of living
substances having soul and so it had to be respected for the latter to be respected.
79
Since the hand toil that followed the birth of the gods was not a punishment inflicted by an almighty god,
like the one Adam and Eve suffered according to the Book of Genesis, and in Cauvin’s view (1987,
1998/2000) neither was it the result of ecological pressures, but the outcome of the psychological
mutation that gave rise to the gods, if Cauvin were right we should be capable to explain the reasons why
it occurred. In this case, among the aspects of this mutation that may have been more determinant we
may hypothesize the following:
When we uninterruptedly feel separate from the flow of our true condition, leisure, which formerly occupied
most of our time, is no longer a precious opportunity for relaxing in the plenitude of the state of
Communion and for carrying out a series of gratifying activities; we are bound to project the concepts of
1022
monotony and boredom, which cause us to reject experience, giving rise to unpleasant sensations, which
then we may try to avoid by means of arduous and uninterrupted work. (In works about the life of huntergatherers and horticulturalists of our time we read that they sometimes feel extreme tedium and worldweariness; for an example, cf. Lizot [1985].) At any rate, when we feel that we are the separate,
autonomous sources of our own actions, these actions seem to take place as a result of our own effort;
therefore, it seems logical that once we can no longer surpass this illusion, the satisfaction of “natural
needs” comes to depend on effort (at any rate, work as a means to an end can only arise once natural
spontaneity has been replaced by the illusion of personal agency).
Since we can no longer surpass the illusion of separateness in aletheia and thus recover plenitude, sooner or
later we may come to believe that that the production of a greater amount of goods by means of
agriculture and animal breeding perhaps may allow us to recover it. Etc.
80
Marx wrote concerning Feuerbach: “With one blow, [Feuerbach] pulverized the contradiction [inherent in
idealism] and without circumlocutions... placed materialism on the throne again...” However, Marx also
noted that Feuerbach: “stopped halfway; the lower half of him was materialist, the upper half idealist.” In
this regard, cf. Marx (undated).
It is widely assumed that Marx’s system inverted Hegel’s in that, among other things, it placed matter at the
beginning of the dialectical process, asserted the idea to be a product of the evolution of matter, and set
out to explain the material conditions of the evolution of our species. Although in his book Dialectics of
Nature (1998/2001) Engels transformed Hegel’s dialectical idealism into a dialectical materialism, and
the resulting system and method is often taken to be Marxist, Marx did not adhere to it. At any rate, Marx
made more flexible the schema thesis - antithesis - synthesis-that-becomes-thesis, which for Hegel
proceeded automatically (according to some, doing with it precisely what Hegel had criticized in his
predecessors and contemporaries). In particular, for Marx there is no “necessity”—not even an internal
one—for human and social development to follow any specific schema from beginning to end.
Furthermore, though Marx admitted a precedence of the infrastructure over the superstructure or
ideology, this did not imply an absolute determinism, for the evolution of the human species is the
evolution of the possibilities to influence social structures and thereby influence the mastery that human
beings can come to have over themselves (it was mainly Engels who insisted that the superstructure—
i.e., ideology—was conditioned by the infrastructure; however, at the end of his life Engels declared that
the motor of evolution was actually “the needs of development of the human spirit”).
Louis Althusser asserts that Marx failed to carry out the required complete inversion of Hegel because he kept
the belief that teleology was at work in the development of our species. Though the view that Marx kept
to some extent the belief that teleology was at work in the development of our species, this would not do
any harm if it were posited as a narrative, making it clear that it is no more than a narrative. Where Marx
and Engels clearly failed was in inverting the Hegelian conception of evolution and history as progress,
perfecting and improving.
81
In Capriles (1994a), I carried out a comprehensive critique of Marxism, involving, among others, that of the
aspects listed in note 44 to this chapter. Concerning the particular point under discussion, though Marx
and Engels purportedly inverted Hegel’s view of history, as stated in the preceding note and elsewhere in
this chapter, they failed to carry out a thorough inversion of Hegel’s view, for despite the fact that they
asserted perfection to lie in the surpassing of the State in all possible forms, and in surpassing private
property, the family and so on, rather than in the Prussian State of their time, they kept the basic
conception of evolution and history as a process of improvement that would conclude with perfection.
Habermas broke with Marx and Engels in many crucial points, but he kept the same belief that evolution
and history were a process of progressive improvement. For his part, Wilber produced a system based on
an analogy between his own view of ontogenesis (criticized in the preceding chapter of this book) and the
views on phylogenesis found in Habermas (1979), and Beck & Cowan (1996).
82
The Communion state is beyond existence, for it is does not involve that which Heidegger called eksistence and that Sartre expressed as “being outside one’s Self”—and hence the limitless wealth inherent
of that condition may not be properly called “existential.” However, Walter Weisskopf (1971) coined this
term to refer to the subjective sensation of wealth, and Fritjof Capra (1982) made the term so popular that
there seems no way to avoid its usage. For an explanation of this concept and its connection with the
views of Tibetan Buddhism and Taoism, as well as an in-depth critique of the Marxist view of economic
value using at length arguments by Piotr Kropotkin (1943; cf. also Cappelletti [1978])—who showed
value and plusvalue—basis of the Marxist principle of distribution under socialism—to be
1023
imponderable insofar as they involved the work for producing all that was involved in the process
of manufacture, including railways, trucks, roads, machinery, buildings, clothes, and so on to the
extent of covering practically all that has been produced by humankind ), Joan Robinson, Ivan Iilich
and Manfred Max-Neef, as well as Weisskopf and Capra, among several others, cf. Capriles (1994a),
Chapter III, “El valor y los valores: crónica de una caída,” section “El valor económico.”
83
In 1845 Marx wrote Die heilige Familie oder Kritik der kritischen Kritik, eine Streitschrift gegen Bruno
Bauer zur Aufklärung des Publikum über die Illusionen der spekulativen Philosophie und über die Idee
des Kommunismus als die Idee des neuen Weltzustandes (The Holy Family, or Critique of the Critique.
Polemic against Bruno Bauer for the Enlightenment of the Public Concerning the Illusions of Speculative
Philosophy and the Idea of Communism as Idea of the New Worldwide State), and in 1848 Marx and
Engels wrote the Communist Manifesto (Manifesto of the Communist Party).
84
I am not saying that all of Bachofen’s views concerning pre-civilized communities is outright wrong;
contrariwise, I believe a sizable portion of it may be correct (even though I really doubt we may speak of
matriarchate as such: for my theory of the social position of genders in different stages of the
degenerative spiritual and social evolution of humankind, cf. Capriles [1994b]). What I contest is mainly
the validity of applying these views to the earliest Germans, for, as indicated in a previous note, IndoEuropeans supposedly introduced an extreme androcentrism in Eurasia (whereas patriarchate as such was
supposedly introduced by the Semitic peoples).
85
See note 50 to this chapter.
86
When primary process intuition was infallible there was no need for the critical function of secondary
process (except perhaps for Awakening, at least to some extent in certain stages). As fallibility
developed, the critical function of secondary process became more and more important, though at the
same time it introduced a further, major obstacle to Awakening.
87
Just by the way, Popper questioned the supposed absence of indeterminacies, and particularly of “uindeterminacies,” in classical physics. In order to prove on logical grounds that classical physics is
indeterministic insofar as it contains u-indeterminacies, he said theories were indeterministic if at least
one event was not completely determined in the sense of being not predictable in all its details (Popper
[1950-1951]). He derived this conclusion by showing that no “predictor”—i.e., a calculating and
predicting machine, or, in today’s terms, a computer—constructed and working on the basis of classical
principles, is capable of fully predicting every one of its own future states; nor can it fully predict, or be
predicted by, any other predictor with which it be in interaction. Popper’s reasoning has been challenged
by G. F. Dear on the grounds that the sense in which “self-prediction” was used by Popper to show its
impossibility is not the sense in which this notion has to be used in order to allow for the effects of
interference (Dear [1961]). Dear’s criticism, in turn, has recently been shown to be untenable by W.
Hoering (1969) who, on the basis of Leon Brillouin’s (1964) penetrating investigations, argued,
“although Popper’s reasoning is open to criticism he arrives at the right conclusion.”
88
More recently, Jacques Derrida (1967) “deconstructed” Claude Lévi-Strauss’ theories concerning the
secondary role of written language with regard to spoken language, and the role of the former in the
relation between the development of writing and that of evil, violence, social stratification, privilege,
domination, enslavement, proletarization, state control and so on, by showing the subterfuges LéviStrauss used to demonstrate his theories, and in particular how he consciously ignored the manifestations
of violence in the Nambiquara society, with the aim of showing that Lévi-Strauss’s attempts to ratify the
scientific credentials of his own theory of writing were characterized by a tremendous lack of rigor, even
though he pretended to have surpassed the categories and abstractions of the traditional philosophical
discourse. Derrida’s extension of the field of writing—both empirical and essential—to a great extent
intended to make evident the fundamental ethnocentrism of the Lévi-Strauss’ distinction between literary
and nonliterary cultures. Thereby Derrida supposedly was attacking not only ethnology—the very object
of research of which (the nonliterary culture) was founded on this distinction, and the regenerating
mission of which lay precisely in its criticism of ethnocentrism—but the very heart of the “scientific”
project and enterprise. Thereafter Derrida applied his method profusely, and in fact it may be applied to
most scientific theories and constructions in order to show them to be baseless. Derrida also applied his
method to philosophy, and the results were practically the same as in the case of scientific theories.
Derrida views all philosophical constructions as candidates for deconstruction, except when these
constructions present themselves as mythology and relate, in which case they can hardly be candidates
for deconstruction.
1024
89
Tim Maudlin says there are two Kuhns, one moderate and the other one unruly, which are mixed up in The
Structure of Scientific Revolutions (Sokal & Bricmont [1999], p. 85 of the Spanish version; the
discussion of Kuhn goes from p. 82 to p. 88 of the Spanish version). Though there seems to be no solid
basis for this conclusion, Sokal and Bricmont are right in their objection that, if the inductions based on
the available data cannot give rise to trustworthy results in physics or biology, then they cannot give rise
to trustworthy conclusions in the story of science, either. However, Kuhn’s arguments and conclusions
are less liable to ideological manipulation than those of experimental science (in experimentation, the
design of the experiment is determined by the results the scientist expects to find, and it is he himself
who does the observations, which may also be conditioned by his or her expectations; in the case of the
history of science, what is interpreted is the records elaborated by the scientists themselves after having
had to modify their theories or paradigms, or the records elaborated by historians on the basis of these
records—which are far less liable to ideological manipulation than the design and observation of
experiments carried out by the scientists themselves), and even if we are not allowed to take them to be
“hard facts,” we can use them as provisional, disposable antidotes to the belief that the results of the
“hard sciences” are “hard facts;” in other words, we may use them in the way in which below in this
section I propose that the conclusions of the hard sciences may be used as antidotes to the
substantialistic, discrete views of common sense.
90
Though some of the criticisms of Feyerabend carried out in Sokal & Bricmont (1999, pp. 88-94 of the
Spanish version), are to the point, they do not invalidate Feyerabend’s general judgment on the sciences,
which is equally to the point, and they do not justify the deriding, mocking tone of Sokal and Bricmont’s
evaluation of the German-born philosopher of science. For example, Sokal and Bricmont are right in
noting that from the premise “all methodologies have their limits” it does not follow that “everything
goes;” however, from this, the conclusion they draw with regard to Feyerabend—that he is the buffoon of
the court of the philosophy of science—does not follow either. This is not the place to discuss the
criticisms Sokal and Bricmont make of Feyerabend; suffice to say that, provided we are able to
discriminate between founded and unfounded criticisms, Sokal and Bricmont’s discussion of Feyerabend
may be helpful to place the author in perspective and determine which of his arguments may be accepted
and which must be rejected.
91
In Sokal & Bricmont (1999), Deleuze is criticized in two different sections of the book; however, the theory
according to which philosophy and the sciences are “more than ideologies” is not among the objects of
this criticism.
92
It seems to be no coincidence that Erasmus ended up confronting Luther and the Reformation, which, as I
tried to show in Capriles (1994a), prepared the ground for the development of material “progress” and
the implementation of the modern project in general.
93
It is significant that, in the same paragraph, Erasmus speaks of God as the “great architect of the Universe”
and quotes (saint) Bernard of Clairvaux, who was a cousin of the founder of the Knights Templar.
94
A civilization over 12,000 years old was discovered at the beginning of the 21st century, submerged just in
front of the Western Indian coasts; however, since its exploration has not gone far enough, there is no
way to determine the interests behind it. In the building of the Egyptian pyramids an instrumental interest
seems apparent, but it is with the Pythagoreans of Alexandria, less than two and a half millennia ago, that
the pace of development of instrumental science and technology knew a more marked increase. Then the
triumph of Christianity produced a recess in the development of instrumental science and technology,
until the Middle Ages began to dream of the golem, which was developed in the last five centuries, since
the time when the Modern Age is supposed to have begun.
95
The advertent reader may have realized that, in my view, the roots of inherently instrumental science and
technology go much farther back in time than Marcuse believed, and their development in the course of
the present time-cycle is inevitable and has a key function in the reductio ad absurdum of all that must go
out of human evolution.
96
Cf. note 50 to this chapter.
97
Berman (1984) based this concept of Max Weber’s idea of “die Entzauberung der Welt” or the
“disenchantment of the world,” which in its turn had precedents one century before in Schiller’s concept
of “die Entgöterung der Natur” or the “disdeification of nature.” However, if we understand the term
“disdeification of nature” in the sense of nature ceasing to be perceived as the direct manifestation of the
divine, rather than in the sense of ceasing to perceive it as being filled with deities, then this process
began much earlier than Schiller thought: the first major step in it may have been the one that gave rise to
1025
the theogenesis reflected in the manifestation of the gods in art discussed by Jacques Cauvin (1987,
1998/2000). In its turn, the disenchantment of the world seems to have begun when human beings moved
beyond the pancommunicative stage, ceasing to perceive the phenomena of nature as having personality.
(CHECK WHETHER THIS NOTE IS NOT REPEATED.)
98
According to Marcuse, this change in the interest at the root of science would carry with it key changes in
its context, for its hypotheses, without thereby losing their rational character, would develop in the
essentially different experimental context of a pacified world; consequently, science would arrive at
essentially different concepts of nature and establish essentially different facts.
99
With regard to the views Marcuse expressed in ch. 6 of Marcuse (1964) and very briefly reviewed in other
endnotes to this chapter, Habermas (1984) admitted that modern natural sciences are inherently
committed to a view of nature as an object to be manipulated and controlled, and that a science of human
beings based on the model of the natural sciences will be equally committed to a view of humans as
objects to be manipulated and controlled; furthermore, he partly admits that this implies a necessary
relation between the scientific domination of nature and the scientific domination of humans. However,
Habermas does not admit that modern natural science is historically specific and not the only form that
science can take, or that the liberation of both humans and nature requires a new science and technology
grounded in a different interest. This is connected with the fact that he asserts that nature does not act as
an interlocutor with whom human beings can maintain communicative relationships, for it does not and
cannot reply to our messages. However, it is a fact that in the pan-communicative stage human beings
perceived natural phenomena and related to them as though they were subjects, and, as we have seen,
their interventions in the natural environment improved biodiversity (as shown in the regard to
Amazonian aborigines in Descola [1996]), whereas in the pan-instrumental stage the interventions of
human beings devastate the ecosphere (as shown by the self-destruction of so many civilizations reported
in Dale & Carter [1955], and the mortal ecological crisis we have produced in our time). And, in fact,
nature talks back to us, for it retaliates against our instrumental interventions with natural disasters, and it
rewards the communicative interventions of aborigines with negentropy. Furthermore, in my own
terminology and worldview, the essential characteristic of communicative relations does not lie in the
responses or lack of responses on the part of our interlocutor, but in our own attitude: in them we act as
though relating with a subject, whereas in instrumental relations we act as though relating with essents
lacking subjectivity and the capacity to feel pleasure and pain.
100
In Illich (1971), we read:
“Some (institutions) have developed in such a way that they characterize and define our time; others are more
modest and pass, so to speak, unnoticed. The first seem to be in charge of the manipulation of human
beings; we shall call them ‘manipulative’ institutions and we shall place them, for the clarity of this
explanation, on the right of the institutional fan or spectrum; on the left, we shall place those which, on
the contrary, make human activities easier. Let us be content with defining them as ‘open’ and
uncontriving...
“On both extremes we can observe the presence of institutional services; however, on one side, we face a
contrived manipulation which causes the client to undergo advertisement, aggression, indoctrination or
electric shocks. On the other side, the service represents increased possibilities in the frame of defined
limits, while the client remains independent. On the right, institutions tend to become complex, in so far
as their method of production carries with it a previous definition and the need to convince the consumer
that he or she cannot live without the offered product or service, which causes the budgets [of those
institutions] to increase ceaselessly. On the left, the institution presents itself rather as a network to
facilitate communication or cooperation among the clients who take the initiative [of using them]. “
I think the discoveries made by Foucault and Deleuze can help us improve the above criterion. If we are to
decide whether an institution—for example, the fire brigade—is located toward the left, the center or the
right of the institutional spectrum, we must observe its structure as well. The fire brigade is organized
after a military model which conditions the experience of its members—the use and disposition of their
space, time and knowledge—and that of the people who interact with them, precisely as required by the
power structures of contemporary societies. Therefore, though other institutions are far more to the right
than the fire brigade, the latter is in a sense a “right wing institution:” it helps its members and those with
whom they interact to function within ever more complex and all-controlling power structures, and
facilitates the ever more efficient use of space and time necessary for the development of modern
organization (such as capitalism or, some time ago, the systems of openly dictatorial Marxist States).
1026
According to this criterion, a genuine left wing institution would be, for example, a Commune in which
each and every member can organize her or his own space, time and knowledge at will—and, ultimately,
transcend space, time and knowledge—in so far as he or she does his or her share of the common work in
the Community.
101
Also Islam martyred and killed many saints in the name of Muslim orthodoxy; one example is that of the
great Sufi master Mansur el-Hallaj, whose martyrdom and death was ordered by the Caliph at the
instigation of Sufi master Junayd of Baghdad—who, by the way, is held in great esteem by members of
the Traditionalist Movement who follow the Muslim line instituted by René Guénon.
102
This chi phowa (‘chi pho ba) or transference of world involves the transformation of the demon mind into
divine mind; cf. David-Neel & Lama Yongden (1981), pp. 268-271.
103
This is the school of systems thinking that was further developed by Gregory Bateson, Ilya Prigogine,
Humberto Maturana, Francisco Varela and various others of the thinkers taken as a model by the
advocates of the New Paradigm, which from the very beginning dealt with the self-organization of living
systems. The alternative school is that of John von Neumann, which was mechanist, and was based on a
system of input-output and linear thinking. Cf. Capra, Fritjof, 1986.
104
As Fritjof Capra (1975/1983) noted—and as Alan Watts had given to understand long before Capra—our
current problems arise from a “crisis of perception”. Human beings have long suffered from fragmentary
perception and delusion, but these, on the one hand, became ever more pronounced as the time cycle
unfolded, and, on the other hand, attained ever greater power to tamper with Nature—thus achieving
their reductio ad absurdum in the multi-leveled ecological crisis that we face. Changing our ways of
thinking would not be enough if our experience kept being fragmented and our basic drives and impulses
did not charge radically.
105
In Díaz (1989), we read:
“...a paradigm that puts in the first place values of growth that are not so much quantitative as qualitative;
[which does not place first] consume but the quality of life, the care of the environment, the satisfaction
that each [has fulfilled her or his] needs for freedom, culture, peace, ecolog[ical balance], etc.”
Professor Díaz is basing himself on Offe (1985).
106
According to Luhmann, systems theories of society cannot include the occurrences taking place within the
bodies and minds of those who take part in the interactions that make up the social system, for:
“Communications presuppose awareness states of conscious systems, but conscious states cannot become
social and do not enter the sequence of communicative operations as a part of them; they remain for the
social system environmental states.” (Luhmann [1990], p. 16).
Thus Luhmann says systems theories of society should deal with the interactions between individuals but
exclude all references to the actor or agent. Since an agent deprived of body and mind is no more than a
fiction or a concept, and there can be no action without an agent, Luhmann concludes that it is not
admissible to speak of communicative action: “Communication cannot be defined as communicative
action because this would require an actor hardly thinkable without body and mind.” (Luhmann [1990],
p. 6; by “communication” Luhmann means “interactions” or “exchange of information:” he is saying that
interactions or exchanges of information may never be understood in terms of Habermas’ concept of
communicative action, apparently on the grounds that, since all action implies an actor or agent, but his
systemic approach to society precludes considering the actor or agent, the concept of action of one or
another kind is inadmissible to systems theories of the kind he advocates. Habermas, instead, realizes that
unfortunately a great deal of human interaction is nowadays instrumental, and proposes that all
interactions between human beings should be communicative—or, if necessary, emancipatory.)
The above quotation from Luhmann is an instance of the fallacy of ignoratio elenchi. From the premise that
we should not take human actors or agents into account it does not follow that when we consider social
interactions we are forbidden to determine whether the structure and function of these interactions is
instrumental, communicative or emancipatory (which would be achieved by reading in the interactions
the implicit attitudes of the parts, in order to establish whether those interactions are structured as though
a subject were dealing with another subject which must be considered and respected as such or, quite to
the contrary, as though a subject were treating a mere object as something to be manipulated which
deserves neither consideration nor respect), for this would not imply including in the field of study the
subjects of the interaction. Besides, if we conceded that the exclusion of subjects forbids us from reading
into interactions the implicit attitude of each part toward the other, in the systemic theory of law we
would also be forbidden from considering—as Luhmann does—the “expectations of the parts” or any
1027
other factor depending on consciousness (even when these expectations are explicitly manifest in
interactions).
The fact that Luhmann’s theory rejects the concept of “communicative action” and gives the term
“communication” a meaning more or less equivalent to the one Bateson gives the term “messages,”
makes his theory quite suitable for instrumental manipulation. For his part, Habermas is wrong when, in
Luhmann & Habermas (1971), he takes for granted that nonsystemic theories of society as they exist
today may manage not to be dehumanizing, and affirms that, on the contrary, the application of systems
theories to society must always be dehumanizing and translate itself into social technology: in terms of
the perspective of the book the reader has in her or his hands, presently all sciences are dehumanizing
and manipulative, but it would be utterly wrong to think that systemic theories of society must
necessarily be more dehumanizing and manipulative than other theories of society.
Systems theories are suitable for expressing nonsubstantialistic worldviews and for showing the illusion of
substantiality to be but an illusion; however, nonsubstantialism does not in any sense imply the
dehumanization of individuals. Quite on the contrary, nonsubstantialistic worldviews, provided that they
derive from the realization of insubstantiality in Communion and are elements of a really effective set of
skillful means for accessing the state of Communion and stabilizing this state (as is the case with the
philosophy of Nagarjuna and the higher vehicles of Buddhism), are more effective than other worldviews
in leading human beings to deal with other human beings communicatively, fully respecting their
subjectivity. This is so because, as we have seen, only from Communion can there arise a genuine
communicative, respectful attitude, both toward other individuals and toward the rest of the universe.
107
For a more complete and thorough criticism of Luhmann’s theories cf. the three works of mine (two of
them with Mayda Hočevar) mentioned just before the call to this note, as well as Maturana (1985), and
Rodríguez (1987).
108
Je Tsongkhapa, founder of the Gelugpa Tibetan Buddhist School, insisted that the system of “Thoroughly
Nonabiding Madhyamikas,” rather than being the true Prasangika system, was a distortion of
Madhyamaka touching on the fringes of nihilism. However, in Capriles (2005), and also in the upcoming
definitive version in print form of Capriles (2004), I demonstrated that it is Tsongkhapa’s system that is
not that of the true Prasangikas, but a misinterpretation of Prasangika thought based on the practice of a
Swatantrika method, and provided substantial evidence suggesting that the true Prasangika system is that
of the “Thoroughly Nonabiding Madhyamikas.”
109
In Tibet, Gelugpa interpreters of Prasangika philosophy in general rejected the use of scientific views and
in general of all kings of autonomous theses; however, Tibetan Mahamadhyamika Masters insisted this
was an error, for when dealing with relative truth it was necessary to accept also the plausible views of
systems other than common sense, and in the refutation of relative truth with regard to the ultimate it was
as valid to use the views of common sense as the plausible views of systems other than common sense.
Of course, before globalization, views other than common sense changed as new authors wrote new
treatises, and after globalization, the sciences change as new paradigms and pieces of knowledge replace
old ones; however, at any moment we can use the prevailing views so long as we do not take them to be
absolutely true.
The above approach was defended by authors as varied as the eighth Karmapa, Mikyo Dorje (mi bskyod rdo
rje), and Ju Mipham (’ju mi pham ’jam dbyangs rnam rgyal, 1846-1912) Rinpoche.
110
Einstein’s theories imply that the entities of our experience not to exist substantially, insofar as they show
them not to be in themselves separate from the rest of the field of our experience—which would hold just
the same regardless of whether those entities and their subatomic structure as studied by physicists
through their scientific instruments were part of a material world existing externally to and independently
of our experience, or whether they existed exclusively in our own experience. In fact, according to
Einstein’s field theory, entities are not in themselves separate from the rest of the universal energy field:
this theory pictures the universe as an undivided, continuous energy field, and notes that there is nothing
different from the field, nor is there a gap in the field, that separates entities from the rest of the field.
And if entities are not in themselves separate (our singling them out for perception being what causes
them to appear as separate), they cannot be considered to be substances.
Aristotle developed different concepts of substance in different works, one of them being that of “sum of
matter and form.” What happens if we resort to this Aristotelian concept of substance? In terms of this
criterion, for something to be a substance it will have to conserve both its form and the matter
constituting it (in fact, if an entity exchanges with its environment the matter that constitutes it, then it
1028
cannot be said not to depend on anything else than itself to be what it is, for it depends on matter that
presently is not part of itself in order to continue to be itself in the future). However, so long as an entity
conserves the matter that constitutes it, we will have the same substance even if this matter changes its
state and by so doing changes its form in a predictable way; for example, water loses its liquid form
when it freezes and becomes ice, or when it evaporates and becomes vapor; however, so long as it
conserves the matter that constitutes it, and so long as it does not become something different from water,
ice or water vapor, it will have to be considered to be the same substance. According to Albert Einstein’s
Field Theory, subatomic particles, which result from the polarization and extreme concentration of the
energy of the universal electromagnetic field, do not conserve the matter/energy that makes them up, for
they are made of the energy of the area of the field through which they seem to be passing (just as a wave
in the ocean is made out of the water of the area of the ocean through which it seems to be passing);
therefore, they cannot be considered to be substances in the Aristotelian sense just considered. And if the
particles constituting the bigger entities formed by their combinations do not conserve their matter and
hence cannot be said to be substances, the latter cannot be said to conserve their matter and cannot be
said to be substances either.
111
The paper in which John Bell expressed his findings was written in 1964, but was published in the Review
of Modern Physics in 1966.
112
Bateson (1972) noted that in order not to include or exclude items not belonging to the logical type being
considered, one had to exclude all such items from consideration, which meant that one was excluding
them in order not to exclude them. Furthermore, this implies that, when dealing with the class to which x
belongs, whatever does not belong to the same class as x cannot be considered either as x or as non-x,
which violates the principle of the excluded third, the excluded middle or noncontradiction—which is
what the theory of logical types was intended to keep in place. However, if we regard the theory of
logical types as a mere convention necessary for resolving practical problems, rather than as an attempt
to substantiate the supposedly ultimate character of Aristotelian logic, then is fulfills its purpose—and
Bohm’s theory incurs in a fragrant breach of conventional logic for not respecting the rules of the theory
in question.
113
I find it pertinent to note at this point that one thing is the error Kant objected to in Leibniz, which consists
in explaining the phenomenal level of reality as resulting from the relations (which by their very nature
are phenomenal) between entities of a wholly nonphenomenal level of reality, and something quite
different is the physical theory according to which quarks do not occupy any space, and yet the whole of
physical reality is made up by them and the relations between them: quarks are supposed to have mass,
and therefore cannot be regarded as being nonphenomenal, even though entities having mass yet not
occupying any space are hardly conceivable by common sense, which works on the basis of discrete
reality. I also find it pertinent to note that the explanation of the four dharmadhatus in the
Avatamsakasutra and the Hwa-yen school is different both from Leibniz’s error and from the New
Physics’ conception of quarks: the four dharmadhatus involve four different perspectives on a single
level of reality, which must go together and be explained side by side insofar as they are the four
possible, different yet mutually complementary viewpoints on the same reality, all of which must
necessarily be taken into account if we are to avoid the error of taking one single perspective as the only,
total, absolute truth concerning that reality.
114
The method of isosthenia or “balancing truth,” which consists in neutralizing delusory adherence to a
particular viewpoint by affirming, as an other-directed assertion, a related yet opposite viewpoint (and
possibly providing evidence substantiating the latter), seems to fully correspond to the method taught by
Hui-neng, Sixth Patriarch of Ch’an Buddhism in China, as a conceptual way toward the nonconceptual
realization of Madhyamaka, which was described above in the regular text of this section.
An example of this method is the dialogue referred in Capriles (2004) (adapted from Blofeld [1962]) and
other of my writings, between Ch’an Master Ta-chu Hui-hai and a Tripitaka Master who tried to ridicule
him by asking him whether changes occurred in the absolute condition of Buddha nature (bhutatathata).
Instead of replying that they didn’t occur (which he knew was the answer that the Tripitaka Master
considered correct, for the bhutatathata may be said to be the absolute truth, and according to the
Mahayana from the standpoint of absolute truth no changes occur), Hui-hai stated: “yes, they do.”
Triumphantly, the Tripitaka Master decreed: “Venerable Master, you are wrong” Hui-hai replied with a
question: “Isn’t the true nature or condition of the Tripitaka Master the bhutatathata (i.e., the Buddhanature)?” The Tripitaka Master answered: “Indeed, it is the nature of all of us.” Hui-hai then added:
1029
“Well, if you sustain that it does not change, you must be a very ignorant king of monk. Surely you
should have heard that a wise man can transform the three poisons (hatred, desire and ignorance) into the
three accumulative precepts, transmute the six sensory perceptions (the ones that take place through the
five senses and the one that occurs through the mental consciousness) into the six divine perceptions,
passions into Awakening and delusion into wisdom. If nonetheless you suppose the absolute to be
incapable of change, then you—a Master of the Tripitaka—are in truth a follower of the heterodox sect
that posits a plurality of substances and asserts that things come about on the basis of their own
supposedly individual self-natures.” The Master of the Tripitaka had no alternative but to concede: “If
you put it that way, then the absolute does undergo changes.” However, instead of agreeing, Hui-hai
upbraided him, saying: “However, in your case, to sustain that the absolute undergoes changes is equally
heretic.” In despair, the Tripitaka Master retorted: “Venerable Master, first you said that the absolute
undergoes changes, and now you said it doesn’t. What is then the correct answer?” Hui-hai concluded:
“The one who has realized his own nature, which may be compared to a Mani pearl that reflects all
appearances (without adhering to them and without them sticking to it), will not fall into delusion no
matter whether he states that the absolute does undergo changes, or that the absolute does not undergo
changes. But those who have not realized this nature, upon hearing about the changing absolute, cling to
the concept of mutability, getting caught in it, and upon hearing that the absolute doesn’t change, adhere
to the concept of immutability, being stuck in it. (And this clinging to concepts is the very root of the
basic delusion that Mahayana Buddhism invites us to overcome.)
Another example of it is a dialogue composed by Ch’an Master Ta-chu Hui-hai, in which an imaginary
interlocutor asked him “What is the Middle Way,” and he replied: “The extremes.” When I found a
Danish Vajra-brother called Jakob standing on the back of the Nyingmapa Buddhist temple in Clement
Town (Dehradhun, H.P., India) in the late 1970s, I asked him: “What are you doing here?” He replied:
“Relatively I am here; ultimately I am not here.” At which I retorted: “Actually, it is relatively that you
are not here, because the relative does not truly exist, and it is absolutely that you are here, for everything
is the absolute.”
Perhaps the most impressive usage of this method by a Buddhist Master may have taken place when Milarepa
was confronted by a Kadampa Geshe who was jealous of the quantity of disciples that visited the Kagyü
hermit. In order to ridicule him before his disciples, and thinking Mila had no knowledge whatsoever of
philosophy, the Geshe asked him whether space was obstructing or nonobstructing—to which the great
repa replied, “obstructing.” When the Geshe triumphantly decreed, “you are wrong,” Mila took a walking
stick and began banging it against empty space—which responded as though it were solid and therefore
obstructing. Then the Geshe asked Milarepa whether matter was obstructing or nonobstructing. The
hermit replied “nonobstructing.” When the Geshe triumphantly decreed, “you are wrong,” Mila passed
his hand through the wall of the cave in which he was sitting. At this, the Geshe became his disciple.
The method of isosthenia is simply the application, in a dialogue between individuals, of the via oppositionis:
the “way of the opposition of mutually contradictory concepts” (a concept that has been emphasized in
Elorduy [1983]), which the Madhyamikas seem to have applied as a key contributory condition toward
the spontaneous collapse of the delusorily valued conceptual limits their school calls “extremes,” and
therefore toward gaining access to the limitless condition that it calls the Middle Way. When the via
oppositionis is applied in speech or writing by a single person who combines contradictory terms in order
to contribute toward the collapse in the reader or listener of the habit of combining delusory valued
concepts into complex meanings that are taken to be absolutely true or false, so that the veil constituted
by the net of delusorily valued thoughts may fall and as a result the true nature of reality may become
evident, we have the very essence of Madhyamika dialectic as manifest in the works by Nagarjuna,
Aryadeva and the Madhyamika Prasangikas.
This application of the via oppositionis also seems to be the very essence of many of the verses in Lao-tzu’s
Tao-Te-Ching. As noted in the regular text, there are many other fragments by Heraclitus that
simultaneously assert opposite views, and which rather than being attempts to destroy the Principle of
Non-contradiction, Law of the Excluded Third or Law of the Excluded Middle (as those who have
interpreted Heraclitus as though he were Hegelian have taken them to be), are part of a strategy for
breaking the reader’s delusory valuation-absolutization of thought that, as we have seen, is at the root of
the delusion that the Buddha called avidya and that the Ephesian called lethe, and that causes people to
hold to one conceptual extreme as true, and reject the other extreme as false (a strategy that would work
only on those who are logically bound by the Principle of Non-contradiction, Law of the Excluded
1030
Middle or Law of the Excluded Third). Concerning the method of isosthenia properly speaking, it was
popularized by Pyrrho of Elis (c. 360-c.270 BC), the founder of the Skeptic School, who purportedly
received it from Anaxarchus of Abdera while both of them traveled with Alexander’s army through Asia.
It is claimed that Anaxarchus in turn received it from his teacher Democritus of Abdera (c.460-c.370
BC), but there is no proof whatsoever that the method was actually taught by Democritus, and therefore
the possibility cannot be discarded that Pyrrho and Anaxarchus may have received it from Asian sages
during their travels. At any rate, it seems certain that the method existed in Greece long before Pyrrho
and Anaxarchus traveled through Asia, for the “sophist” Protagoras (c.490-c.421 BC) is reputed to have
applied it. In fact, Protagoras may have been justifying this method when, as Diogenes Laërtius tells us,
he asserted, “...concerning any matter (pragma), there are two mutually opposed discourses (logoi),” and
noted he considered both as being equally valid. (However, it is impossible for us to discern after nearly
two and a half millennia whether Protagoras was a link in the venerable lineage of philosophers who used
the method in question to lead individuals beyond grasping at thoughts and thus into the realization of the
ultimate, unborn nature, or, as held by the detractors of the sophists, whether he was teaching his pupils
techniques for the manipulation of the masses in the agora and/or means for the pacification of their
consciences so that they could pursue illegitimate purposes without feeling remorse.)
In turn, in his treatise On Nonbeing, Gorgias of Leontini set out to destroy Eleatic ontology by expounding
his renowned there doctrines: (1) Nothing exists; (2) If something existed, it could not be known; and (3)
Even if (something existed and) could be known, it could not be expressed in words. “Nothing exists”
could as well mean the same as in the Prajñaparamita Sutras and in the original Madhyamika literature:
that nothing is self-existent. If this were so, the other two statements would be rhetorical assertions
emphasizing the fact that conceptual knowledge cannot correspond in an absolutely precise way to what
it interprets, and that it is impossible to express the nature of reality, or even its structure and function, in
an absolutely precise way. However, we face the same problem again, for we cannot know whether this
is so, or whether Gorgias was an opportunist who taught techniques for the manipulation of the masses in
the agora and for the pacification of the consciences of people pursuing illegitimate purposes.
In general, scholars take the above statements by Gorgias and Protagoras to imply that they held mutually
contradictory views; however, a Madhyamika would agree to the statements of both, for it is precisely
insofar as no conceptual position can be absolutely true with regard to any given object, that mutually
contradictory conceptual positions can be valid and held to be conventionally true with regard to an
object. And, in fact, I suspect that Gorgias may have been saying precisely that no conceptual position
can be absolutely true with regard to any given object, whereas Protagoras may have been saying that
mutually contradictory conceptual positions can be valid and held to be conventionally true with regard
to any given object—in which case both of them would have been expressing the very same view.
Another sophist, Cratylus, was renowned for raising his finger and remaining silent upon being questioned.
He claimed to be a follower of Heraclitus, and concerning the Ephesian’s statement that one cannot enter
the same river twice, for new waters overflow (fr. DK 91), he asserted that one cannot enter the same
river even once, for even while one enters the river, new waters have already overflowed (and therefore
there is no continuous river that may be entered). (Plato’s assertion in his Cratylus that the said “sophist”
believed everything had a right name of its own seems to contradict this interpretation of his thought.
However, in general Plato misrepresented Cratylus and other of the ancient philosophers: even his
depiction of Socrates is not the most plausible one, for it does not seem congruent with the renowned
statement “l only know I know nothing;” furthermore, the Cynics’ depiction of Socrates provides a more
plausible explanation of his death sentence.)
Neo-Academic philosopher Arcesilas (c.315-c.240 BC) introduced the method of isosthenia into the
Academy (where it was said to be “of Socratic inspiration,” either because Socrates actually applied it, or
in order to valorize it by ascribing it to the venerated teacher of the Academy’s founder). It was another
neo-Academic, Carneades, who left as his legacy to us another, less well-known application in speech or
writing of the via oppositionis by a single person already mentioned in the regular text (which, however,
this author is not sure may be therapeutic, and, contrariwise, thinks in some cases may be dangerous): the
argumentum in utramque partem or “argument in favor of both sides,” which consists in developing an
argument convincingly until the listeners or readers have been persuaded by it, and then developing the
opposite argument in an equally convincing way.
Therefore the possibility may not be discarded that Heraclitus, Democritus, Anaxarchus and Pyrrho,
Protagoras, Gorgias and Cratylus, Arcesilas and perhaps even Carneades, and quite possibly Anthistenes
1031
and the Cynics (or at least some of these) may have been links in a wisdom tradition somehow similar to
that of the Madhyamikas, to that of Ch’an or Zen, and to that of Dzogchen. In fact, one may suspect such
a tradition may have existed within the genuine, ancient Dionysian tradition, which as we have seen
Alain Daniélou (1992) showed it to be one with the Shaiva tradition of India and the Egyptian cult of
Osiris, and, as shown in Capriles (2000b) and in other works by this author, was one with Zurvanism,
Taoism of Unorigination [the one represented by Lao-tzu, Chuang-tzu, Lieh-tzu and the Masters of
Huainan, and quite likely by Chuan Chen Taoism as discussed in Liu I-ming, 1988, and Reid, D., 2003]
and ancient Bön—the latter of which, probably since around 1800 BC, has had its own Dzogchen
tradition and its own Mantric teachings (Namkhai Norbu [1996, 1997a, 1999/2001, 2004], etc.). If this
were so, Cratylus raising his finger in reply to the questions of his interlocutors may have had the same
meaning as the identical behavior of Ch’an Master Chu-ti, who succeeded to T’ien-lung (cf. Cleary &
Cleary [1977], vol. I, Nineteenth Case, pp. 123-128). (With regard to Chu-ti’s method, consider the
following: “When he was near death, Chu-ti said to his assembly, ‘I attained T’ien Lung’s one-finger
Ch’an and have used it all my life without exhausting it. Do you want to understand?’ He raised his
finger, then died.” [Ibidem, p. 125.])
Since we have enough fragments of Heraclitus’ book as to assume he may have been a representative of a
genuine wisdom-tradition (which, as we have seen, must have been the Dionysian tradition), it may be
useful to note that the Skeptics traced their tradition to Heraclitus. As noted in Cappelletti (1969):
“Ænesidemus, the most radical critic of the principle of causality in antiquity, ends up considering the
[method of the] Skeptics as a propaedeutics to the philosophy of Heraclitus, in which paradoxically he
sees the metaphysical foundation to the epistemological doctrine of the former (Braga [1931]). Another
Skeptic, Sextus Empiricus, refers quite extensively to the epistemology and the psychology of Heraclitus
in his work Adversus mathematicos, where he quotes the initial paragraph of his book.”
All of the above is considered in detail in my work in progress Greek Philosophy and the East. For a
published explanation of the relationship between Shaivism and ancient Bön, cf. the notes to Vol. I of
this book; for a more detailed explanation cf. Capriles (work in progress 3, work in progress 4) (note that
Shiva’s dwelling place is Mount Kailash in Tibet, at the foot of which around 1,800 BC the great Bönpo
Master Shenrab Miwoche taught the Dzogchen tradition of the Zhang Zhung Nyengyü [rdzogs pa chen
po zhang zhung snyan brgyud]). Concerning the relationship between the Greek Skeptics and the
Madhyamaka School of Philosophy, the reader may consult McEviley (1982); Capriles (1994a, 2004,
work in progress 3); Gómez de Liaño (1998); Carré (1999, 2001).
To conclude, it should not be assumed that all thinkers of East and West associated with the via oppositionis
necessarily had the same wisdom and used it in the same way. The problem is too ample to be dealt with
here; it will be further considered in my work in progress Greek Philosophy and the East.
(Concerning Anthistenes and the Cynics, I have already noted that it is clear that the latter had an askesis that
aimed at the liberation of conditioned perceptions; if it were true that Diogenes was a disciple of
Anthistenes and that the latter passed down a series of doctrines and practices to the former, then there
could hardly be any doubt that Anthistenes’ assertion of the illegitimacy, both of negation [his phrase ouk
estin antilegein had been used by Protagoras], and of definition in terms of the syllogism “a is b,” were
“in the thread of Ariadna” of the ancient soteriological tradition that I assume would have been somehow
akin to Madhyamaka philosophy. For an explanation of these two theses of Anthistenes’ in terms of the
relationship between the computations of the two cerebral hemispheres and between the two processes
established in Freud’s Project of 1895, cf. Capriles (1999b, work in progress 3.)
115
As will be shown below in the regular text, signs “mean” by differing from other signs; however, for
Derrida the key point is that they may differ, opening a space from that which they represent, and they
may also defer, opening up a temporal chain, or participating in temporality—a double sense emphasized
by Derrida’s neologism. Likewise, the term clôture or “closure,” in the already defined sense of “closing
in on the outside” of the logos (again in a non-Heraclitian sense of the term) within the boundaries of a
way of thinking and attributing meaning, refers to a space of shared, restricted meanings (comparable to
the enclosed space that results from building an encircling fence, or to a monastery or convent that is off
limits to the laity)—which theoretically seems to be conceived as being capable of continuing
indefinitely. In fact, in Derrida (1972b), p. 23, he tells us:
“What is caught in the de-limited clôture (closure) may continue indefinitely.”
However, nothing that is conditioned, compounded, constructed or born may continue indefinitely; in
particular, according to Nietzsche, the development of modernity is bound to cause nihilism qua the
1032
moral Christian and the metaphysical Platonic interpretations of the world (which in Derridian terms are
spatial clôtures) to reduce themselves to absurdity (this is not Nietzsche’s terminology but my own; at
any rate, as will be shown below in the regular text, according to Nietzsche this is due to the fact that
these interpretations of the world carry in themselves the seeds of their own destruction, to a great extent
because one of their primary values is Truth, and when the quest for Truth is applied to these two
interpretations of the world, at some point they are revealed to be untrue)—which in Nietzsche’s view
will give rise to radical nihilism. Active radical nihilism, in particular, involves the imperative of
breaking what Derrida calls clôture (in the spatial sense, and as a “closing in on the outside” of the logos
[in a non-Heraclitian sense] within the boundaries of a way of thinking and attributing meaning);
however, according to Derrida we must attempt this fracture without believing that philosophy is going
to be “surpassed.” At any rate, the important point is that breaking the clôture or closure in the spatial
sense of the term involves the clôture or closure, in the temporal sense of the term, of the space of shared,
restricted meanings: here clôture has the sense it acquires when referring to the act of terminating a
process, of definitively ending a state of affairs (as, for example, in “la clôture d’un débat” or “la clôture
d’une conference”); it has to do with completion, and refers to a condition prior to the end, to the
bringing of a process to its conclusion. In Derrida (1967), p. 14, we read:
“The unity of all that is noted today through the most diverse concepts of science and writing is in principle
more or less secret but always indefectibly, determined by a historic-metaphysical epoch of which we
only glimpse the clôture. We do not say the end.”
Thus in the temporal sense clôture refers to the surpassing of something, which is not merely its coming to an
end. And qua surpassing that does not represent the end of the surpassed (but only in this particular
regard) it has been shown to have something in common with concepts so different from each other as
Hegel’s Aufhebung or sublation, Heidegger’s Vollendung (completion) and the phenomenological double
negation discussed in this book (which was illustrated with the double negation in Sartre’s bad faith and
Laing’s spiral of pretences). However, this acceptation of Derrida’s concept seems to coincide in more
senses with Heidegger’s concept, for the notion of Überwindung der Metaphysik, the “overcoming of
metaphysics” (in Heidegger [1978]) was reiterated in Derrida (1967), p. 4 of English Ed. of 1976/1998.
Simon Critchley (1999) discusses this coincidence in the section “The Problem of Closure in Derrida,”
noting that Heidegger does not “understand the end of philosophy as a full stop, or conclusion, to the
metaphysical tradition; instead, it is necessary to think das Ende in terms of die Vollendung, as a
completion, or fulfillment, of metaphysics” (Heidegger (1978), p. 374)—and that the same is the case
with Derrida, to whom this end is not a perfection or finality, but a completion or closure (clôture) “that
has left a taste in the mouth of thought” (Critchley [1999], p. 77), and which implies a deracination
insofar as it involves the destruction of the essential similarity of that which is coming to an end.
Contrarily to the notion of the end of philosophy in, say, Hegel, for whom his own system represented
the final perfection of philosophy, Derrida suggest a thinking that “radicalizes the thinking through of
metaphysics” and takes the thinking of an ending right “through to the thinking also of the end of the
end. “ Critchley assumes Robert Bernasconi’s thesis that Derrida’s clôture might correspond to
Heidegger’s Verendung, arguing that rather than countering Heidegger’s notion of end, Derrida is
drawing out its vast implications, for he agrees with Heidegger’s essential view of the history of
metaphysics (Critchley [1999], pp. 79 and 81). However, this problem is utterly beyond the aims of the
present book.
At any rate, clôture always involves the setting of a limit. The deconstruction of logocentrism shows how the
limit, or clôture, of a logocentric text’s prevailing interpretation involves certain faults, breaks or
fissures, which are the marks of an alterity, an overwhelming otherness, which the text is unable to
reduce or expel, so that it cannot demarcate its inside from its outside (and is even divided within itself
between belonging and not belonging to the logocentric tradition—which is where the “silence” referred
to by Loy “announces a possibility...”). In space, even the clôture established by the phenomenological
epoche does not really divide phenomenology from metaphysics; in time, the break announces a
continuation...
116
In Derrida (1972a), “La différance,” pp. 12 and 13, we read:
“Différance is the nonfull, nonsimple ‘origin’, the structured and differing origin of differences. Therefore,
the name ‘origin’ is no longer appropriate... Retaining at least the schema if not the content of the
requirement formulated by Saussure, by différance we will refer to the movement according to which
1033
language, or any code, any system of forwarding in general ‘historically’ constitutes itself as a tissue of
differences.”
To Derrida, the very movement of the différance is the trace qua arche-trace, qua arche-writing, which
constitutes all processes of signification and articulation of language: Derrida tells us it is the becomingspace of time and the becoming-time of space (Ibidem, pp. 13 and 14). This is so because each and every
element of language refers to another element that is not simply present, each difference refers to another
difference which is not simply present, so that each element constitutes itself on the basis of traces of the
other elements of the system, which are themselves traces as well: each trace refers to another trace and
so there is no first or primordial trace. The difference at the “origin” of all possible differences is the
trace itself qua arche-trace, qua movement of the absolute origin of meaning. Derrida wants the very
concept of the trace to cause to hesitate, by “crossing it out,” the concept of the origin, which he sees as
being at the root of metaphysics. The rature (crossing out or erasure) implies belonging to another story,
to another play: to the general text or writing that is the arche-writing and which submits classical
concepts to the operation of the rature.
117
The main hermeneutical tradition is the one that passed from Schleiermacher to Dilthey and then to
Heidegger, which initially implied a clear-cut subject-object division, but which with the passing of time
came to take language to be the only reality, on the basis of a view that sees language as a totality
representing unity in the opposition of subject and object, and as being previous to the abstractions that
language itself makes possible.
Besides, there is Nietzsche’s alternative Hermeneutics, according to which “There are no facts, only
interpretations.” This phrase is from Nietzsche (1999), which is widely regarded as the primary source
for Nietzsche’s moral hermeneutics—which, rather than taking moral judgments as imperatives of reason
to be evaluated, from the perspectives of radical nihilism and pessimism views them as signs to be
interpreted, and the development of which Nietzsche himself (1997d) already carried out to some extent.
As noted in the regular text of this section, in “On Truth and Lie in an Nonmoral Sense” (undated 1),
which he wrote in 1873, Nietzsche takes this view, according to which there are no facts but only
interpretations, to the realm of truth and epistemology, arguing that what is claimed to be objective truth
is nothing but an endless series of metaphors, and that objective truth, the basis of scientific theories, is
only an illusion. Nietzsche also makes relevant points in this regard in one 1987 work (Nietzsche [1999])
and three 1888 works (Nietzsche [1974, 1967, 1997c]).
Derrida has insinuated that hermeneutics remains attached to the old metaphysics of presence; he had in mind
what I called the “main hermeneutical tradition,” but in any case there is an ongoing discussion as to
whether of not Derrida is right in his insinuation.
118
Qua Base, shunyata, as understood by the Madhyamaka-Prasangika school of Mahayana philosophy,
corresponds to the metaontological fact that no essent has true being or substance. Qua experience on the
Path, shunyata is the derealization discussed in the regular text, whereas qua realization on the Path it
might be said to involve a temporary surpassing of the delusory valuation of thought. Qua Fruit,
shunyata might be said to consist in the irreversible cessation of the delusory valuation of thought.
However, the above is a Mahayana interpretation based on the Second Promulgation (dharmachakra) which
itself does not contemplate the continuity of Base, Path and Fruit, but which I nonetheless related to these
concepts. The explanation that best emphasizes this continuity is that of the Dzogchen teachings, in
which shunyata qua Base is the ngowo (ngo-bo) or essence aspect of the Base; shunyata qua Path is the
reGnition of the ngowo aspect of the Base that is the manifestation of dharmakaya while on the Path; and
shunyata qua Fruit is the stabilization of the dharmakaya as the first of the three aspects of Buddhahood.
119
Nonetheless, conventional truth or samvriti satya (Tib. kundzob denpa [kun rdzob bden pa]) has two
subvarieties: inverted relative truth (Skt., mithyasamvritisatya; Tib. logpai kundzob denpa [log pa’i kun
rdzob bden pa]), which characterizes human beings who have never realized the absolute truth, and
which consists of utterly deluded perceptions, and so called “correct” relative truth (Skt.,
tathyasamvritisatya; Tib. yangdagpai kundzob denpa [yang dag pa’i kun rdzob bden pa]), which
manifests in the post-Contemplation state of superior bodhisattvas (those who have realized the absolute
truth) and which involves some awareness of the fact that this “truth” is “deluded truth” (or, which is the
same, untruth), insofar as it comprises an awareness of apparitionality. (From a different perspective, the
two varieties of conventional truth are: [1] ineffectual relative truth, constituted by phenomena that lack
effectiveness in the sense of not being able to produce the effects that would be expected from them, as is
the case with the falling hairs seen by someone with cataract, which cannot make the person bald; and [2]
1034
actual or effective relative truth, constituted by the phenomena that are fully effective, like the falling
hairs that make the person progressively bald.)
120
The method of Thoroughly Nonabiding Madhyamikas, just as the related method that the Hwa-shan
Mahayana is supposed to have defended in the alleged debate of Samye, in which he is supposed to have
faced the Indian master of the lower form of the Madhyamaka-Swatantrika-Yogachara, Kamalashila,
might have been absorbed by the Mahayana from the Semde (sems sde) series of Dzogchen teachings.
In the case of the method of Thoroughly Nonabiding Madhyamikas, the above could have occurred because,
as stated by the traditions of the Nyingmapa (rnying ma pa) School of Tibetan Buddhism that were
codified in the authoritative treatise Feast for the Erudite: A History of the Dharma or Chöjung Khepai
Gatön (chos ’byung mkhas pa’i dga’ ston) written by Pawo Tsuglag Threngwa (dpa’ bo gtsug lag phreng
ba) (1504-1566), Nagarjuna and Aryadeva were lineage holders in the transmission of Dzogchen
Atiyoga—which has been taken to imply that the Madhyamaka is a philosophical explanation, adapted to
the gradual Mahayana, of the essential View of Dzogchen Ati. In this regard, Chögyäl Namkhai Norbu
has written (1988, p. 26):
“The [theoretical] viewpoint of Dzogchen is that of the Madhyamaka-Prasangika system (note by EC: i.e.,
the system of Thoroughly Nonabiding Madhyamikas), aim of the teaching of Buddha and supreme
among Buddhist philosophical systems, originally expounded by Nagarjuna and his disciple Aryadeva.
This is confirmed by [the root Tantra of the Dzogchen Menngagde series], the Drataljur (sgra thal ’gyur
chen po’i rgyud, Skt., shabda maha prasamga mula tantra). Therefore, we could conclude that the
[theoretical] view of Dzogchen [corresponds to that of] this philosophical system that transcends
eternalism and nihilism. It is even possible to speculate that the [theoretical] view of MadhyamakaPrasangika originated from Dzogchen. There are two reasons to substantiate this. The first is that the
[real] Knowledge (of) the true condition cannot be something different from the state of spontaneous
perfection of Dzogchen, and therefore the view of Madhyamaka-Prasangika must correspond to it. The
other is that Garab Dorje, the first Master of [Buddhist] Dzogchen, was the source of two lineages, one of
seven disciples and one of twenty-one, and one of these twenty-one successors was Nagarjuna. Besides,
it is claimed that Aryadeva vanished in light after having received Dzogchen teachings from the second
Mañjushrimitra [who is considered to have been an emanation of the direct disciple of Garab Dorje
bearing the same name]. All of this is clearly reported in A Feast for the Erudite: A history of Buddhism.”
The same may have occurred in the case of the Hwa-shan because, as stated in The Sutra of Hui-neng (WongMou-Lam [trans. 1969], pp. 50-1), the most authoritative canonical source of Ch’an or Zen Buddhism,
Nagarjuna and Aryadeva were respectively the fourteenth and fifteenth Patriarchs in the transmission of
this school (and Western scholars have speculated that these Masters may have developed Madhyamaka
philosophy as a theoretical basis for the practice of the sudden Mahayana). Since according to the abovementioned text Nagarjuna and Aryadeva were Dzogchen masters, they could have introduced teachings
from the Dzogchen Semde in the Ch’an / Zen tradition. And since centuries later, in Tibet, there were
many interactions between Dzogchen and Ch’an or Zen (Nub Namkhai Nyingpo [gnubs nam mkha’i
snying po] was a Master of both Ch’an and Dzogchen, and Aro Yeshe Jungne [a ro ye shes ’byung gnas]
was the seventh link in both the Tibetan Ch’an and Dzogchen lineages), mutual influences between these
traditions may have continued to take place.
The Drataljur and other Dzogchen texts had to emphasize the essential coincidence of the theoretical view of
the Prasangika with that of Dzogchen because, (1) Some scholars had mistaken the Dzogchen view
according to which the true nature of mind is Awake awareness, for the lower Yogachara view according
to which there is a thoroughly established (yongdrub [yongs grub]) Buddha-nature, and (2) These
scholars had tried to confirm the wrongly assumed identity between Yogachara and Dzogchen, on the
basis of the fact that Third Promulgation terms used by the Yogachara such as klishta mano vijñana,
alaya vijñana and swasamvedana are central to Ati Dzogpa Chenpo, and that the same applies to the
concept of the continuity of Base, Path and Fruit featured in Maitreyanatha’s Uttaratantra (which strictly
speaking does not belong either to the Yogachara School or the Madhyamaka Swatantrika Yogachara
subschools, but which the Madhyamika Rangtongpas and in particular the Madhyamika Prasangikas
associate to these schools)—all of which are extraneous to the sutras of the Second Promulgation and to
Prasangika philosophy.
Concerning the confusion of the Ati view according to which the true nature of mind is Awake awareness,
with the lower Yogachara view according to which there is a thoroughly established Buddha-nature, it
must be stressed that the Dzogchen teachings, rather than viewing the nature of mind as thoroughly
1035
established, assert it to be an awareness free of elaborations (thödräl [spros bral); since freedom from
elaborations is the main trait of Prasangika philosophy, and since Ati Dzogpa Chenpo views all
phenomena as being empty of self-existence in a way that cannot be distinguished from that of the
Prasangikas, in these most essential respects the “theoretical view” of Dzogchen corresponds to that of
the Prasangika subschool (furthermore, the conception of voidness in the Yogachara School is much
lower than that of the Uma Rangtongpa or Swabhava Shunyata Madhyamaka in general, and, even more
so, than that of the Dzogchen teachings—and even the conception of voidness of the Madhyamaka
Swatantrika subschools is not as thorough as both that of the Prasangika School and that of the
Dzogchen teachings). However, Prasangika philosophy does not speak of a “nature of mind” or a
“spontaneous awareness” (which in Dzogchen is not understood as an “awareness of consciousness” but
as a nondual awareness that in samsara becomes awareness [of] consciousness), and thus there is a
greater coincidence between Dzogchen and Mahamadhyamaka, which shares the Prasangika concept of
freedom from elaborations but which accepts a “spontaneous awareness” that in samsara becomes
awareness [of] consciousness, than there is between Dzogchen and Prasangika (for a thorough
discussion of this, cf. the upcoming revised edition in print of Capriles [2004]).
Concerning the use in the Dzogchen teachings of terms featured in Sutras of the Third Promulgation that were
assimilated by the Yogachara and Madhyamaka Swatantrika Yogachara schools, the reader must be
reminded that according to the Nyingmapa the highest philosophical schools of the Mahayana are those
that make up the subtle, inner Madhyamaka (and in particular the one known as Mahamadhyamaka; cf.
Dudjom Rinpoche, J. Y. D., English 1991, Trans.: G. Dorje and M. Kapstein), which are also based
mainly on the Sutras of the Third Promulgation, and which use the concepts and terms that these Sutras
share with the Dzogchen teachings, which they interpret in a far subtler and more refined way than do the
Yogachara and Madhyamaka Swatantrika Yogachara schools. However, no Mahayana school
whatsoever features any of the concepts that respond to the Dzogchen principle of spontaneous liberation
and its results; besides, the Dzogchen teachings present a much ampler and more coherent system that
gives some of the terms it shares with the subtle, inner Madhyamaka a meaning that is quite different
from the one they have in all Mahayana systems (all of which has been used to support the thesis
according to which those terms and concepts existed in the Dzogchen teachings before they were
incorporated into the Mahayana). To conclude, the continuity Base-Path-Fruit is far more perfect in the
Dzogchen teachings than in the Uttaratantra, which may be have arisen from adapting the continuity of
Dzogchen and the less perfect continuity of the Tantras of the Path of Transformation (in both of which
the Buddha-nature is fully actual) to the lower views of the Mahayana (also for a thorough discussion of
this cf. the upcoming revised edition in print of Capriles [2004]).
121
Nonaffirming negation or absolute negation (Skt., prasajyapratisedha: Tib. megag [med dgag]) is a
negation which negates the object of negation without implying anything else; in the Gelugpa tradition
this type of negation is illustrated with the statement “A Brahmin should not drink alcohol” (I am not
sure this example is the proper one—i.e., the one that illustrated the meaning the term had before
Tsongkhapa reformed the Prasangika view and practice, and which really makes sense; I am of the
impression that the correct example should be something like “there is no man whatsoever”). Affirming
negation or implicative negation (Skt., paryudasapratisedha; Tib. mayingag [ma yin dgag]) is a negation
that upon negating its object of negation implies the assertion of some other facts; this type of negation is
generally illustrated with the statement “this man is not a Brahmin.”
The original sense of nonaffirming negation or absolute negation it properly illustrated by Nagarjuna’s
chatushkoti or negation of the four extreme views, for the negation of all conceptual possibilities
concerning an essent does not allow for the assertion of anything whatsoever; it is to be assumed that this
was the sense the term nonaffirming negation or absolute negation had among the original Prasangikas,
who, as we have seen, were the ones called “Thoroughly Nonabiding Madhyamikas” (Skt.,
sarvadharmapratisthanavadin; Tib., rabtu minepar mawa [rab tu mi gnas par smra ba]). Je Tsongkhapa
was totally right in viewing the voidness arrived at by the Shantarakshita-Kamalashila-Arya
Vimuktasena form of Madhyamaka-Swatantrika-Yogachara as an affirming or implicative negation
insofar as the voidness this system seeks is the presence of the object being analyzed as an existent
though illusion-like phenomenon (which is claimed to be concordant with the actual ultimate truth and a
non-metaphoric ultimate insofar as it involves the negation of true existence)—which is one of the
reasons why these authors have been called reason-established illusionists [Skt., mayopamadvayavadin;
Tib., gyuma rigdrubpa mawa [sgyu ma rigs grub pa smra ba]).
1036
Though Je Tsongkhapa taught the method of insight meditation of the Shantarakshita-Kamalashila-Arya
Vimuktasena form of Madhyamaka-Swatantrika-Yogachara (which he adapted from the there
Bhavanakramas by Shantarakshita and the three Bhavanakramas by Kamalashila), rather than that of the
Prasangikas, he claimed that insofar as in his adaptation of the method in question the voidness sought is
the presence of the absence of the inherent existence that is like a hare’s horn in that it does not exist at
all (rather than the realization of the object of analysis as an existent though illusion-like phenomenon),
the voidness that manifests at the term of the analysis is a nonaffirming or absolute negation. However,
whereas in the chatushkoti or negation of the four extreme views one cannot affirm the existence, the
nonexistence, “both one and the other,” or “neither one not the other,” in this case the nonexistence is
affirmed and posited as the ultimate truth. This shows that the nature of the Fruit depends on that of the
Path, and that of the Path on that of the Fruit, for in Tsongkhapa’s method one arrives at a result one can
grasp at (the conceptual nonexistence of an essent), rather than arriving at the impossibility of grasping at
anything—which is what may result in the manifestation of the genuine absolute truth.
For a more complete and precise explanation of this, cf. the upcoming edition in print of Capriles (2004).
122
I copy from Coward (1990), note 30 to Chapter Six, “Derrida and Nagarjuna,” pp. 185-6:
“This is nicely exemplified in the analysis of the statement ‘the human soul is eternal’ offered by Nagarjuna
and Chandrakirti. Chandrakirti asks what is the relationship between the subject, ‘the human soul’, and
the predication, ‘is eternal’; are the two terms identical or different? ‘If the two terms are identical, we
are left with a tautology: the eternal human soul is eternal. If they are different and distinct, what could
possibly justify the claim that they are related’. (‘Prolegomenon to Vallabha’s Theology of Revelation’,
p. 109). See ‘Self and the Way Things Really Are’, in Sprung, Mervin, 1979, pp. 165-186.”
123
I have in mind those Derrida-influenced thinkers who promote so-called “political correctness”—with
regard to which Baudrillard (1996b, p. 139) rightly noted that the it and the euphemisms it fosters
constitute a preaching “far more obscene than that which it tries to hide” (even though I am really at odds
with the idea of “obscene,” and though I find a great deal of the works the French author wrote after 1990
to be extremely shallow, inconsequential and frivolous, I quite agree with Baudrillard in this regard).
A most renowned specimen of this class is literature professor Stanley Fish, from Duke University, who
argued that since all speech is a political power play, ideas must be monitored and managed, rather than
rationally and constructively engaged (Fish [1992])—an attitude that has lead a liberal academic like
Harvard University’s Alan Dershowitz to claim that a new McCarthyism pervades intellectual life today
(Dershowitz [1992]). The other side of the coin is the “anything goes and must be respected” premise of
such thinkers, which under the guise of carrying tolerance and democracy to hitherto unknown degrees,
in real practice makes it acceptable for people to embrace and promote fascism and intolerance. Consider
the following paragraphs in the review of Mohanty (1997), in Wallia (undated):
“...Because a given word can have different meanings, any text can be read in various ways ... to take apart or
deconstruct texts is to reveal their hidden meanings, values or ideologies. And what one finds are ‘binary
opposites’ such as male or female or truth and fiction, with one term getting a ‘privileged’ position while
the other is pushed to the ‘margins’. An example might be the convention of using ‘he’ rather than
‘she’... when referring to men or women.” (Quoted from Smith, Dinita, ‘Philosopher Gamely Defends
His Ideas’, in the New York Times, 30 May 1998.)...
“Deconstruction’s focus on the hidden hierarchies in language appealed immediately to the predilections of
the burgeoning academic disciplines of feminist, ethnic, and postcolonial studies. The growth of those
disciplines in the past two decades has made deconstruction fashionable in American universities.
“However, critics of Derrida charge deconstruction with destabilizing and neutralizing political and moral
values. Such nihilistic amoralism, they say, had made it possible for Martin Heidegger to join Nazism.
Since Derrida had been heavily influenced by Heidegger’s work, he was asked to answer for Heidegger’s
amoralistic behavior. Moreover, in 1987 it was found out that Derrida’s close associate, Paul de Mann, a
Yale professor, had written anti-Semitic newspaper articles during the Nazi occupation of Belgium...
“In the first four essays, Mohanty evaluates the work of cultural theorists like Jacques Derrida, Paul de Mann,
Gayatri Spivak, Hilary Putnam, Louis Althusser, and Frederic Jameson. And in the [three essays of the]
book’s second part... he constructs a sustained argument for ‘moral universalism and multiculturalism
[as] compatible and indeed complementary ideals... Multiculturalism should be defined as a form of
epistemic cooperation across cultures’.
“...In the fourth essay, ‘Jameson’s Marxist Hermeneutics and the Need for an Adequate Epistemology’,
Mohanty evaluates Frederic Jameson’s synthesis of key poststructuralist insights with Marxist
1037
hermeneutics as well as his defense of interpretation as ‘exemplary for contemporary criticism’...
Mohanty faults Jameson (as well as Althusser) for adhering to [the] poststructuralists’ limited
epistemology of linguistic reference and knowledge... In a footnote, Mohanty observes: ‘In my opinion,
if we were to attempt a sociological explanation of postmodernist epistemology, it would deal less with
‘late capitalism’ and more with the power of the Western academy over intellectual discourse, with its
power—through its structure of recognition and rewards—to discourage critical examination of one of its
most fashionable theories ... it would make clear to what extent postmodernist theory ... is a creation of
the marketplace, rather than a genuine intellectual development’...
“In the fifth essay, ‘Political Criticism and the Challenge of Otherness’, Mohanty derides the cultural and
historical relativism rampant in postmodernist discourse as a concomitant of its principle of the
indeterminate nature of textual meanings. Cultural relativism is ‘inadequate for cross-cultural
understanding ... and intellectually underjustified as well as politically misguided’.”
The fact that I quote the above does not mean I endorse Mohanty’s view (or that of the reviewer, for that
matter). And the same applies—just even more so—to the following excerpt from Sokal & Bricmont
(1999), pp. 111-112 (I am retranslating into English from the Spanish):
“Unfortunately, postmodern ideas are not confined to European Departments of Philosophy or NorthAmerican Departments of Literature. It seems to us that where they do most harm is the Third World,
precisely there where the immense majority of the world population lives and where the supposedly
‘surpassed’ work of the Enlightenment is far from being concluded.”
The authors take for granted that all peoples of the world should go through the European Enlightenment,
which implies that they take for granted the cultural superiority of European civilization over all other
world cultures. Fortunately, many Europeans and North Americans have set out to practice Eastern
mystical systems that may provide an antidote to the arrogance and hubris that led the Enlightenment to
produce the current ecological crisis. They continue:
“Meera Nanda, an Indian biochemist who has been engaged in the movements of ‘science for the people’ in
India and who currently studies sociology of science in the United States, tells the following story à
propos of the traditional Vedic superstitions that regulate the construction of sacred buildings and which
are meant to boost ‘positive energy’ to the maximum. An Indian politician who was stuck in great
difficulties was warned... ‘that his difficulties would disappear if he came into his office through a door
oriented to the East. However, that access was blocked by a slum and it was impossible to go through it
by car. Hence he ordered the demolition of the slum’.
“Much to the point, Nanda points out the following:
“‘If the Indian left had kept so active in the movements of science for the people as it had been in the past, it
would have entered into a debate, not only against the demolition of the houses, but against the
superstition that had been used to justify it. (,,,) A left that would not have been so careful of
guaranteeing ‘respect’ for non-Western knowledge would have never allowed those who detent power [to
hide] behind the indigenous ‘experts’.’
“‘I told this story to my friends adhering to social constructivism in the United States. (...) [They told me] that
to put in the same bag two descriptions of space so different from each other [as that of the scientific
vision and that of Vedic traditions], which are both linked to different cultures, is in itself a progressive
action, for then neither can aspire at absolute truth, and therefore tradition will end up losing its present
control over the mentality of people (Nanda, 1997, p. 82).
“The problem with this kind of answers is that practical choices must be made: what medicine must be used
or in what sense is it convenient to orient buildings? In these cases theoretical laxity becomes
unsustainable. The result is that intellectuals fall into the hypocrisy of employing ‘Western’ science when
it is indispensable (for example, when they are gravely ill), while recommending the people to trust
superstitions.”
Are the Vedic rules for building, as the above authors take for granted, mere superstitions? I certainly do not
know and the point is irrelevant with regard to the problem under consideration, which is that the welfare
of a single politician is seen as justifying the destruction of the homes of many common people and the
subjection of these to all the sufferings and hardships that derive from this. However, it is evident that, in
spite of all the ills produced by Western medicine (and by stating this I am not denying its achievements,
and in particular the fact that nowadays it provides treatments which often are the only ones leading to
remission in hitherto uncommon disorders that now proliferate due to the heavy pollution all kinds of
technology has produced in our time) and of the mortal ecological crisis that has reduced to absurdity
1038
science and technology as they have developed so far in the West, and in spite of the fact that in our time
the healing power and relative innocuousness of ancient Eastern medical systems, and the power of
Eastern spiritual systems, have been widely substantiated by modern scientific research, the authors in
question see modern Western allopathic medicine as the only and true science of healing, while rejecting
all forms of Ayurveda (and by extension of Chinese and Tibetan medicine) as mere superstitions—
betraying a scientism that labels whatever has to do with ancient tradition as superstition and whatever
has to do with modern science as truth. (As way of example of the healing power of a traditional Asian
medical system, research by C. W. Ottaway, David Taylor, Philip Rogers, Richard Glassberg and
Chinese veterinarians such as San Hyuck Shin, Wei Gao, Yi Xin Huang, Hong Chen, Da Yong Song &
Qin Li Wang, etc. has shown acupuncture can cure infectious illnesses in animals—which cannot be due
to a placebo effect insofar as animals are not liable to self-suggestion [cf. among other works: Rogers,
White & Ottaway, 1977; Rogers, Philip & Bossy, 1981; Rogers, 1988, updated 1990, 1993; Rogers,
1991, 1993, 1996; Gao, Huang, Chen, Song & Wang, 2000]. Likewise, research by specialists has
confirmed the outstanding physiological effects of physical yoga and meditation techniques [Stein,
2003]; as a token, the team headed by Herbert Benson, MD, of Harvard University, has proven that an
outstandingly rapid increase in body temperature is achieved through the yogic practice of tummo [gtum
mo] [Benson, Lehmann, Malhotra, Goldman, Hopkins & Epstein, 1982].) Furthermore, modern
allopathic Western medicine is currently looting the Asian, American, African and Oceanian storehouses
of medical knowledge in order to patent their findings. Before a plant employed by one of these
indigenous systems has been patented, Sokal and Bricmont would have to regard its healing power as a
mere superstition; however, as soon as it has been patented, they would have to view it as certain
scientific knowledge. However, as just noted and as repeated again and again throughout this chapter,
modern science-based technology has produced the ecological crisis that threatens to put an end to all life
on this planet; therefore, if, as suggested in Descola (1996), the interventions of Amazonian aborigines in
the natural environment improved biodiversity... then down with science and long live superstition!!!
Of course, not all supposed “superstitions” are good and not all science is evil—and yet there is no doubt
Catherine Walsh is right when she writes (2004; the translation of the excerpt is my own):
“However, perhaps the greatest consequence of the geopolitics of knowledge is that it allows us to understand
that knowledge works like the economy: it is organized in terms of centers of power and subordinate
regions—the centers of financial capital being the centers of intellectual capital as well. This is why the
intellectual production of Latin America, and even more so that of Ecuador, still bears such a little weight
in the world. But there is an additional problem: the discourse of modernity created the illusion that
knowledge is abstract, unlocated and delocalized, causing us to think that knowledge is something
universal, having neither home nor body, neither gender nor color of skin. It is also this discourse of
modernity that creates the need, for all regions of the planet, to “ascend” to the epistemology of
modernity; that is, to approach, from Latin America, the Eurocentric model as the only valid one
concerning progress in the field of knowledge. The author Jean Franco uses the metaphor of the body in
order to explain this colonial, imperial relation—the thinking head in the North, whereas the acting body
(which also carries out the biological body functions) is in the South.
“Therefore, to speak of the geopolitics of knowledge is to acknowledge the hegemonic nature of the
[re]production, the diffusion and the use of knowledge, not simply as an academic exercise, but as a
fundamental aspect of the capitalist, modern world-system, which simultaneously is still colonial.”
The absolute relativism and the nihilism of trends of “postmodern” constructivism is not to be contested with
the bigotry of the scientism and Eurocentrism that—despite the fact that the Enlightenment and Western
science have led our species to the verge of extinction, and that only the ancient wisdom they despise can
save us from extinction—sees the whole of ancient Eastern wisdom as superstition and places the
Enlightenment and Western science on the throne of Truth. On the contrary, in each particular case we
must determine which approach is most appropriate and less harmful for both human beings and the
whole of the biosphere: that of modern Western science, or that of traditional approaches—for, once
more, it is a matter of adopting the narrative or the story that does most good and produces least evil.
124
There is no doubt that globalization is undermining attachment to the traditional views of all human
societies, which in its turn favors revolt against the established order in the societies undergoing this
transformation—which in its turn is necessary if the wayward order at the root of human suffering and
ecological crisis is to be surpassed. Besides, globalization is making it evident that the richest part of the
global population is squeezing to the extreme the poorest part of the same population in order to maintain
1039
its privileges in a world of rapidly depleting resources and increasing pollution and ecological
destruction—which may also elicit revolt in those who are oppressed and exploited. Finally,
globalization is exacerbating the process of reductio ad absurdum of delusion by impelling ecological
destruction. Therefore, in a way globalization is propelling the death of that which must die for
humankind not to die, and therefore is leading to the advent of the New Age of Communion,
homeostasis, socioeconomic and political equality, and plenitude in frugality, which according to the
present metanarrative, will constitute the true postmodernity.
However, the above does not amount to endorsing the view Marx expressed in the articles he published in the
New York Tribune in 1853, in which he interpreted a massacre committed by the British in India as an
important episode in the modernization of humankind. Nor is it exactly the same as the charge against
nationalism—both that of oppressors and that of the oppressed—from a supposedly “postmodern”
standpoint, in Hardt & Negri (2001), where the authors write that, “In the nineteenth century Karl Marx
(...) acknowledged the utopic potential of the ever increasing processes of global interaction and
communication” (p. 118). It is significant that this view implies that the authors are understanding history
in terms of a metanarrative they do not acknowledge to be such, and hence Lyotard and most
“postmodern” thinkers would not view their work as strictly fulfilling the conditions for being
“postmodern.”
(In Hardt & Negri [2004], the American literary theorist from Duke University, and the philosopher who
founded the Italian Radical Party and who upon being accused of belonging to the Italian Red Brigades
exiled himself in France until his extradition to Italy toward the end of the decade of the 1990s, further
develop the ideological line of Empire, asserting that in our time for the first time the possibility of
democracy on a global scale is emerging (one in which NGOs would have more relevance than State
structures), for the basic project of the multitude expresses the wish for a world of equality and freedom,
and the demand for an inclusive global democratic society, while at the same time providing the means to
achieve it. I think it may be a sign of the times that Toni Negri eulogizes the ever increasing processes of
global interaction and communication that are eroding non-Western cultures, and yet his son has taken
the opposite stand by heading an Italian organization that promotes respect toward the Tibetan culture
and offers help to Tibet.)
125
Obviously, I do not mean that the whole of the sense data and potential sense data that may be singled out
within the universe manifests in one’s awareness at once; what I mean is that the whole is an unthinkable,
inconceivable nature which can only be realized directly beyond conceptual, dualistic knowledge, and
that this nature is realized when, in the condition of aletheia, the all-embracing primordial gnosis
becomes patent—independently of how extremely little of the universe may be embraced by an
individual’s continuum of sensa.
126
If the whole of the universe is in truth the absolute, what is it that speaks when people speak, but the
absolute? Of course, from the standpoint of the absolute, what we call speech is not speech, and hence
from this standpoint the absolute may not be said to speak. However, when a muni sadhu commits
himself to not speaking, he is doing so in the relative sense in which there is speech when words come
from his mouth and silence when words do not come out from it, and he is imitating his wrong
conception of the absolute, which he believes does not speak in this relative sense. In order to dispel this
error, a Madhyamika philosopher would probably tell the muni sadhu that the absolute neither speaks—
insofar as from the standpoint of the absolute speech has no existence—nor remains silent—to begin
with, because from the standpoint of the absolute also silence has no existence, but perhaps also because
all that happens in the relative is in fact the absolute and hence when people speak what is speaking is the
absolute. It is for the last reason that, from a relative perspective, I related the relative to the absolute and
said speech and all that manifests in the universe is the play of the absolute. (Relating the absolute and
the relative does not involve the error Kant perceived in Leibniz, and which I explained as the mixture of
two different logical types, for in this case we are not dealing with two different spheres of reality that
can have no contact with each other, but with two different perspectives on reality, which manifest
coincidently in the dharmadhatu of li-shih-wu-ai of the Avatamsaka Sutra and the Hwa-yen school of
Chinese Buddhism; since from the standpoint of the relative there is speech, from the standpoint of the
dharmadhatu of li-shih-wu-ai, it may be said that the absolute has speech.)
127
There is an ongoing dispute concerning whether or not the Nagarjuna who was a disciple of the
Mahasiddha Sarahapada and the Nagarjuna who originated the Madhyamaka school are the same person,
for the former has been dated about the eighth century CE, and the latter is generally viewed as being
1040
much earlier (for an account of the various views with regard to Nagarjuna’s dating, including those by
Western scholars as well, see Ruegg [1981], pp. 46). However, there is no doubt that the Nagarjuna who
originated the Madhyamaka school is the one that, according to the Feast for the Erudite: A History of
the Dharma or Chöjung Khepai Gatön (chos ’byung mkhas pa’i dga’ ston) written by Pawo Tsuglag
Threngwa (dpa’ bo gtsug lag phreng ba) (1504-1566), was a Dzogchen master, and that the same applies
to the Aryadeva who was a disciple of Nagarjuna, for the text refers to a rather early stage in the
transmission of the Dzogchen teachings, which may correspond to various of the datings of the original
Nagarjuna.
128
He expresses this by saying that the needed clôture is in Nagarjuna; however, I doubt what is lacking in
Derrida, which may be provided by Nagarjuna, may be properly referred to by the Derridian term
clôture. The reasons for this are patent in the discussion of the Derridian clôture in a previous note in
which Critchley (1999), section “The Problem of Closure in Derrida,” is quoted.
129
However, the Buddhist vehicles of the Path of Renunciation maintain the sexist vices introduced by the
Indo-Europeans, which had not developed as yet in the pre-Indo-European religions of India and the
Himalayas. These vices were eradicated only in the various forms of Tantrism (Buddhist, Shaiva and
Jaina) and in the Dzogchen teachings (in their Buddhist and possibly Shaiva forms), which in the
Christian era restored in India the egalitarian character of original Indian and Himalayan religions. (I am
assuming that the vices in question did not develop in Tibet before the introduction of Buddhism, and
hence I am not referring to the Bönpo Tantric and Dzogchen teachings as carrying out the same
restoration.)
130
The reader may ask him or her self what is the use of the Buddhist methods intended for achieving the
spontaneous dissolution of the mental subject, since the latter dissolves anyhow at the end of the
cognition in which it manifested interdependently with its object. The point is that the dissolution of the
mental subject that occurs after each and every cognition does not involve either the realization that the
mental subject is an illusion, or the reGnition (of) the true condition of reality in an event of nirvana, and
is immediately followed by the condition of the base-of-all in which neither samsara nor nirvana are
active—the manifestation of which is indispensable for maintaining the continuity of samsara. In order
to advance on the Path to the transcendence of samsara in the manifestation of nirvana we must apply
the methods that make it possible for the mental subject to spontaneously dissolve in the reGnition (of)
the Self-qua-Base, right during the manifestation of a cognition rather than after a cognition has passed,
and making it evident that the mental subject is an illusion and that the true condition of reality does not
involve the subject-object duality.
131
In his Dialogues Plato posited two eternal principles, among others: (1) the eidos, which were pure Forms
having no matter whatsoever, had a fullness of being, truth, goodness, beauty and so on; and (2) matter,
which was formless, had absolutely no being, truth, goodness, beauty and so on. Using the eidos as
models, the Demiurge molded formless matter (and, in the case of human beings, inserted in their bodies
the respective souls—some of which had witnessed the eidos before being in the human body, and
therefore had the potentiality of remembering the true reality consisting in the eidos, and hence of
becoming philosophers), giving rise to the transient physical world—which, insofar as it had form, had
some of the being, truth, goodness, beauty and so on inherent in the eidos or Forms. This is why we may
not say the physical world of mere appearances had absolutely no value to Plato: it had some value
insofar as it had form. (Plato’s Dialogues express myths that seem intended for childish people, and
which supposedly represent his exoteric doctrines, as different from the esoteric doctrines that were
called agrapha dogmata or “unwritten doctrines.”)
132
In his dialogues, Plato attributed to Socrates his own metaphysical views; since the mainstream Western
metaphysical tradition is Platonic, this tradition assumed Socrates was as Plato described him. However,
the Cynics, the different Megarian streams of thought, and the Cyrenaics, had their own picture of
Socrates; though not all of these pictures survived until our time, we have the one drawn by the Cynics,
which is the one that most aptly explains the reasons why Socrates was forced to drink the cicuta. In this
regard, despite their anti-metaphysical stances, Nietzsche and Vattimo follow the mainstream Western
metaphysical tradition and believe the Socrates of Plato’s Dialogues to be the true one.
133
It would be wrong to think that in themselves nihilism and the dead of god pleased Nietzsche. He did not
welcome the advent of nihilism per se because he foresaw that as a consequence of the ‘Death of God’
what we regard as human civilization and culture, all that we hold as most worthy and valuable and that
1041
is the source of our self-esteem, was likely to be overtaken and destroyed by a more brutal and animallike age. He expressed his fears as follows (Nietzsche, Friedrich, English 1983, II, section 9):
“[If] ... the lack of any cardinal distinction between man and animal—doctrines which I consider true but
deadly—are thrust upon the people for another generation ... no one should be surprised if the people
perishes of petty egoism, ossification and greed, falls apart and ceases to be a people; in its place systems
of individualist egoism, brotherhoods for rapacious exploitation of non-brothers ... may perhaps appear in
the arena of the future.”
134
Nietzsche (1873; this English Ed. undated) concludes in this regard:
“What then is truth? A movable host of metaphors, metonymies, and anthropomorphisms: in short, a sum of
human relations which have been poetically and rhetorically intensified, transferred, and embellished,
and which, after long usage, seem to a people to be fixed, canonical, and binding. Truths are illusions
which we have forgotten are illusions—they are metaphors that have become worn out and have been
drained of sensuous force, coins which have lost their embossing and are now considered as metal and no
longer as coins.”
135
This leitmotif runs though Nietzsche’s works; in Thus Spoke Zarathushtra, he attributes this contempt to
the “prophet” who reformed the Indo-European Persian religion, but who in Nietzsche’s work is a
personification of the author having hardly anything to do with the original character. For example,
Zarathushtra 28 (“The Rabble”) begins:
“LIFE is a well of delight; but where the rabble also drink, there all fountains are poisoned.”
(Nietzsche, Friedrich, Nietzsche, Friedrich, 1891, adaptation by Paul Douglas of the Thomas Common trans.,
this English ed. undated.)
136
Below in the regular text the way in which Vattimo structures his own so-called “postmodern” theory in
terms of his two readings of Nietzsche is explained. With regard to Heidegger, his position is related to
an interpretation of the latter’s view of the crisis of humanism. Heidegger views the disposition of our
technological world (Ge-Stell) as the most advanced version and logical conclusion of Western
metaphysics, for rationalism always implied the ideal of achieving rational domination over a world of
objects, which is the project of technology. This is why the defense by humanism of values such as
freedom, truth or reason cannot convince us that these values may represent an alternative in face of
technological values: they share the same metaphysical base and characteristics; both humanism and
technology are metaphysics. Hence the present crisis is not due to the fact that technology threatens the
values of humanism; on the contrary, it is due to the fact that technology has made patent the result to
which these values inevitably lead.
137
Baudrillard agrees that Vattimo is wrong in believing that thought has the capacity of making of the world
a fiction for us—and hence in viewing this as a philosophical task. However, this is not due to a
realization by Baudrillard that unassisted thought cannot carry out this transformation, and that in order
to carry it out we must resort to traditional means of the Paths of Awakening, which must allow us to go
beyond the delusory valuation of thought in the state of Communion, and manipulate our delusorily
valued thoughts in the state of post-Communion. Baudrillard’s critique lies in the fact that he sees the
project enunciated by Vattimo as being too centered on the subject, and as involving a gross
underestimation of the world, fictitious or not, that we try to represent or capture objectively. However,
Baudrillard’s objections and theses in this regard seem even more pedestrian than those of Vattimo’s—
and so if he is right in claiming that the pensiero debole (weak thought) is truly a way of thinking proper
of a feeble mind (Baudrillard [1996a], p. 36), then his own thought must come from an even feebler
mind. What is the point of noting that even computers have viruses?! (Vattimo’s pensiero debole is the
means that author proposes in order to achieve the “fabulation of the world.” It is supposed to be proper
of a consciousness that has freed itself from the belief in metaphysical, technological or humanistic
realities, and which undermines the efforts of technological civilization to impose its own version of the
world as the only possible reality, which at once weakens the pretensions of effectiveness of
technological reality and rejects the nostalgia for the humanistic pretense of placing the human subject at
the center, controlling and ordering the world of objects: it attempts to experience science and technology
as contaminated by other languages of contemporary culture, showing that the world may be made to
become “lighter” if we just realize that there is no clear-cut division into truth, on the one hand, and
fiction, information and images, on the other (Vattimo [1988], p. 29). (It may be interesting to note that,
in Baudrillard’s view, there may be no need to fable history, for history as we understand it is a
simulation insofar as it presents itself as a model of time resting on the concept of an end, which at the
1042
same time it keeps in suspense, and insofar as it can only take place in this sort of simulated time. He
notes that each and everyone is conscious of the arbitrariness, of the artificial character of time and
history (1994a, p. 8.)
138
Cf. note 50 to this chapter.
139
Cf. note 50 to this chapter.
140
Teleonomy demonstrates that the human system, with its programs and metaprograms, is oriented toward
Awakening: this is evidenced by the dynamics of the relations between primary process and secondary
process—and in particular by the Thanatos which, as understood by Gregory Bateson (1972), is an
inherent element of this dynamics. Bateson interpreted this teleonomy in terms of the concept of
teleology; though this is legitimate, postmodern thinkers reject teleology as such, which they see as
belonging to the old metaphysics that has supposedly been surpassed. (The true logical error would lie in
positing a final cause [to telos, to ou enecha] as an efficient cause [earche tos metaboles].)
141
Cf. note 50 to this chapter.
142
The Mahayana holds that good an evil depend on intention, and intention is generally held to depend on
consciousness. Besides, according to the Yogachara or Chittamatra School of Mahayana philosophy, the
maturation of good and bad karmas depends on the continuity of consciousness. This is why in
Bodhicharyavatara 9: 11 the Madhyamika master Shantideva offered us the following dialogue (1996, p.
116):
“[Proponent of the Chittamatra view] If consciousness does not exist, then there is no evil in, for example,
murdering an illusory man.
“[Proponent of the Madhyamika view:] On the contrary, [even though there is no consciousness], insofar as
one is endowed with the illusion of consciousness, [depending on intentions] good and evil arise.”
143
As noted in the regular text, according to Vattimo, the increased awareness of a plurality of views of
history that is partly due to the media explosion, puts an end to our capacity to view history as
unilinear—which in his view represents the end of history inherent in the notion of postmodernity.
Parallel to this, the radicalization of nihilism makes it impossible to believe anything to be absolutely
true—which leads to the famous “fabulation of the world” that he propounds. Baudrillard, for his part,
asserts that technology absorbs the illusion and vision of the world, turning it into tele-reality, in “real
time” and in vitality which, according to him, is the antithesis of illusion: it is total disillusion and
disappearance. This is so because the technology of the media, through its vicious process, exhausts our
faith in reality and at the same time teaches us to question each and every image and commentary, giving
rise to indifference, distance, skepticism and apathy. However, the thesis that the technology of the media
teaches us to question each and every image and commentary does not seem to be correct, for recent
research in France has shown that watching TV tends to inhibit the functioning of the cerebral cortex,
making it difficult for us to take a distance with regard to whatever is broadcasted and criticize it. What
media such as TV actually do is to generate apathy in face of all the horrors the news and other programs
show; this may seem to sustain views such as Vattimo, for apathy before events may seem similar to
what one is supposed to experience before an illusion that one knows to be an illusion. However, it is not
at all the same, for the experience of the superior bodhisattva in the post-Contemplation state, rather than
being pervaded by apathy, is pervaded by compassion.
144
In Eliade (1959), we read:
“If we observe the general behavior of archaic man, we are struck by the following fact: neither the objects of
the external world nor human acts, properly speaking, have any autonomous intrinsic value. Objects or
acts acquire a value, and in so doing become real, because they participate, after one fashion or another,
in a reality that transcends them...
“Nutrition is not a simple physiological operation; it renews a communion. Marriage and the collective orgy
echo mythical prototypes; they are repeated because they were consecrated in the beginning (‘in those
days’, in illo tempore) by gods, ancestors, or heroes.
“In the particulars of his conscious behavior, the ‘primitive’, the archaic man, acknowledges no act which has
not been previously posited and lived by someone else... What he does has been done before. His life is
the ceaseless repetition of gestures initiated by others... [His] gesture acquires meaning, reality, solely to
the extent to which it repeats a primordial act.”
145
Cf. note 53 to this chapter.
146
Nietzsche—who referred to the divorce of human beings from nature as “human degeneration”—seems to
have intuited that history developed as a process of reductio ad absurdum, for he asserted nihilism to be
1043
developing toward an extreme (i.e., a threshold) at which it could be overcome, and insisted that “man”
(i.e., the human) was “something that must be overcome.” Though this idea of Nietzsche is of utmost
importance in our time, when the “human” cycle of evolution is about to come to an end and our survival
depends on the transition to the following cycle, and though part of Nietzsche’s characterization of the
superhuman—which I prefer to call the posthuman, which does not give the idea of an improvement, of
something better than the condition that preceded it—seems quite admissible, admission of other aspects
of this characterization would be extremely dangerous.
For example, the characterization of this evolutional stage in terms of “will for power” (Wille zur Macht)
could be interpreted as meaning that in it the impulse to dominate nature and other human beings should
continue to prevail. Likewise, the idea that beings in the stage in question will oppose the “feminine
values of Christianity,” such as compassion, love and so on, is totally inverted, for the posthuman would
embody what these values represent—which implies, however, that they will no longer be values as such
(cf. Capriles [1993, 1994], as well as the second chapter of Capriles [1994a]). Furthermore, for the
posthuman no traits would be exclusively “feminine” or “masculine,” for males would reintegrate their
femininity, no longer projecting it outside themselves, and females would reintegrate their masculinity,
no longer projecting it outside themselves.
As suggested by both the title and the contents of Francis Bacon’s 1603 work The Masculine Birth of Time,
Or the Great Instauration of the Dominion of Man over the Universe, in which he wrote: “I am come in
very truth leading Nature to you, with all her children, to bind her to your service and to make her your
slave... So may I succeed in my only earthly wish, namely to stretch the deplorably narrow limits of
man’s dominion over the universe to their promised bounds,” and as reiterated again and again by
ecofeminism, in Chinese terms the scientific-technological project that has led us to the verge of selfdestruction may be said to be an extremely yang project aiming at the domination of nature, which has
generally been seen as female. However, this project and that which gave rise to it will not be surpassed
by ying values and female power coming to prevail; it will only be surpassed when yin and yang, female
and male, be integrated in the holistic tao vision (i.e., in the condition of aletheia, Communion, the Selfqua-Path or however we call it) that embraces and harmonizes the opposites.
Since Nietzsche was such a rabid elitist, since he eulogized the German, and since Hitler praised him, some
identify with Nazism the thesis of a transition from the human to the posthuman. However, both
biological evolutionism and human teleonomy seems to imply that, just as the human arose out of the
prehuman, it would have to give rise to the posthuman, which would replace it. In the words of the XIIIth
century Persian sage Jalal-ud-din Rumi (retranslated into English from Rumi [1983]):
“I died as mineral and lived as vegetable;
having died as vegetable, I became animal;
coming out from the animal, l became a human being...
tomorrow I will be an angel, and then I will rise above the angels.
What you cannot imagine, that I will be..”
Except for the strident tone characteristic of Nietzsche and his pathological contempt for common human
beings of his age, what the German philologist and philosopher wrote in the following passage—in
which he implied that the contamination inherent in our present condition must be cleansed by
madness—is not essentially different from the above (adapted by this author from Nietzsche, Friedrich,
1891, adaptation by Paul Douglas of the Thomas Common trans., this English ed. undated, Zarathushtra
Prologue 3-4):
“I bring you the Superman! Mankind is something to be surpassed. What have you done to surpass mankind?
“All beings so far have created something beyond themselves. Do you want to be the ebb of that great tide,
and revert back to the beast rather than surpass mankind? What is the ape to a man? A laughing stock, a
thing of shame. And just so shall a man be to the Superman: a laughing stock, a thing of shame. You
have evolved from worm to man, but much within you is still worm. Once you were apes, yet even now
man is more of an ape than any of the apes.
“Even the wisest among you is only a confusion and hybrid of plant and phantom. But do I ask you to
become phantoms or plants?
“Behold, I bring you the Superman! The Superman is the meaning of the earth. Let your will say: The
Superman shall be the meaning of the earth! I beg of you my brothers, remain true to the earth, and
believe not those who speak to you of otherworldly hopes! Poisoners are they, whether they know it or
1044
not. Despisers of life are they, decaying ones and poisoned ones themselves, of whom the earth is weary:
so away with them!
“Once blasphemy against God was the greatest blasphemy; but God died, and those blasphemers died along
with him. Now to blaspheme against the earth and to rank love for the [fictitious otherworldly reality]
higher than the meaning of the earth, is the greatest sin!
“Once the soul looked contemptuously upon the body, and then that contempt was the supreme thing: the soul
wished the body lean, monstrous, and famished. Thus it thought to escape from the body and the earth.
But that soul was itself lean, monstrous, and famished; and cruelty was the delight of this soul! So my
brothers, tell me: What does your body say about your soul? Is not your soul poverty and filth and
miserable self-complacency?
“In truth, man is a polluted river. One must be a sea to receive a polluted river without becoming defiled. I
bring you the Superman! He is that sea; in him your great contempt can be submerged.
“What is the greatest thing you can experience? It is the hour of your greatest contempt. The hour in which
even your happiness becomes loathsome to you, and so also your reason and virtue.
“The hour when you say: ‘What good is my happiness? It is poverty and filth and miserable selfcomplacency. But my happiness should justify existence itself’
“The hour when you say: ‘What good is my reason? Does it long for knowledge as the lion for his prey? It is
poverty and filth and miserable self-complacency!’
“The hour when you say: ‘What good is my virtue? It has not yet driven me mad! How weary I am of my
good and my evil! It is all poverty and filth and miserable self-complacency!’
“The hour when you say: ‘What good is my justice? I do not see that I am filled with fire and burning coals.
But the just are filled with fire and burning coals!’
“The hour when you say: ‘What good is my pity? Is not pity the cross on which he is nailed who loves man?
But my pity is no crucifixion!’
“Have you ever spoken like this? Have you ever cried like this? Ah! If only I had heard you cry this way! “It
is not your sin — it is your moderation that cries to heaven; your very sparingness in sin cries to heaven!
“Where is the lightning to lick you with its tongue? Where is the madness with which you should be
cleansed?
“Behold, I bring you the Superman! He is that lightning; he is that madness!...
“Man is a rope stretched between the animal and the Superman—a rope over an abyss.
“A dangerous crossing, a dangerous wayfaring, a dangerous looking-back, a dangerous trembling and
halting.”
Thus it is clear that Vattimo’s supposedly postmodern reading of Nietzsche does not correspond to the
Zarathushtra, which rejects otherworldly values but eulogizes worldly ones, asking us to remain true to
the earth and ignore those who speak of otherworldly hopes, and telling us now the greatest sin is to
blaspheme against the earth and to rank love for the [fictitious otherworldly reality] higher than the
meaning of the earth.
So there is no doubt we must enter a new stage of evolution, but what does this involve? Since the transition
from hominid to human involved a leap in intellectual capacity depending on the increase of the human
skull’s size, naïve biological evolutionism would likely assume that the transition to the next stage of our
evolution would involve a similar biological mutation. However, this is not the case, to begin with
because the size and hence the capacity of the human skull cannot increase any further, as in our species
the first cervical vertebra has welded with the opening at the base of the skull that, during a great deal of
our phylogenetic development, made it possible for the skull to grow. Though in itself this does not mean
human intelligence could not continue to increase, for it is well known that until today most of us have
used only a small proportion of our brain, statistics show the IQ of US citizens has progressively
diminished since the first nuclear test at Alamo Gordo, and though IQ is a culturally conditioned
measurement that may not be equated with intelligence, it is clear that many variables in today’s world
could further degenerative biological tendencies.
And, in fact, as asserted by the nineteenth and twentieth century Indian politician, philosopher and mystic
Shri Aurobindo, what would characterize what he called the superhuman—but which as noted above I
prefer to call the posthuman—would not be a sharper intelligence; the posthuman would be the result of
the widespread recovery of the capacity of Communion, and therefore of the self-liberation of delusorily
valued thought. Shri Aurobindo’s disciple, Satprem (1973), writes concerning his teacher’s views with
regard to the transition our species is supposed to undergo at the end of the cosmic cycle or aeon:
1045
“‘Superhumanhood’, says Sri Aurobindo, ‘is not man after climbing to his own natural zenith, not a superior
degree of human greatness, knowledge, power, intelligence, will... genius... saintliness, love, purity or
perfection’. It is SOMETHING ELSE, another vibration of being, another consciousness.”
Within Christianity, Jesuit paleontologist-geologist-philosopher Pierre Teilhard de Chardin claimed that the
human “has not been completed, but needs to be surpassed, completed;” having arrived at point alpha,
now we must arrive at point omega, represented by the “Christogenesis,” corresponding to the rise of the
superhuman (for a comparison between the thought of Aurobindo and that of Teilhard, cf. Mourgue
[1993]). From this we may infer that Jesus called himself the “Son of Man” because his “Christic” state
should characterize the descendants-successors of human beings. However, as conceived by Teilhard,
this transition could neither be undertaken individually or be limited to an elite—though in his view it
would be promoted by an elite (Teilhard de Chardin [1974], p. 296; what here is in parentheses is a note
in Teilhard’s book; the translation into English of the excerpt is my own):
“The way out of the world, the doors of the future, the entrance to the superhuman, do not open forth either to
some privileged beings or to a single people chosen among all peoples! They will only yield to the thrust
of all together, in a direction in which, also together (though only thanks to the influence and leadership
of a few: an elite) we may unite and become a whole within a spiritual renewal of the Earth.”
Also Michel Foucault insisted that “man” must be overcome; however, when Foucault says “man,” he is
referring to a “historical device” produced by a particular knowledge/power over one and a half century
ago, rather than referring to the “human condition” in general—as is the case with Nietzsche, Teilhard
and Aurobindo. At any rate, there seems to be no alternative to the surpassing of the human condition (in
the Sartrean sense of the term, in the humanist sense denounced by Heidegger in which homo
humanus=homo romanus, and in Foucault’s sense, but certainly not in the biological sense), for as we
have seen repeatedly, this condition has now completed its reductio ad absurdum, and if it is not
surpassed altogether, our species will cause its own destruction. As Fritjof Capra expressed it (Capra
[1982]), we have come to a crossroads, and ahead to paths open: the one leading to the Bomb and the one
leading to the Buddha. In Teilhard’s terminology, the paths that open ahead of us are the one leading to
nothingness and the one leading to the Christ (by this I am not endorsing Teilhard’s philosophy, which I
have criticized elsewhere).
For Buddhism, in order to achieve Awakening or liberation we must “find ourselves in the human condition,”
which does not mean simply that our bodies must have a human shape, but that we must possess the
particular conditions of the psychological state Buddhism calls “human.” This seems to be the meaning
of the assertion of Tenzin Gyamtso’s, the fourteenth Dalai Lama, that we must “become fully human”
(Dalai Lama, Fourteenth, Tenzin Gyamtso, 1990); however, it would also be admissible to assert that so
far we have been in the process of transition to the human condition, and that becoming fully human is
the same that so far I have been referring to as “achieving the transition to the posthuman”—and
understand the Fourteenth Dalai Lama’s statement in this sense.
147
Despite their being too general and not referring to particular authors, as though there were a single
postmodern thought, I find there are some interesting points in the (later expunged) note Mayda Hočevar
had originally appended to a paper she read in a Conference on Postmodernity:
“And here I find it necessary to refer to some “postmodern” theses the sensuality and beauty of which
initially enthrall me, but which, as I see the other edge of the sword, make me shake with fury:
“1. The pretension of “postmodernism” not to believe itself possessor of the truth. I wander, where are, how
can we find, of how can we cause to be born, these human beings who do not believe themselves to be
possessors of the truth?
“2. Relativism without a frame of reference: any relativism that does not refer to an absolute is doomed to
self-destruction.
“3. The variety of postmodernism qua set of alternative criteria before modernity, which nonetheless rejects
the adoption of political, social and individual positions before the global problems that we face.
“4. Doing away with meaning and with the legitimization of human actions, by individuals for whom it is not
at all the same to eat or not to eat.
“5. The rejection of univocal axiological criteria without changing human beings so that they do not need
such criteria.
“6. The claim of going beyond ideologies: are not the injunctions of going beyond values, of respecting local
narratives instead of producing metanarratives, and so on, clearly ideological?
1046
“7. The assertion that I am one among many, with my value-system, my language, my beliefs, and that I must
show the same respect and tolerance to all, including minorities, in the context of a society based on the
benefit of some at the expense of others, and which we are supposed not to change insofar as it must be
respected too.
“8. See Habermas, p. 17 (Ana Julia). (?!)
148
Though Nicholas of Cusa died some eleven years after the supposed beginning of the “modern age,” he is
generally regarded as a premodern philosopher.
149
Nicholas of Cusa noted that “our intellect, which is not the truth, never grasps the truth with such precision
that it could not be comprehended with infinitely greater precision” (De Docta Ignorantia I, 3), and
compared the approximation to truth characteristic of the mind that is subject to the principle of
noncontradiction to a polygon inscribed in a circle that increases its number of sides without ever
becoming a circle. Therefore knowledge is at best conjecture (coniectura). However, speculative reason
can have an intellectual intuition (mystical in nature) that allows us to surpass the principle of
noncontradiction and thus know the coincidentia oppositorum characteristic of reality, but especially of
the infinite God, which could be compared to a circle having a radium infinite in size: in such a circle the
curve would manifest coincidently with the strait line—so that in Him all opposition is reconciled in
perfect unity. Plotinus, the other Neo-Platonists, Augustine of Hippo, Boethius, Pseudo-Dionysius,
Anselm of Canterbury, the members of the School of Chartres, John of Fidanza (Saint Bonaventure),
Meister Eckhart and many others also accepted a similar mystical intuition.
Furthermore, Plato, source of Western metaphysics, was a decidedly mythic thinker who posited eternal
nonmaterial eidos that were know by some souls before birth, and a method for remembering these eidos
that, despite being based on dialectic, was mystic in that it was a form of knowledge different from the
one that is acquired through the senses. The problem with Plato was that his mysticism was of Orphic
origin and thus was based in a poisonous antisomatic dualism.
150
Lyotard (1994, pp. 31-32) writes:
“By metanarrative or grand narrative I understand precisely the narratives that have a legitimating or
legitimating function. Its decadence does not forestall the existence of thousands of stories, small or not
so small, that keep weaving the fabric of everyday life. “
Lyotard spares from his criticisms the privilege literary genre of small relates, which in his view escapes the
legitimation crisis.
“Surely these narratives escape the crisis, but this is due to the fact that they have neither had a legitimation
value.”
This, however, does not mean that all popular proverbs maintain their legitimacy: in his view, postmodernity
is also the end of the people as the king of stories.
151
This does not mean, however, that such systems may refer to tables as tigers: as we have seen, in the postContemplation state, bodhisattvas are aware that it is just as valid to say the table is a table as to say it is
not a table; however, unless it be as skillful means in a particular situation, they would never claim the
table to be a tiger.
152
This is what I have attempted to do in all that I have written in my lifetime, even though I would not
pretend to have produced anything definitive in this regard.
153
Walter A. Kauffman (1950, pp. 270 et seq.) showed Nietzsche did not coin the term Übermensch, for
hyperanthropos is found in Luciano’s writings in the second century CE (in Kataplous, 16), which
Nietzsche studied and to which he made frequent references in his philologica. Furthermore, in German
the term had already been used by Heinrich Müller, Herder, Jean Paul and Goethe.
1047